HBVdb

Dataset for protein HBe of genotype C

[Download (right click)] [Alignment] [Repertoires]

2115 sequence(s)

>gnl|hbvpro|AB014360_HBe_P-C Product feature CHAIN AB014360_HBe_P-C of FT:mat_peptide AB014360_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D01HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014361_HBe_P-C Product feature CHAIN AB014361_HBe_P-C of FT:mat_peptide AB014361_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 02D02HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPNA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014362_HBe_P-C Product feature CHAIN AB014362_HBe_P-C of FT:mat_peptide AB014362_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 03D03HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014363_HBe_P-C Product feature CHAIN AB014363_HBe_P-C of FT:mat_peptide AB014363_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04D04HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVCEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB014364_HBe_P-C Product feature CHAIN AB014364_HBe_P-C of FT:mat_peptide AB014364_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 05D05HCC). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALHREALESPGHCTPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014365_HBe_P-C Product feature CHAIN AB014365_HBe_P-C of FT:mat_peptide AB014365_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D06HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014367_HBe_P-C Product feature CHAIN AB014367_HBe_P-C of FT:mat_peptide AB014367_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08D08HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|AB014368_HBe_P-C Product feature CHAIN AB014368_HBe_P-C of FT:mat_peptide AB014368_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09D09HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014369_HBe_P-C Product feature CHAIN AB014369_HBe_P-C of FT:mat_peptide AB014369_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10D10HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB014372_HBe_P-C Product feature CHAIN AB014372_HBe_P-C of FT:mat_peptide AB014372_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13D13HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014373_HBe_P-C Product feature CHAIN AB014373_HBe_P-C of FT:mat_peptide AB014373_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 14D14HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MXLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIICWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014374_HBe_P-C Product feature CHAIN AB014374_HBe_P-C of FT:mat_peptide AB014374_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 15D15HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014376_HBe_P-C Product feature CHAIN AB014376_HBe_P-C of FT:mat_peptide AB014376_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17T02HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014377_HBe_P-C Product feature CHAIN AB014377_HBe_P-C of FT:mat_peptide AB014377_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18T03HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTSGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014378_HBe_P-C Product feature CHAIN AB014378_HBe_P-C of FT:mat_peptide AB014378_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19Y01HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTP
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014379_HBe_P-C Product feature CHAIN AB014379_HBe_P-C of FT:mat_peptide AB014379_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 20Y02HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014380_HBe_P-C Product feature CHAIN AB014380_HBe_P-C of FT:mat_peptide AB014380_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 21Y03HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014387_HBe_P-C Product feature CHAIN AB014387_HBe_P-C of FT:mat_peptide AB014387_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28Y10HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXDMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB014390_HBe_P-C Product feature CHAIN AB014390_HBe_P-C of FT:mat_peptide AB014390_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 31Y13HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB014391_HBe_P-C Product feature CHAIN AB014391_HBe_P-C of FT:mat_peptide AB014391_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 32Y14HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB014394_HBe_P-C Product feature CHAIN AB014394_HBe_P-C of FT:mat_peptide AB014394_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35Y17HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLADPASRDLVVNYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB014395_HBe_P-C Product feature CHAIN AB014395_HBe_P-C of FT:mat_peptide AB014395_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 36Y18HCC). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026811_HBe_P-C Product feature CHAIN AB026811_HBe_P-C of FT:mat_peptide AB026811_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Feb.). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026812_HBe_P-C Product feature CHAIN AB026812_HBe_P-C of FT:mat_peptide AB026812_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;98.May). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026813_HBe_P-C Product feature CHAIN AB026813_HBe_P-C of FT:mat_peptide AB026813_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Sep.). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026814_HBe_P-C Product feature CHAIN AB026814_HBe_P-C of FT:mat_peptide AB026814_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Donor 3;98.May). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB026815_HBe_P-C Product feature CHAIN AB026815_HBe_P-C of FT:mat_peptide AB026815_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 2:full). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB031262_HBe_P-C Product feature CHAIN AB031262_HBe_P-C of FT:mat_peptide AB031262_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV VietA-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033550_HBe_P-C Product feature CHAIN AB033550_HBe_P-C of FT:mat_peptide AB033550_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NDR260). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033551_HBe_P-C Product feature CHAIN AB033551_HBe_P-C of FT:mat_peptide AB033551_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK300). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033552_HBe_P-C Product feature CHAIN AB033552_HBe_P-C of FT:mat_peptide AB033552_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK494). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033553_HBe_P-C Product feature CHAIN AB033553_HBe_P-C of FT:mat_peptide AB033553_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK619). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB033556_HBe_P-C Product feature CHAIN AB033556_HBe_P-C of FT:mat_peptide AB033556_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AK66). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB042282_HBe_P-C Product feature CHAIN AB042282_HBe_P-C of FT:mat_peptide AB042282_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGKLMNLATWVGSNLEDPASRELLVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB042283_HBe_P-C Product feature CHAIN AB042283_HBe_P-C of FT:mat_peptide AB042283_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB042285_HBe_P-C Product feature CHAIN AB042285_HBe_P-C of FT:mat_peptide AB042285_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
TQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYLEALESPEHCSPH
HTALRQAILCWDELMKLATWVGGNLDDQASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB050018_HBe_P-C Product feature CHAIN AB050018_HBe_P-C of FT:mat_peptide AB050018_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB074047_HBe_P-C Product feature CHAIN AB074047_HBe_P-C of FT:mat_peptide AB074047_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRSRRSQSRGSQC
>gnl|hbvpro|AB074755_HBe_P-C Product feature CHAIN AB074755_HBe_P-C of FT:mat_peptide AB074755_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th44). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESSEHCSPH
HTALRQAILCWGEMMNLATWVGSNLQDPASRELVVSYVNVNMGLNIRQLLWFHISCLTFGTETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB074756_HBe_P-C Product feature CHAIN AB074756_HBe_P-C of FT:mat_peptide AB074756_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th55). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESSEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB105173_HBe_P-C Product feature CHAIN AB105173_HBe_P-C of FT:mat_peptide AB105173_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALETPEHSSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB105174_HBe_P-C Product feature CHAIN AB105174_HBe_P-C of FT:mat_peptide AB105174_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 60). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111112_HBe_P-C Product feature CHAIN AB111112_HBe_P-C of FT:mat_peptide AB111112_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLSFLPSDFFPSXRDLLDTASALYREALESPEHXSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111116_HBe_P-C Product feature CHAIN AB111116_HBe_P-C of FT:mat_peptide AB111116_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111117_HBe_P-C Product feature CHAIN AB111117_HBe_P-C of FT:mat_peptide AB111117_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111118_HBe_P-C Product feature CHAIN AB111118_HBe_P-C of FT:mat_peptide AB111118_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWAELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRQGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111119_HBe_P-C Product feature CHAIN AB111119_HBe_P-C of FT:mat_peptide AB111119_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111120_HBe_P-C Product feature CHAIN AB111120_HBe_P-C of FT:mat_peptide AB111120_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111121_HBe_P-C Product feature CHAIN AB111121_HBe_P-C of FT:mat_peptide AB111121_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111122_HBe_P-C Product feature CHAIN AB111122_HBe_P-C of FT:mat_peptide AB111122_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGEMMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111123_HBe_P-C Product feature CHAIN AB111123_HBe_P-C of FT:mat_peptide AB111123_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111124_HBe_P-C Product feature CHAIN AB111124_HBe_P-C of FT:mat_peptide AB111124_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111125_HBe_P-C Product feature CHAIN AB111125_HBe_P-C of FT:mat_peptide AB111125_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB111946_HBe_P-C Product feature CHAIN AB111946_HBe_P-C of FT:mat_peptide AB111946_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT103). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALFREALESPEHCTPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112063_HBe_P-C Product feature CHAIN AB112063_HBe_P-C of FT:mat_peptide AB112063_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT101). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCLRPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALFREALESPEHCTPH
HTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB112065_HBe_P-C Product feature CHAIN AB112065_HBe_P-C of FT:mat_peptide AB112065_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT140). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNSEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112066_HBe_P-C Product feature CHAIN AB112066_HBe_P-C of FT:mat_peptide AB112066_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY624). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVLSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRKRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112348_HBe_P-C Product feature CHAIN AB112348_HBe_P-C of FT:mat_peptide AB112348_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY656). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGGLWGMDIDPYKVFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112408_HBe_P-C Product feature CHAIN AB112408_HBe_P-C of FT:mat_peptide AB112408_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY683). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFEFFLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASEELLSFLPSDYFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112471_HBe_P-C Product feature CHAIN AB112471_HBe_P-C of FT:mat_peptide AB112471_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH123). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPNKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB112472_HBe_P-C Product feature CHAIN AB112472_HBe_P-C of FT:mat_peptide AB112472_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH124). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPNKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRIPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB113875_HBe_P-C Product feature CHAIN AB113875_HBe_P-C of FT:mat_peptide AB113875_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFMPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB113876_HBe_P-C Product feature CHAIN AB113876_HBe_P-C of FT:mat_peptide AB113876_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFMPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB113879_HBe_P-C Product feature CHAIN AB113879_HBe_P-C of FT:mat_peptide AB113879_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB117758_HBe_P-C Product feature CHAIN AB117758_HBe_P-C of FT:mat_peptide AB117758_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CB10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLCGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB176643_HBe_P-C Product feature CHAIN AB176643_HBe_P-C of FT:mat_peptide AB176643_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-NK1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB182589_HBe_P-C Product feature CHAIN AB182589_HBe_P-C of FT:mat_peptide AB182589_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CH:Mat-Ko). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLVLGWLGGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHGSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195942_HBe_P-C Product feature CHAIN AB195942_HBe_P-C of FT:mat_peptide AB195942_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195943_HBe_P-C Product feature CHAIN AB195943_HBe_P-C of FT:mat_peptide AB195943_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195944_HBe_P-C Product feature CHAIN AB195944_HBe_P-C of FT:mat_peptide AB195944_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195945_HBe_P-C Product feature CHAIN AB195945_HBe_P-C of FT:mat_peptide AB195945_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|AB195949_HBe_P-C Product feature CHAIN AB195949_HBe_P-C of FT:mat_peptide AB195949_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195952_HBe_P-C Product feature CHAIN AB195952_HBe_P-C of FT:mat_peptide AB195952_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHICCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195953_HBe_P-C Product feature CHAIN AB195953_HBe_P-C of FT:mat_peptide AB195953_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHICCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB195954_HBe_P-C Product feature CHAIN AB195954_HBe_P-C of FT:mat_peptide AB195954_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHICCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198076_HBe_P-C Product feature CHAIN AB198076_HBe_P-C of FT:mat_peptide AB198076_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198077_HBe_P-C Product feature CHAIN AB198077_HBe_P-C of FT:mat_peptide AB198077_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198078_HBe_P-C Product feature CHAIN AB198078_HBe_P-C of FT:mat_peptide AB198078_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198079_HBe_P-C Product feature CHAIN AB198079_HBe_P-C of FT:mat_peptide AB198079_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198080_HBe_P-C Product feature CHAIN AB198080_HBe_P-C of FT:mat_peptide AB198080_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198081_HBe_P-C Product feature CHAIN AB198081_HBe_P-C of FT:mat_peptide AB198081_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198082_HBe_P-C Product feature CHAIN AB198082_HBe_P-C of FT:mat_peptide AB198082_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB198083_HBe_P-C Product feature CHAIN AB198083_HBe_P-C of FT:mat_peptide AB198083_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB202071_HBe_P-C Product feature CHAIN AB202071_HBe_P-C of FT:mat_peptide AB202071_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIMCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB202072_HBe_P-C Product feature CHAIN AB202072_HBe_P-C of FT:mat_peptide AB202072_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205123_HBe_P-C Product feature CHAIN AB205123_HBe_P-C of FT:mat_peptide AB205123_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CN578-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205124_HBe_P-C Product feature CHAIN AB205124_HBe_P-C of FT:mat_peptide AB205124_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TJ3-1-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVDVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205125_HBe_P-C Product feature CHAIN AB205125_HBe_P-C of FT:mat_peptide AB205125_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VH34-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB222714_HBe_P-C Product feature CHAIN AB222714_HBe_P-C of FT:mat_peptide AB222714_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB222715_HBe_P-C Product feature CHAIN AB222715_HBe_P-C of FT:mat_peptide AB222715_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7M). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB241110_HBe_P-C Product feature CHAIN AB241110_HBe_P-C of FT:mat_peptide AB241110_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB241111_HBe_P-C Product feature CHAIN AB241111_HBe_P-C of FT:mat_peptide AB241111_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246344_HBe_P-C Product feature CHAIN AB246344_HBe_P-C of FT:mat_peptide AB246344_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246345_HBe_P-C Product feature CHAIN AB246345_HBe_P-C of FT:mat_peptide AB246345_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246346_HBe_P-C Product feature CHAIN AB246346_HBe_P-C of FT:mat_peptide AB246346_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB247916_HBe_P-C Product feature CHAIN AB247916_HBe_P-C of FT:mat_peptide AB247916_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB250109_HBe_P-C Product feature CHAIN AB250109_HBe_P-C of FT:mat_peptide AB250109_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IH030213). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB288026_HBe_P-C Product feature CHAIN AB288026_HBe_P-C of FT:mat_peptide AB288026_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALREAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB299858_HBe_P-C Product feature CHAIN AB299858_HBe_P-C of FT:mat_peptide AB299858_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300359_HBe_P-C Product feature CHAIN AB300359_HBe_P-C of FT:mat_peptide AB300359_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300361_HBe_P-C Product feature CHAIN AB300361_HBe_P-C of FT:mat_peptide AB300361_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGGSVEPLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRKRTQSRESQC
>gnl|hbvpro|AB300362_HBe_P-C Product feature CHAIN AB300362_HBe_P-C of FT:mat_peptide AB300362_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300363_HBe_P-C Product feature CHAIN AB300363_HBe_P-C of FT:mat_peptide AB300363_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300365_HBe_P-C Product feature CHAIN AB300365_HBe_P-C of FT:mat_peptide AB300365_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300368_HBe_P-C Product feature CHAIN AB300368_HBe_P-C of FT:mat_peptide AB300368_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300372_HBe_P-C Product feature CHAIN AB300372_HBe_P-C of FT:mat_peptide AB300372_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient14). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB362932_HBe_P-C Product feature CHAIN AB362932_HBe_P-C of FT:mat_peptide AB362932_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367392_HBe_P-C Product feature CHAIN AB367392_HBe_P-C of FT:mat_peptide AB367392_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPPDFFPSVRDLIDTASALYREALESPEHHSPH
HTALRQGILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367394_HBe_P-C Product feature CHAIN AB367394_HBe_P-C of FT:mat_peptide AB367394_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 3/Adefovir-treated Pt. 8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367395_HBe_P-C Product feature CHAIN AB367395_HBe_P-C of FT:mat_peptide AB367395_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367396_HBe_P-C Product feature CHAIN AB367396_HBe_P-C of FT:mat_peptide AB367396_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367397_HBe_P-C Product feature CHAIN AB367397_HBe_P-C of FT:mat_peptide AB367397_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367398_HBe_P-C Product feature CHAIN AB367398_HBe_P-C of FT:mat_peptide AB367398_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 7/Adefovir-treated Pt. 20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAFLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367399_HBe_P-C Product feature CHAIN AB367399_HBe_P-C of FT:mat_peptide AB367399_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 8/Adefovir-treated Pt. 29). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367401_HBe_P-C Product feature CHAIN AB367401_HBe_P-C of FT:mat_peptide AB367401_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 10/Adefovir-treated Pt. 9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB367402_HBe_P-C Product feature CHAIN AB367402_HBe_P-C of FT:mat_peptide AB367402_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367403_HBe_P-C Product feature CHAIN AB367403_HBe_P-C of FT:mat_peptide AB367403_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 12/Adefovir-treated Pt. 17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367407_HBe_P-C Product feature CHAIN AB367407_HBe_P-C of FT:mat_peptide AB367407_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 16/Adefovir-treated Pt. 11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367408_HBe_P-C Product feature CHAIN AB367408_HBe_P-C of FT:mat_peptide AB367408_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 17/Adefovir-treated Pt. 14). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367409_HBe_P-C Product feature CHAIN AB367409_HBe_P-C of FT:mat_peptide AB367409_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 18). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVLASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367410_HBe_P-C Product feature CHAIN AB367410_HBe_P-C of FT:mat_peptide AB367410_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 19/Adefovir-treated Pt. 19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367411_HBe_P-C Product feature CHAIN AB367411_HBe_P-C of FT:mat_peptide AB367411_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367412_HBe_P-C Product feature CHAIN AB367412_HBe_P-C of FT:mat_peptide AB367412_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 21). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367413_HBe_P-C Product feature CHAIN AB367413_HBe_P-C of FT:mat_peptide AB367413_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 22/Adefovir-treated Pt. 4). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRELIDTASALYREALESPEHCSPH
HTALRQALLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367414_HBe_P-C Product feature CHAIN AB367414_HBe_P-C of FT:mat_peptide AB367414_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 23/Adefovir-treated Pt. 3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367416_HBe_P-C Product feature CHAIN AB367416_HBe_P-C of FT:mat_peptide AB367416_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367417_HBe_P-C Product feature CHAIN AB367417_HBe_P-C of FT:mat_peptide AB367417_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 26). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367418_HBe_P-C Product feature CHAIN AB367418_HBe_P-C of FT:mat_peptide AB367418_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 27/Adefovir-treated Pt. 21). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367422_HBe_P-C Product feature CHAIN AB367422_HBe_P-C of FT:mat_peptide AB367422_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 31/Adefovir-treated Pt. 12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367423_HBe_P-C Product feature CHAIN AB367423_HBe_P-C of FT:mat_peptide AB367423_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 32/Adefovir-treated Pt. 28). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367424_HBe_P-C Product feature CHAIN AB367424_HBe_P-C of FT:mat_peptide AB367424_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 33). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367434_HBe_P-C Product feature CHAIN AB367434_HBe_P-C of FT:mat_peptide AB367434_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 43/Adefovir-treated Pt. 26). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGMSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB367435_HBe_P-C Product feature CHAIN AB367435_HBe_P-C of FT:mat_peptide AB367435_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 44/Adefovir-treated Pt. 23). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB426467_HBe_P-C Product feature CHAIN AB426467_HBe_P-C of FT:mat_peptide AB426467_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471848_HBe_P-C Product feature CHAIN AB471848_HBe_P-C of FT:mat_peptide AB471848_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-F). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471849_HBe_P-C Product feature CHAIN AB471849_HBe_P-C of FT:mat_peptide AB471849_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471850_HBe_P-C Product feature CHAIN AB471850_HBe_P-C of FT:mat_peptide AB471850_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471851_HBe_P-C Product feature CHAIN AB471851_HBe_P-C of FT:mat_peptide AB471851_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2NK-F). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471852_HBe_P-C Product feature CHAIN AB471852_HBe_P-C of FT:mat_peptide AB471852_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471853_HBe_P-C Product feature CHAIN AB471853_HBe_P-C of FT:mat_peptide AB471853_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB485808_HBe_P-C Product feature CHAIN AB485808_HBe_P-C of FT:mat_peptide AB485808_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-IT). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB640730_HBe_P-C Product feature CHAIN AB640730_HBe_P-C of FT:mat_peptide AB640730_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ehime-EPCH-HBV-C1-HN). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB642099_HBe_P-C Product feature CHAIN AB642099_HBe_P-C of FT:mat_peptide AB642099_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2005-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB642100_HBe_P-C Product feature CHAIN AB642100_HBe_P-C of FT:mat_peptide AB642100_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2006-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670238_HBe_P-C Product feature CHAIN AB670238_HBe_P-C of FT:mat_peptide AB670238_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670239_HBe_P-C Product feature CHAIN AB670239_HBe_P-C of FT:mat_peptide AB670239_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQXILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670240_HBe_P-C Product feature CHAIN AB670240_HBe_P-C of FT:mat_peptide AB670240_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQXILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670241_HBe_P-C Product feature CHAIN AB670241_HBe_P-C of FT:mat_peptide AB670241_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB670243_HBe_P-C Product feature CHAIN AB670243_HBe_P-C of FT:mat_peptide AB670243_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.7). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQXILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB670246_HBe_P-C Product feature CHAIN AB670246_HBe_P-C of FT:mat_peptide AB670246_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAIVCWGELMNLATWVGSNLEDQASRDSVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB670247_HBe_P-C Product feature CHAIN AB670247_HBe_P-C of FT:mat_peptide AB670247_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670249_HBe_P-C Product feature CHAIN AB670249_HBe_P-C of FT:mat_peptide AB670249_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670252_HBe_P-C Product feature CHAIN AB670252_HBe_P-C of FT:mat_peptide AB670252_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAXLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670253_HBe_P-C Product feature CHAIN AB670253_HBe_P-C of FT:mat_peptide AB670253_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETAVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB670254_HBe_P-C Product feature CHAIN AB670254_HBe_P-C of FT:mat_peptide AB670254_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.18). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAXLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670255_HBe_P-C Product feature CHAIN AB670255_HBe_P-C of FT:mat_peptide AB670255_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.19). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTAIRQAVLCWGELMSLATWVGSNLEDPASREAVVNYVNVNMGLKFRQLLWFHVSCLTFGRQTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670256_HBe_P-C Product feature CHAIN AB670256_HBe_P-C of FT:mat_peptide AB670256_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670260_HBe_P-C Product feature CHAIN AB670260_HBe_P-C of FT:mat_peptide AB670260_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.24). Complete genome. [Hepadnaviridae] (length=211 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEESSRELVVSYVNVHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAY
RPPNAPILSTLPETTVXRCRGRSPRRRTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB670261_HBe_P-C Product feature CHAIN AB670261_HBe_P-C of FT:mat_peptide AB670261_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB670265_HBe_P-C Product feature CHAIN AB670265_HBe_P-C of FT:mat_peptide AB670265_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.29). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESNC
>gnl|hbvpro|AB670266_HBe_P-C Product feature CHAIN AB670266_HBe_P-C of FT:mat_peptide AB670266_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.30). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670267_HBe_P-C Product feature CHAIN AB670267_HBe_P-C of FT:mat_peptide AB670267_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.31). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670268_HBe_P-C Product feature CHAIN AB670268_HBe_P-C of FT:mat_peptide AB670268_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.32). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGXKXRPLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB670269_HBe_P-C Product feature CHAIN AB670269_HBe_P-C of FT:mat_peptide AB670269_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.33). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670275_HBe_P-C Product feature CHAIN AB670275_HBe_P-C of FT:mat_peptide AB670275_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670277_HBe_P-C Product feature CHAIN AB670277_HBe_P-C of FT:mat_peptide AB670277_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670278_HBe_P-C Product feature CHAIN AB670278_HBe_P-C of FT:mat_peptide AB670278_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670281_HBe_P-C Product feature CHAIN AB670281_HBe_P-C of FT:mat_peptide AB670281_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPXSRELXVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670282_HBe_P-C Product feature CHAIN AB670282_HBe_P-C of FT:mat_peptide AB670282_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670283_HBe_P-C Product feature CHAIN AB670283_HBe_P-C of FT:mat_peptide AB670283_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670285_HBe_P-C Product feature CHAIN AB670285_HBe_P-C of FT:mat_peptide AB670285_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYXEALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLLIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670287_HBe_P-C Product feature CHAIN AB670287_HBe_P-C of FT:mat_peptide AB670287_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670289_HBe_P-C Product feature CHAIN AB670289_HBe_P-C of FT:mat_peptide AB670289_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670290_HBe_P-C Product feature CHAIN AB670290_HBe_P-C of FT:mat_peptide AB670290_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670291_HBe_P-C Product feature CHAIN AB670291_HBe_P-C of FT:mat_peptide AB670291_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.18). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670292_HBe_P-C Product feature CHAIN AB670292_HBe_P-C of FT:mat_peptide AB670292_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670294_HBe_P-C Product feature CHAIN AB670294_HBe_P-C of FT:mat_peptide AB670294_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.21). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670297_HBe_P-C Product feature CHAIN AB670297_HBe_P-C of FT:mat_peptide AB670297_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670300_HBe_P-C Product feature CHAIN AB670300_HBe_P-C of FT:mat_peptide AB670300_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.27). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB670304_HBe_P-C Product feature CHAIN AB670304_HBe_P-C of FT:mat_peptide AB670304_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.31). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRTLLWFHISCLMFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670305_HBe_P-C Product feature CHAIN AB670305_HBe_P-C of FT:mat_peptide AB670305_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.32). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670306_HBe_P-C Product feature CHAIN AB670306_HBe_P-C of FT:mat_peptide AB670306_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.33). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTXVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB670307_HBe_P-C Product feature CHAIN AB670307_HBe_P-C of FT:mat_peptide AB670307_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.34). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670309_HBe_P-C Product feature CHAIN AB670309_HBe_P-C of FT:mat_peptide AB670309_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.36). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEETASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670310_HBe_P-C Product feature CHAIN AB670310_HBe_P-C of FT:mat_peptide AB670310_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.37). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB670311_HBe_P-C Product feature CHAIN AB670311_HBe_P-C of FT:mat_peptide AB670311_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.38). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB675674_HBe_P-C Product feature CHAIN AB675674_HBe_P-C of FT:mat_peptide AB675674_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A33). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB675675_HBe_P-C Product feature CHAIN AB675675_HBe_P-C of FT:mat_peptide AB675675_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A34). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB675677_HBe_P-C Product feature CHAIN AB675677_HBe_P-C of FT:mat_peptide AB675677_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A39). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697490_HBe_P-C Product feature CHAIN AB697490_HBe_P-C of FT:mat_peptide AB697490_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697494_HBe_P-C Product feature CHAIN AB697494_HBe_P-C of FT:mat_peptide AB697494_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No9). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697500_HBe_P-C Product feature CHAIN AB697500_HBe_P-C of FT:mat_peptide AB697500_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697510_HBe_P-C Product feature CHAIN AB697510_HBe_P-C of FT:mat_peptide AB697510_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No33). Complete genome. [Hepadnaviridae] (length=212 residues).
IQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHLSCITFGREIVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVLRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB900115_HBe_P-C Product feature CHAIN AB900115_HBe_P-C of FT:mat_peptide AB900115_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPNIRDLLDTASALYREALESSEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB971714_HBe_P-C Product feature CHAIN AB971714_HBe_P-C of FT:mat_peptide AB971714_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1026). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB971715_HBe_P-C Product feature CHAIN AB971715_HBe_P-C of FT:mat_peptide AB971715_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1027). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF068756_HBe_P-C Product feature CHAIN AF068756_HBe_P-C of FT:mat_peptide AF068756_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223954_HBe_P-C Product feature CHAIN AF223954_HBe_P-C of FT:mat_peptide AF223954_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223955_HBe_P-C Product feature CHAIN AF223955_HBe_P-C of FT:mat_peptide AF223955_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223956_HBe_P-C Product feature CHAIN AF223956_HBe_P-C of FT:mat_peptide AF223956_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223957_HBe_P-C Product feature CHAIN AF223957_HBe_P-C of FT:mat_peptide AF223957_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223958_HBe_P-C Product feature CHAIN AF223958_HBe_P-C of FT:mat_peptide AF223958_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223959_HBe_P-C Product feature CHAIN AF223959_HBe_P-C of FT:mat_peptide AF223959_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF223960_HBe_P-C Product feature CHAIN AF223960_HBe_P-C of FT:mat_peptide AF223960_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPXNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRZSQC
>gnl|hbvpro|AF223961_HBe_P-C Product feature CHAIN AF223961_HBe_P-C of FT:mat_peptide AF223961_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVXHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPXNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF241410_HBe_P-C Product feature CHAIN AF241410_HBe_P-C of FT:mat_peptide AF241410_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3270). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF241411_HBe_P-C Product feature CHAIN AF241411_HBe_P-C of FT:mat_peptide AF241411_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8290). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF286594_HBe_P-C Product feature CHAIN AF286594_HBe_P-C of FT:mat_peptide AF286594_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF363961_HBe_P-C Product feature CHAIN AF363961_HBe_P-C of FT:mat_peptide AF363961_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPYAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384364_HBe_P-C Product feature CHAIN AF384364_HBe_P-C of FT:mat_peptide AF384364_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384365_HBe_P-C Product feature CHAIN AF384365_HBe_P-C of FT:mat_peptide AF384365_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384366_HBe_P-C Product feature CHAIN AF384366_HBe_P-C of FT:mat_peptide AF384366_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF384367_HBe_P-C Product feature CHAIN AF384367_HBe_P-C of FT:mat_peptide AF384367_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFRISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF411408_HBe_P-C Product feature CHAIN AF411408_HBe_P-C of FT:mat_peptide AF411408_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF411410_HBe_P-C Product feature CHAIN AF411410_HBe_P-C of FT:mat_peptide AF411410_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF411411_HBe_P-C Product feature CHAIN AF411411_HBe_P-C of FT:mat_peptide AF411411_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF411412_HBe_P-C Product feature CHAIN AF411412_HBe_P-C of FT:mat_peptide AF411412_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPR
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF458664_HBe_P-C Product feature CHAIN AF458664_HBe_P-C of FT:mat_peptide AF458664_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C84). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPGTTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF458665_HBe_P-C Product feature CHAIN AF458665_HBe_P-C of FT:mat_peptide AF458665_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C733). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQPSRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF461357_HBe_P-C Product feature CHAIN AF461357_HBe_P-C of FT:mat_peptide AF461357_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVASYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF461363_HBe_P-C Product feature CHAIN AF461363_HBe_P-C of FT:mat_peptide AF461363_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVASYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF473543_HBe_P-C Product feature CHAIN AF473543_HBe_P-C of FT:mat_peptide AF473543_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2e). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF533983_HBe_P-C Product feature CHAIN AF533983_HBe_P-C of FT:mat_peptide AF533983_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ748098_HBe_P-C Product feature CHAIN AJ748098_HBe_P-C of FT:mat_peptide AJ748098_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient Z1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011097_HBe_P-C Product feature CHAIN AP011097_HBe_P-C of FT:mat_peptide AP011097_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011098_HBe_P-C Product feature CHAIN AP011098_HBe_P-C of FT:mat_peptide AP011098_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011099_HBe_P-C Product feature CHAIN AP011099_HBe_P-C of FT:mat_peptide AP011099_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011100_HBe_P-C Product feature CHAIN AP011100_HBe_P-C of FT:mat_peptide AP011100_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011101_HBe_P-C Product feature CHAIN AP011101_HBe_P-C of FT:mat_peptide AP011101_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011106_HBe_P-C Product feature CHAIN AP011106_HBe_P-C of FT:mat_peptide AP011106_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AP011107_HBe_P-C Product feature CHAIN AP011107_HBe_P-C of FT:mat_peptide AP011107_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY057947_HBe_P-C Product feature CHAIN AY057947_HBe_P-C of FT:mat_peptide AY057947_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet705). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY066028_HBe_P-C Product feature CHAIN AY066028_HBe_P-C of FT:mat_peptide AY066028_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167090_HBe_P-C Product feature CHAIN AY167090_HBe_P-C of FT:mat_peptide AY167090_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167091_HBe_P-C Product feature CHAIN AY167091_HBe_P-C of FT:mat_peptide AY167091_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ic). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPANAPILSTLPETTVIRGRSRAPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY167092_HBe_P-C Product feature CHAIN AY167092_HBe_P-C of FT:mat_peptide AY167092_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Id). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY167099_HBe_P-C Product feature CHAIN AY167099_HBe_P-C of FT:mat_peptide AY167099_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IVb). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206378_HBe_P-C Product feature CHAIN AY206378_HBe_P-C of FT:mat_peptide AY206378_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAVVCWGELVNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY206382_HBe_P-C Product feature CHAIN AY206382_HBe_P-C of FT:mat_peptide AY206382_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206384_HBe_P-C Product feature CHAIN AY206384_HBe_P-C of FT:mat_peptide AY206384_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206385_HBe_P-C Product feature CHAIN AY206385_HBe_P-C of FT:mat_peptide AY206385_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206386_HBe_P-C Product feature CHAIN AY206386_HBe_P-C of FT:mat_peptide AY206386_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWMRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY206389_HBe_P-C Product feature CHAIN AY206389_HBe_P-C of FT:mat_peptide AY206389_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY220699_HBe_P-C Product feature CHAIN AY220699_HBe_P-C of FT:mat_peptide AY220699_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETMLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY220700_HBe_P-C Product feature CHAIN AY220700_HBe_P-C of FT:mat_peptide AY220700_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY247031_HBe_P-C Product feature CHAIN AY247031_HBe_P-C of FT:mat_peptide AY247031_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB84). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY247032_HBe_P-C Product feature CHAIN AY247032_HBe_P-C of FT:mat_peptide AY247032_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB95). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPTSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269099_HBe_P-C Product feature CHAIN AY269099_HBe_P-C of FT:mat_peptide AY269099_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 8). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269140_HBe_P-C Product feature CHAIN AY269140_HBe_P-C of FT:mat_peptide AY269140_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESAEHCTAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGGSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY306136_HBe_P-C Product feature CHAIN AY306136_HBe_P-C of FT:mat_peptide AY306136_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H85). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIGPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPTSRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596107_HBe_P-C Product feature CHAIN AY596107_HBe_P-C of FT:mat_peptide AY596107_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-1). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY596108_HBe_P-C Product feature CHAIN AY596108_HBe_P-C of FT:mat_peptide AY596108_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY641558_HBe_P-C Product feature CHAIN AY641558_HBe_P-C of FT:mat_peptide AY641558_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He74). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDRLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY641560_HBe_P-C Product feature CHAIN AY641560_HBe_P-C of FT:mat_peptide AY641560_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He100). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY641561_HBe_P-C Product feature CHAIN AY641561_HBe_P-C of FT:mat_peptide AY641561_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He127). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY862869_HBe_P-C Product feature CHAIN AY862869_HBe_P-C of FT:mat_peptide AY862869_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H8). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPR
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D00630_HBe_P-C Product feature CHAIN D00630_HBe_P-C of FT:mat_peptide D00630_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLRGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAFALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSVGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|D12980_HBe_P-C Product feature CHAIN D12980_HBe_P-C of FT:mat_peptide D12980_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D23680_HBe_P-C Product feature CHAIN D23680_HBe_P-C of FT:mat_peptide D23680_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B4-HBVST1). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D28880_HBe_P-C Product feature CHAIN D28880_HBe_P-C of FT:mat_peptide D28880_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Plasma 1992-085-9434). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|D50517_HBe_P-C Product feature CHAIN D50517_HBe_P-C of FT:mat_peptide D50517_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFMPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVPEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D50518_HBe_P-C Product feature CHAIN D50518_HBe_P-C of FT:mat_peptide D50518_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFMPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVPEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|D50519_HBe_P-C Product feature CHAIN D50519_HBe_P-C of FT:mat_peptide D50519_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089756_HBe_P-C Product feature CHAIN DQ089756_HBe_P-C of FT:mat_peptide DQ089756_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK75). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPNDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQGILCWGELMNLATWVGGNLDDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089757_HBe_P-C Product feature CHAIN DQ089757_HBe_P-C of FT:mat_peptide DQ089757_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2342). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGXNLXDPASREXVVSYVNVNMGLKXRQXLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ089758_HBe_P-C Product feature CHAIN DQ089758_HBe_P-C of FT:mat_peptide DQ089758_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1733). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089759_HBe_P-C Product feature CHAIN DQ089759_HBe_P-C of FT:mat_peptide DQ089759_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1512). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRXLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRXRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089760_HBe_P-C Product feature CHAIN DQ089760_HBe_P-C of FT:mat_peptide DQ089760_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK454). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNWEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089761_HBe_P-C Product feature CHAIN DQ089761_HBe_P-C of FT:mat_peptide DQ089761_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK515). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ089762_HBe_P-C Product feature CHAIN DQ089762_HBe_P-C of FT:mat_peptide DQ089762_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1644). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|DQ089763_HBe_P-C Product feature CHAIN DQ089763_HBe_P-C of FT:mat_peptide DQ089763_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1048). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089764_HBe_P-C Product feature CHAIN DQ089764_HBe_P-C of FT:mat_peptide DQ089764_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK967). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|DQ089765_HBe_P-C Product feature CHAIN DQ089765_HBe_P-C of FT:mat_peptide DQ089765_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK428). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089766_HBe_P-C Product feature CHAIN DQ089766_HBe_P-C of FT:mat_peptide DQ089766_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK553). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089767_HBe_P-C Product feature CHAIN DQ089767_HBe_P-C of FT:mat_peptide DQ089767_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1663). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAXVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089768_HBe_P-C Product feature CHAIN DQ089768_HBe_P-C of FT:mat_peptide DQ089768_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1814). Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASSELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTAIRQAILCWGELMNLATWVGSNLEDPGSRELVVGYVNVNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089769_HBe_P-C Product feature CHAIN DQ089769_HBe_P-C of FT:mat_peptide DQ089769_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK430). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089770_HBe_P-C Product feature CHAIN DQ089770_HBe_P-C of FT:mat_peptide DQ089770_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1272). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRARSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089772_HBe_P-C Product feature CHAIN DQ089772_HBe_P-C of FT:mat_peptide DQ089772_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK910). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSYH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089773_HBe_P-C Product feature CHAIN DQ089773_HBe_P-C of FT:mat_peptide DQ089773_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1193). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRHLLWFHISCLTFGRETVLEYLVSFGVWIPTPPA
YRPPNAPILSTLPETTVXRRRGSSPRRRTPSPRRRSSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089775_HBe_P-C Product feature CHAIN DQ089775_HBe_P-C of FT:mat_peptide DQ089775_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK290). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAH
HTALRQAIVCWGELMNLATWVGSNLDDPASREVVVNYVNVNMGLKIRQILWFHISCLTFGRQTVLEYLVSFGVWIRTPIA
YRPPNAPILSTLPETTVIRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089776_HBe_P-C Product feature CHAIN DQ089776_HBe_P-C of FT:mat_peptide DQ089776_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK884). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLDDQGSRDLVVSYVNVNMGLKVRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089777_HBe_P-C Product feature CHAIN DQ089777_HBe_P-C of FT:mat_peptide DQ089777_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1159). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLDDQXSRELVVSYVNVNMGLKVRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089778_HBe_P-C Product feature CHAIN DQ089778_HBe_P-C of FT:mat_peptide DQ089778_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1442). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAILCWXELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089779_HBe_P-C Product feature CHAIN DQ089779_HBe_P-C of FT:mat_peptide DQ089779_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK554). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089780_HBe_P-C Product feature CHAIN DQ089780_HBe_P-C of FT:mat_peptide DQ089780_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK947). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|DQ089781_HBe_P-C Product feature CHAIN DQ089781_HBe_P-C of FT:mat_peptide DQ089781_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1476). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089782_HBe_P-C Product feature CHAIN DQ089782_HBe_P-C of FT:mat_peptide DQ089782_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2032). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFWPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089783_HBe_P-C Product feature CHAIN DQ089783_HBe_P-C of FT:mat_peptide DQ089783_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1402). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089784_HBe_P-C Product feature CHAIN DQ089784_HBe_P-C of FT:mat_peptide DQ089784_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1285). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCXTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTPPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089785_HBe_P-C Product feature CHAIN DQ089785_HBe_P-C of FT:mat_peptide DQ089785_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1386). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASQELISFLPSDFFPTIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMSLATWVGGNLDDPASRDAVVSYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|DQ089786_HBe_P-C Product feature CHAIN DQ089786_HBe_P-C of FT:mat_peptide DQ089786_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2074). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRPLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPANAPILSTLPETTVVRQRGRSLRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089787_HBe_P-C Product feature CHAIN DQ089787_HBe_P-C of FT:mat_peptide DQ089787_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK352). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGEVMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089788_HBe_P-C Product feature CHAIN DQ089788_HBe_P-C of FT:mat_peptide DQ089788_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK820). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASLELLSFLPSDFFPSIRDLLETASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ089789_HBe_P-C Product feature CHAIN DQ089789_HBe_P-C of FT:mat_peptide DQ089789_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK926). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089790_HBe_P-C Product feature CHAIN DQ089790_HBe_P-C of FT:mat_peptide DQ089790_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1248). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNDNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRXPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089791_HBe_P-C Product feature CHAIN DQ089791_HBe_P-C of FT:mat_peptide DQ089791_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1205). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089792_HBe_P-C Product feature CHAIN DQ089792_HBe_P-C of FT:mat_peptide DQ089792_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK870). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNXNMGLKXRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPA
YRPXNAPILSTLPETTVVRRRXRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089793_HBe_P-C Product feature CHAIN DQ089793_HBe_P-C of FT:mat_peptide DQ089793_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK343). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089795_HBe_P-C Product feature CHAIN DQ089795_HBe_P-C of FT:mat_peptide DQ089795_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1465). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089796_HBe_P-C Product feature CHAIN DQ089796_HBe_P-C of FT:mat_peptide DQ089796_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK751). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089799_HBe_P-C Product feature CHAIN DQ089799_HBe_P-C of FT:mat_peptide DQ089799_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK734). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ089801_HBe_P-C Product feature CHAIN DQ089801_HBe_P-C of FT:mat_peptide DQ089801_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2100). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLWLIISCSCPTVQASKRCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRXRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144553_HBe_P-C Product feature CHAIN DQ144553_HBe_P-C of FT:mat_peptide DQ144553_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cq2-A2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144603_HBe_P-C Product feature CHAIN DQ144603_HBe_P-C of FT:mat_peptide DQ144603_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cq5-14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ144604_HBe_P-C Product feature CHAIN DQ144604_HBe_P-C of FT:mat_peptide DQ144604_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cq5-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ246215_HBe_P-C Product feature CHAIN DQ246215_HBe_P-C of FT:mat_peptide DQ246215_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHSCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315781_HBe_P-C Product feature CHAIN DQ315781_HBe_P-C of FT:mat_peptide DQ315781_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI0398). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315782_HBe_P-C Product feature CHAIN DQ315782_HBe_P-C of FT:mat_peptide DQ315782_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI0423). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315783_HBe_P-C Product feature CHAIN DQ315783_HBe_P-C of FT:mat_peptide DQ315783_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI03188). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ361526_HBe_P-C Product feature CHAIN DQ361526_HBe_P-C of FT:mat_peptide DQ361526_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NK-586). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETGVVRQRGRSSRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ377160_HBe_P-C Product feature CHAIN DQ377160_HBe_P-C of FT:mat_peptide DQ377160_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT16). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFLSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ377161_HBe_P-C Product feature CHAIN DQ377161_HBe_P-C of FT:mat_peptide DQ377161_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ377162_HBe_P-C Product feature CHAIN DQ377162_HBe_P-C of FT:mat_peptide DQ377162_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|DQ377163_HBe_P-C Product feature CHAIN DQ377163_HBe_P-C of FT:mat_peptide DQ377163_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT32). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ377164_HBe_P-C Product feature CHAIN DQ377164_HBe_P-C of FT:mat_peptide DQ377164_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ377165_HBe_P-C Product feature CHAIN DQ377165_HBe_P-C of FT:mat_peptide DQ377165_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT35). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ478899_HBe_P-C Product feature CHAIN DQ478899_HBe_P-C of FT:mat_peptide DQ478899_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRPQSPRRRRSQSRESQC
>gnl|hbvpro|DQ478900_HBe_P-C Product feature CHAIN DQ478900_HBe_P-C of FT:mat_peptide DQ478900_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H172). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|DQ478901_HBe_P-C Product feature CHAIN DQ478901_HBe_P-C of FT:mat_peptide DQ478901_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H155). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ536410_HBe_P-C Product feature CHAIN DQ536410_HBe_P-C of FT:mat_peptide DQ536410_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFRISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ536411_HBe_P-C Product feature CHAIN DQ536411_HBe_P-C of FT:mat_peptide DQ536411_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|DQ536413_HBe_P-C Product feature CHAIN DQ536413_HBe_P-C of FT:mat_peptide DQ536413_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=213 residues).
MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|DQ536414_HBe_P-C Product feature CHAIN DQ536414_HBe_P-C of FT:mat_peptide DQ536414_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=213 residues).
MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|DQ683578_HBe_P-C Product feature CHAIN DQ683578_HBe_P-C of FT:mat_peptide DQ683578_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ922649_HBe_P-C Product feature CHAIN DQ922649_HBe_P-C of FT:mat_peptide DQ922649_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRGRTPSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|DQ922650_HBe_P-C Product feature CHAIN DQ922650_HBe_P-C of FT:mat_peptide DQ922650_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ922651_HBe_P-C Product feature CHAIN DQ922651_HBe_P-C of FT:mat_peptide DQ922651_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSQH
HATLRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVCIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ975272_HBe_P-C Product feature CHAIN DQ975272_HBe_P-C of FT:mat_peptide DQ975272_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVDVNMGLKLRQLQWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ975273_HBe_P-C Product feature CHAIN DQ975273_HBe_P-C of FT:mat_peptide DQ975273_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ980550_HBe_P-C Product feature CHAIN DQ980550_HBe_P-C of FT:mat_peptide DQ980550_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ980551_HBe_P-C Product feature CHAIN DQ980551_HBe_P-C of FT:mat_peptide DQ980551_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWLRTPPA
YRPPNAPILSTLPETAVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993690_HBe_P-C Product feature CHAIN DQ993690_HBe_P-C of FT:mat_peptide DQ993690_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 204-1113-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993691_HBe_P-C Product feature CHAIN DQ993691_HBe_P-C of FT:mat_peptide DQ993691_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0803-Nature2.2-unSero). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993692_HBe_P-C Product feature CHAIN DQ993692_HBe_P-C of FT:mat_peptide DQ993692_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0810-Nature2.1-unSero). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ993693_HBe_P-C Product feature CHAIN DQ993693_HBe_P-C of FT:mat_peptide DQ993693_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 232-1125-Nature1.1-unSero). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF137802_HBe_P-C Product feature CHAIN EF137802_HBe_P-C of FT:mat_peptide EF137802_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLGYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF197911_HBe_P-C Product feature CHAIN EF197911_HBe_P-C of FT:mat_peptide EF197911_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=211 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|EF384201_HBe_P-C Product feature CHAIN EF384201_HBe_P-C of FT:mat_peptide EF384201_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-02). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPS
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF494377_HBe_P-C Product feature CHAIN EF494377_HBe_P-C of FT:mat_peptide EF494377_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW1138). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAFRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EF494379_HBe_P-C Product feature CHAIN EF494379_HBe_P-C of FT:mat_peptide EF494379_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW8585). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF536065_HBe_P-C Product feature CHAIN EF536065_HBe_P-C of FT:mat_peptide EF536065_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF536066_HBe_P-C Product feature CHAIN EF536066_HBe_P-C of FT:mat_peptide EF536066_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF688062_HBe_P-C Product feature CHAIN EF688062_HBe_P-C of FT:mat_peptide EF688062_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ28-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305540_HBe_P-C Product feature CHAIN EU305540_HBe_P-C of FT:mat_peptide EU305540_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-123). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305541_HBe_P-C Product feature CHAIN EU305541_HBe_P-C of FT:mat_peptide EU305541_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-190). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU305542_HBe_P-C Product feature CHAIN EU305542_HBe_P-C of FT:mat_peptide EU305542_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-1251). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306673_HBe_P-C Product feature CHAIN EU306673_HBe_P-C of FT:mat_peptide EU306673_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306685_HBe_P-C Product feature CHAIN EU306685_HBe_P-C of FT:mat_peptide EU306685_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306687_HBe_P-C Product feature CHAIN EU306687_HBe_P-C of FT:mat_peptide EU306687_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALEPPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306688_HBe_P-C Product feature CHAIN EU306688_HBe_P-C of FT:mat_peptide EU306688_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306689_HBe_P-C Product feature CHAIN EU306689_HBe_P-C of FT:mat_peptide EU306689_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306690_HBe_P-C Product feature CHAIN EU306690_HBe_P-C of FT:mat_peptide EU306690_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306691_HBe_P-C Product feature CHAIN EU306691_HBe_P-C of FT:mat_peptide EU306691_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306694_HBe_P-C Product feature CHAIN EU306694_HBe_P-C of FT:mat_peptide EU306694_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306713_HBe_P-C Product feature CHAIN EU306713_HBe_P-C of FT:mat_peptide EU306713_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306714_HBe_P-C Product feature CHAIN EU306714_HBe_P-C of FT:mat_peptide EU306714_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306719_HBe_P-C Product feature CHAIN EU306719_HBe_P-C of FT:mat_peptide EU306719_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSALPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306720_HBe_P-C Product feature CHAIN EU306720_HBe_P-C of FT:mat_peptide EU306720_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306721_HBe_P-C Product feature CHAIN EU306721_HBe_P-C of FT:mat_peptide EU306721_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306722_HBe_P-C Product feature CHAIN EU306722_HBe_P-C of FT:mat_peptide EU306722_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASMELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306727_HBe_P-C Product feature CHAIN EU306727_HBe_P-C of FT:mat_peptide EU306727_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU306729_HBe_P-C Product feature CHAIN EU306729_HBe_P-C of FT:mat_peptide EU306729_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU410079_HBe_P-C Product feature CHAIN EU410079_HBe_P-C of FT:mat_peptide EU410079_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph109). Complete genome. [Hepadnaviridae] (length=212 residues).
MXLFHLCLIISCSCPTVQASXLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU410080_HBe_P-C Product feature CHAIN EU410080_HBe_P-C of FT:mat_peptide EU410080_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph76). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU410081_HBe_P-C Product feature CHAIN EU410081_HBe_P-C of FT:mat_peptide EU410081_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph80). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439005_HBe_P-C Product feature CHAIN EU439005_HBe_P-C of FT:mat_peptide EU439005_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU439013_HBe_P-C Product feature CHAIN EU439013_HBe_P-C of FT:mat_peptide EU439013_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=211 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLETASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLKYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|EU439015_HBe_P-C Product feature CHAIN EU439015_HBe_P-C of FT:mat_peptide EU439015_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU498227_HBe_P-C Product feature CHAIN EU498227_HBe_P-C of FT:mat_peptide EU498227_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JL). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRESVVTYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU522068_HBe_P-C Product feature CHAIN EU522068_HBe_P-C of FT:mat_peptide EU522068_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5N). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU522069_HBe_P-C Product feature CHAIN EU522069_HBe_P-C of FT:mat_peptide EU522069_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5T). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLTFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554535_HBe_P-C Product feature CHAIN EU554535_HBe_P-C of FT:mat_peptide EU554535_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554537_HBe_P-C Product feature CHAIN EU554537_HBe_P-C of FT:mat_peptide EU554537_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554538_HBe_P-C Product feature CHAIN EU554538_HBe_P-C of FT:mat_peptide EU554538_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554539_HBe_P-C Product feature CHAIN EU554539_HBe_P-C of FT:mat_peptide EU554539_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-21). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPR
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554541_HBe_P-C Product feature CHAIN EU554541_HBe_P-C of FT:mat_peptide EU554541_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEYCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSILPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU554542_HBe_P-C Product feature CHAIN EU554542_HBe_P-C of FT:mat_peptide EU554542_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU560438_HBe_P-C Product feature CHAIN EU560438_HBe_P-C of FT:mat_peptide EU560438_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2-B74). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWVRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU560440_HBe_P-C Product feature CHAIN EU560440_HBe_P-C of FT:mat_peptide EU560440_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-S869). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU562215_HBe_P-C Product feature CHAIN EU562215_HBe_P-C of FT:mat_peptide EU562215_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU562216_HBe_P-C Product feature CHAIN EU562216_HBe_P-C of FT:mat_peptide EU562216_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU562217_HBe_P-C Product feature CHAIN EU562217_HBe_P-C of FT:mat_peptide EU562217_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU562218_HBe_P-C Product feature CHAIN EU562218_HBe_P-C of FT:mat_peptide EU562218_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570067_HBe_P-C Product feature CHAIN EU570067_HBe_P-C of FT:mat_peptide EU570067_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18-S541). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILLTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570068_HBe_P-C Product feature CHAIN EU570068_HBe_P-C of FT:mat_peptide EU570068_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26-S541). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU570072_HBe_P-C Product feature CHAIN EU570072_HBe_P-C of FT:mat_peptide EU570072_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-B74). Complete genome. [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQCW
>gnl|hbvpro|EU570073_HBe_P-C Product feature CHAIN EU570073_HBe_P-C of FT:mat_peptide EU570073_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8-S698). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRDSQC
>gnl|hbvpro|EU570074_HBe_P-C Product feature CHAIN EU570074_HBe_P-C of FT:mat_peptide EU570074_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11-S698). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRDSQC
>gnl|hbvpro|EU579442_HBe_P-C Product feature CHAIN EU579442_HBe_P-C of FT:mat_peptide EU579442_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU589341_HBe_P-C Product feature CHAIN EU589341_HBe_P-C of FT:mat_peptide EU589341_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-10). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLFLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU589342_HBe_P-C Product feature CHAIN EU589342_HBe_P-C of FT:mat_peptide EU589342_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-13). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU589345_HBe_P-C Product feature CHAIN EU589345_HBe_P-C of FT:mat_peptide EU589345_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S624-2). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU670263_HBe_P-C Product feature CHAIN EU670263_HBe_P-C of FT:mat_peptide EU670263_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph105). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU717212_HBe_P-C Product feature CHAIN EU717212_HBe_P-C of FT:mat_peptide EU717212_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D26K-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPNA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU717214_HBe_P-C Product feature CHAIN EU717214_HBe_P-C of FT:mat_peptide EU717214_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G62K-8). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASRELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLNFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRGSQSPRRRRSQSRQSQC
>gnl|hbvpro|EU796069_HBe_P-C Product feature CHAIN EU796069_HBe_P-C of FT:mat_peptide EU796069_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLGYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU796070_HBe_P-C Product feature CHAIN EU796070_HBe_P-C of FT:mat_peptide EU796070_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU796072_HBe_P-C Product feature CHAIN EU796072_HBe_P-C of FT:mat_peptide EU796072_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871976_HBe_P-C Product feature CHAIN EU871976_HBe_P-C of FT:mat_peptide EU871976_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-04-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871980_HBe_P-C Product feature CHAIN EU871980_HBe_P-C of FT:mat_peptide EU871980_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-01-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQEILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871982_HBe_P-C Product feature CHAIN EU871982_HBe_P-C of FT:mat_peptide EU871982_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-96-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU871998_HBe_P-C Product feature CHAIN EU871998_HBe_P-C of FT:mat_peptide EU871998_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-00-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQEILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU872005_HBe_P-C Product feature CHAIN EU872005_HBe_P-C of FT:mat_peptide EU872005_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-96-1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASRELLSFLPSDFFPPVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|EU872010_HBe_P-C Product feature CHAIN EU872010_HBe_P-C of FT:mat_peptide EU872010_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-92-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU872013_HBe_P-C Product feature CHAIN EU872013_HBe_P-C of FT:mat_peptide EU872013_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-99-6). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPADFFPSIRDLLDTASALYRETLESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU881996_HBe_P-C Product feature CHAIN EU881996_HBe_P-C of FT:mat_peptide EU881996_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916210_HBe_P-C Product feature CHAIN EU916210_HBe_P-C of FT:mat_peptide EU916210_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2.4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVVLLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916212_HBe_P-C Product feature CHAIN EU916212_HBe_P-C of FT:mat_peptide EU916212_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGGETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916215_HBe_P-C Product feature CHAIN EU916215_HBe_P-C of FT:mat_peptide EU916215_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPGTTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916217_HBe_P-C Product feature CHAIN EU916217_HBe_P-C of FT:mat_peptide EU916217_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916218_HBe_P-C Product feature CHAIN EU916218_HBe_P-C of FT:mat_peptide EU916218_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSRPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916223_HBe_P-C Product feature CHAIN EU916223_HBe_P-C of FT:mat_peptide EU916223_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916224_HBe_P-C Product feature CHAIN EU916224_HBe_P-C of FT:mat_peptide EU916224_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916225_HBe_P-C Product feature CHAIN EU916225_HBe_P-C of FT:mat_peptide EU916225_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916227_HBe_P-C Product feature CHAIN EU916227_HBe_P-C of FT:mat_peptide EU916227_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASAPYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPPPRRRWSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916229_HBe_P-C Product feature CHAIN EU916229_HBe_P-C of FT:mat_peptide EU916229_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.4). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916233_HBe_P-C Product feature CHAIN EU916233_HBe_P-C of FT:mat_peptide EU916233_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRPQSRESQC
>gnl|hbvpro|EU916234_HBe_P-C Product feature CHAIN EU916234_HBe_P-C of FT:mat_peptide EU916234_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.2). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916237_HBe_P-C Product feature CHAIN EU916237_HBe_P-C of FT:mat_peptide EU916237_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU916238_HBe_P-C Product feature CHAIN EU916238_HBe_P-C of FT:mat_peptide EU916238_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQF
>gnl|hbvpro|EU919165_HBe_P-C Product feature CHAIN EU919165_HBe_P-C of FT:mat_peptide EU919165_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient24). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU919168_HBe_P-C Product feature CHAIN EU919168_HBe_P-C of FT:mat_peptide EU919168_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939536_HBe_P-C Product feature CHAIN EU939536_HBe_P-C of FT:mat_peptide EU939536_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C3). Complete genome. [Hepadnaviridae] (length=212 residues).
MELFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939540_HBe_P-C Product feature CHAIN EU939540_HBe_P-C of FT:mat_peptide EU939540_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939541_HBe_P-C Product feature CHAIN EU939541_HBe_P-C of FT:mat_peptide EU939541_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPH
HTALRQAILCWGELMNLATWVGSNLENPASRELVVSYVNVNMGLKIKQLLWFHISCLTFGKKTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRQGRSPKKKTPSPRKQRSQSPRRKKSQSRESQC
>gnl|hbvpro|EU939544_HBe_P-C Product feature CHAIN EU939544_HBe_P-C of FT:mat_peptide EU939544_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C39). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPTSREAVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939549_HBe_P-C Product feature CHAIN EU939549_HBe_P-C of FT:mat_peptide EU939549_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C49). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939550_HBe_P-C Product feature CHAIN EU939550_HBe_P-C of FT:mat_peptide EU939550_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C55). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939552_HBe_P-C Product feature CHAIN EU939552_HBe_P-C of FT:mat_peptide EU939552_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C57). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQLLWFHISCLTFGKETVLEYLVSFGVWIPTPPA
YRPPNAPILSTLPETTVVKQPGRSPRKRTPSPRKRRSQSPRRKRSQSRESQC
>gnl|hbvpro|EU939554_HBe_P-C Product feature CHAIN EU939554_HBe_P-C of FT:mat_peptide EU939554_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C61). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MLLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939557_HBe_P-C Product feature CHAIN EU939557_HBe_P-C of FT:mat_peptide EU939557_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C65). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939560_HBe_P-C Product feature CHAIN EU939560_HBe_P-C of FT:mat_peptide EU939560_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C69). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939561_HBe_P-C Product feature CHAIN EU939561_HBe_P-C of FT:mat_peptide EU939561_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C70). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939562_HBe_P-C Product feature CHAIN EU939562_HBe_P-C of FT:mat_peptide EU939562_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C75). Complete genome. [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHCY
>gnl|hbvpro|EU939564_HBe_P-C Product feature CHAIN EU939564_HBe_P-C of FT:mat_peptide EU939564_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C77). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939569_HBe_P-C Product feature CHAIN EU939569_HBe_P-C of FT:mat_peptide EU939569_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C102). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU939571_HBe_P-C Product feature CHAIN EU939571_HBe_P-C of FT:mat_peptide EU939571_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C104). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|EU939572_HBe_P-C Product feature CHAIN EU939572_HBe_P-C of FT:mat_peptide EU939572_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C105). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939573_HBe_P-C Product feature CHAIN EU939573_HBe_P-C of FT:mat_peptide EU939573_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C106). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939574_HBe_P-C Product feature CHAIN EU939574_HBe_P-C of FT:mat_peptide EU939574_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C109). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939578_HBe_P-C Product feature CHAIN EU939578_HBe_P-C of FT:mat_peptide EU939578_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C119). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939582_HBe_P-C Product feature CHAIN EU939582_HBe_P-C of FT:mat_peptide EU939582_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU939584_HBe_P-C Product feature CHAIN EU939584_HBe_P-C of FT:mat_peptide EU939584_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B107). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939586_HBe_P-C Product feature CHAIN EU939586_HBe_P-C of FT:mat_peptide EU939586_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B142). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAFLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPHRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939590_HBe_P-C Product feature CHAIN EU939590_HBe_P-C of FT:mat_peptide EU939590_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939591_HBe_P-C Product feature CHAIN EU939591_HBe_P-C of FT:mat_peptide EU939591_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C131). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939592_HBe_P-C Product feature CHAIN EU939592_HBe_P-C of FT:mat_peptide EU939592_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C141). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939593_HBe_P-C Product feature CHAIN EU939593_HBe_P-C of FT:mat_peptide EU939593_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C144). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939597_HBe_P-C Product feature CHAIN EU939597_HBe_P-C of FT:mat_peptide EU939597_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C151). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939599_HBe_P-C Product feature CHAIN EU939599_HBe_P-C of FT:mat_peptide EU939599_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C172). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVEVTNLATWVGSNLEDPASRELVVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRIRRSQSPRRTRSQSRESKC
>gnl|hbvpro|EU939600_HBe_P-C Product feature CHAIN EU939600_HBe_P-C of FT:mat_peptide EU939600_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C176). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939603_HBe_P-C Product feature CHAIN EU939603_HBe_P-C of FT:mat_peptide EU939603_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C183). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRQRGRSIRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939604_HBe_P-C Product feature CHAIN EU939604_HBe_P-C of FT:mat_peptide EU939604_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C192). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939605_HBe_P-C Product feature CHAIN EU939605_HBe_P-C of FT:mat_peptide EU939605_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C200). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSILPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|EU939609_HBe_P-C Product feature CHAIN EU939609_HBe_P-C of FT:mat_peptide EU939609_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C209). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939610_HBe_P-C Product feature CHAIN EU939610_HBe_P-C of FT:mat_peptide EU939610_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C211). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939611_HBe_P-C Product feature CHAIN EU939611_HBe_P-C of FT:mat_peptide EU939611_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C212). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939615_HBe_P-C Product feature CHAIN EU939615_HBe_P-C of FT:mat_peptide EU939615_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939618_HBe_P-C Product feature CHAIN EU939618_HBe_P-C of FT:mat_peptide EU939618_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C230). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939619_HBe_P-C Product feature CHAIN EU939619_HBe_P-C of FT:mat_peptide EU939619_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C233). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939625_HBe_P-C Product feature CHAIN EU939625_HBe_P-C of FT:mat_peptide EU939625_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C167). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRESVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|EU939626_HBe_P-C Product feature CHAIN EU939626_HBe_P-C of FT:mat_peptide EU939626_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D158). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MKLFHLCLIISCSCPTIQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939640_HBe_P-C Product feature CHAIN EU939640_HBe_P-C of FT:mat_peptide EU939640_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C239). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939641_HBe_P-C Product feature CHAIN EU939641_HBe_P-C of FT:mat_peptide EU939641_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D18). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALHREALESPEXCTPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939642_HBe_P-C Product feature CHAIN EU939642_HBe_P-C of FT:mat_peptide EU939642_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D20). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPLDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939643_HBe_P-C Product feature CHAIN EU939643_HBe_P-C of FT:mat_peptide EU939643_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D32). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAFALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939647_HBe_P-C Product feature CHAIN EU939647_HBe_P-C of FT:mat_peptide EU939647_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D90). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939648_HBe_P-C Product feature CHAIN EU939648_HBe_P-C of FT:mat_peptide EU939648_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D96). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EU939652_HBe_P-C Product feature CHAIN EU939652_HBe_P-C of FT:mat_peptide EU939652_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D107). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939658_HBe_P-C Product feature CHAIN EU939658_HBe_P-C of FT:mat_peptide EU939658_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D142). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALETPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRPGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023566_HBe_P-C Product feature CHAIN FJ023566_HBe_P-C of FT:mat_peptide FJ023566_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0026). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNTPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023567_HBe_P-C Product feature CHAIN FJ023567_HBe_P-C of FT:mat_peptide FJ023567_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0026). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023568_HBe_P-C Product feature CHAIN FJ023568_HBe_P-C of FT:mat_peptide FJ023568_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0026). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023571_HBe_P-C Product feature CHAIN FJ023571_HBe_P-C of FT:mat_peptide FJ023571_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0197). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023587_HBe_P-C Product feature CHAIN FJ023587_HBe_P-C of FT:mat_peptide FJ023587_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2742). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023589_HBe_P-C Product feature CHAIN FJ023589_HBe_P-C of FT:mat_peptide FJ023589_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2742). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023590_HBe_P-C Product feature CHAIN FJ023590_HBe_P-C of FT:mat_peptide FJ023590_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2742). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023591_HBe_P-C Product feature CHAIN FJ023591_HBe_P-C of FT:mat_peptide FJ023591_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2742). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023624_HBe_P-C Product feature CHAIN FJ023624_HBe_P-C of FT:mat_peptide FJ023624_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3733). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLIHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSFEDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023625_HBe_P-C Product feature CHAIN FJ023625_HBe_P-C of FT:mat_peptide FJ023625_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3733). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILPTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023640_HBe_P-C Product feature CHAIN FJ023640_HBe_P-C of FT:mat_peptide FJ023640_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1206). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YGPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023641_HBe_P-C Product feature CHAIN FJ023641_HBe_P-C of FT:mat_peptide FJ023641_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1237). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023642_HBe_P-C Product feature CHAIN FJ023642_HBe_P-C of FT:mat_peptide FJ023642_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1257). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023643_HBe_P-C Product feature CHAIN FJ023643_HBe_P-C of FT:mat_peptide FJ023643_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1306). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023644_HBe_P-C Product feature CHAIN FJ023644_HBe_P-C of FT:mat_peptide FJ023644_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1318). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023646_HBe_P-C Product feature CHAIN FJ023646_HBe_P-C of FT:mat_peptide FJ023646_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0201). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023647_HBe_P-C Product feature CHAIN FJ023647_HBe_P-C of FT:mat_peptide FJ023647_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0214). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023648_HBe_P-C Product feature CHAIN FJ023648_HBe_P-C of FT:mat_peptide FJ023648_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0273). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023649_HBe_P-C Product feature CHAIN FJ023649_HBe_P-C of FT:mat_peptide FJ023649_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0289). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023650_HBe_P-C Product feature CHAIN FJ023650_HBe_P-C of FT:mat_peptide FJ023650_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0341). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023652_HBe_P-C Product feature CHAIN FJ023652_HBe_P-C of FT:mat_peptide FJ023652_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0648). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPQNAPILSTLPETTVVRPRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023653_HBe_P-C Product feature CHAIN FJ023653_HBe_P-C of FT:mat_peptide FJ023653_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0909). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023654_HBe_P-C Product feature CHAIN FJ023654_HBe_P-C of FT:mat_peptide FJ023654_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1412). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023655_HBe_P-C Product feature CHAIN FJ023655_HBe_P-C of FT:mat_peptide FJ023655_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0754). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASREVVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023656_HBe_P-C Product feature CHAIN FJ023656_HBe_P-C of FT:mat_peptide FJ023656_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0938). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023657_HBe_P-C Product feature CHAIN FJ023657_HBe_P-C of FT:mat_peptide FJ023657_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0987). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023658_HBe_P-C Product feature CHAIN FJ023658_HBe_P-C of FT:mat_peptide FJ023658_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-1116). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ023677_HBe_P-C Product feature CHAIN FJ023677_HBe_P-C of FT:mat_peptide FJ023677_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1/I2_M04-0309). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMTLASWVGGNLEDPASRDLVVNYVNVNMGLKLKQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRQRGRSHRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032331_HBe_P-C Product feature CHAIN FJ032331_HBe_P-C of FT:mat_peptide FJ032331_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S193-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032332_HBe_P-C Product feature CHAIN FJ032332_HBe_P-C of FT:mat_peptide FJ032332_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-10). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032334_HBe_P-C Product feature CHAIN FJ032334_HBe_P-C of FT:mat_peptide FJ032334_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S445-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|FJ032339_HBe_P-C Product feature CHAIN FJ032339_HBe_P-C of FT:mat_peptide FJ032339_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032340_HBe_P-C Product feature CHAIN FJ032340_HBe_P-C of FT:mat_peptide FJ032340_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032341_HBe_P-C Product feature CHAIN FJ032341_HBe_P-C of FT:mat_peptide FJ032341_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032345_HBe_P-C Product feature CHAIN FJ032345_HBe_P-C of FT:mat_peptide FJ032345_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032346_HBe_P-C Product feature CHAIN FJ032346_HBe_P-C of FT:mat_peptide FJ032346_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032347_HBe_P-C Product feature CHAIN FJ032347_HBe_P-C of FT:mat_peptide FJ032347_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032350_HBe_P-C Product feature CHAIN FJ032350_HBe_P-C of FT:mat_peptide FJ032350_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032351_HBe_P-C Product feature CHAIN FJ032351_HBe_P-C of FT:mat_peptide FJ032351_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032355_HBe_P-C Product feature CHAIN FJ032355_HBe_P-C of FT:mat_peptide FJ032355_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032356_HBe_P-C Product feature CHAIN FJ032356_HBe_P-C of FT:mat_peptide FJ032356_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLGTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ032361_HBe_P-C Product feature CHAIN FJ032361_HBe_P-C of FT:mat_peptide FJ032361_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ151413_HBe_P-C Product feature CHAIN FJ151413_HBe_P-C of FT:mat_peptide FJ151413_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=211 residues).
MQLFHLCLIISCSCPTVQAFKLCLGWLWGMDIDPYKEFGASVELLSFLPSDLFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVFEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|FJ349225_HBe_P-C Product feature CHAIN FJ349225_HBe_P-C of FT:mat_peptide FJ349225_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H94). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386575_HBe_P-C Product feature CHAIN FJ386575_HBe_P-C of FT:mat_peptide FJ386575_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1745). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386576_HBe_P-C Product feature CHAIN FJ386576_HBe_P-C of FT:mat_peptide FJ386576_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1746). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386577_HBe_P-C Product feature CHAIN FJ386577_HBe_P-C of FT:mat_peptide FJ386577_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1747). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386579_HBe_P-C Product feature CHAIN FJ386579_HBe_P-C of FT:mat_peptide FJ386579_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1762). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPLDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386587_HBe_P-C Product feature CHAIN FJ386587_HBe_P-C of FT:mat_peptide FJ386587_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1812). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386588_HBe_P-C Product feature CHAIN FJ386588_HBe_P-C of FT:mat_peptide FJ386588_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1828). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386589_HBe_P-C Product feature CHAIN FJ386589_HBe_P-C of FT:mat_peptide FJ386589_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1830). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386591_HBe_P-C Product feature CHAIN FJ386591_HBe_P-C of FT:mat_peptide FJ386591_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1869). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386594_HBe_P-C Product feature CHAIN FJ386594_HBe_P-C of FT:mat_peptide FJ386594_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1878). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386595_HBe_P-C Product feature CHAIN FJ386595_HBe_P-C of FT:mat_peptide FJ386595_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1879). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386598_HBe_P-C Product feature CHAIN FJ386598_HBe_P-C of FT:mat_peptide FJ386598_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1889). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALXREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386601_HBe_P-C Product feature CHAIN FJ386601_HBe_P-C of FT:mat_peptide FJ386601_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1912). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386603_HBe_P-C Product feature CHAIN FJ386603_HBe_P-C of FT:mat_peptide FJ386603_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1949). Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIFSCSCPTGQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386605_HBe_P-C Product feature CHAIN FJ386605_HBe_P-C of FT:mat_peptide FJ386605_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1965). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386607_HBe_P-C Product feature CHAIN FJ386607_HBe_P-C of FT:mat_peptide FJ386607_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1967). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386609_HBe_P-C Product feature CHAIN FJ386609_HBe_P-C of FT:mat_peptide FJ386609_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1999). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386612_HBe_P-C Product feature CHAIN FJ386612_HBe_P-C of FT:mat_peptide FJ386612_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2019). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386616_HBe_P-C Product feature CHAIN FJ386616_HBe_P-C of FT:mat_peptide FJ386616_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2064). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ386617_HBe_P-C Product feature CHAIN FJ386617_HBe_P-C of FT:mat_peptide FJ386617_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2093). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGGLWDMDIDHYKEFGASVELLSFLPFDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ386618_HBe_P-C Product feature CHAIN FJ386618_HBe_P-C of FT:mat_peptide FJ386618_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2111). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386619_HBe_P-C Product feature CHAIN FJ386619_HBe_P-C of FT:mat_peptide FJ386619_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2119). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386620_HBe_P-C Product feature CHAIN FJ386620_HBe_P-C of FT:mat_peptide FJ386620_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2121). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386626_HBe_P-C Product feature CHAIN FJ386626_HBe_P-C of FT:mat_peptide FJ386626_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2205). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRQCRSSRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386627_HBe_P-C Product feature CHAIN FJ386627_HBe_P-C of FT:mat_peptide FJ386627_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2242). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386628_HBe_P-C Product feature CHAIN FJ386628_HBe_P-C of FT:mat_peptide FJ386628_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2255). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386629_HBe_P-C Product feature CHAIN FJ386629_HBe_P-C of FT:mat_peptide FJ386629_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2286). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386631_HBe_P-C Product feature CHAIN FJ386631_HBe_P-C of FT:mat_peptide FJ386631_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2359). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386632_HBe_P-C Product feature CHAIN FJ386632_HBe_P-C of FT:mat_peptide FJ386632_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2370). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386637_HBe_P-C Product feature CHAIN FJ386637_HBe_P-C of FT:mat_peptide FJ386637_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2151). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386638_HBe_P-C Product feature CHAIN FJ386638_HBe_P-C of FT:mat_peptide FJ386638_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2015). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDXLDTASALHREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386639_HBe_P-C Product feature CHAIN FJ386639_HBe_P-C of FT:mat_peptide FJ386639_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1929). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386640_HBe_P-C Product feature CHAIN FJ386640_HBe_P-C of FT:mat_peptide FJ386640_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2168). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|FJ386641_HBe_P-C Product feature CHAIN FJ386641_HBe_P-C of FT:mat_peptide FJ386641_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2236). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386644_HBe_P-C Product feature CHAIN FJ386644_HBe_P-C of FT:mat_peptide FJ386644_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S737). Complete genome. [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPFEFFLSIRDLLDTASALYREPLESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386647_HBe_P-C Product feature CHAIN FJ386647_HBe_P-C of FT:mat_peptide FJ386647_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2400). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386650_HBe_P-C Product feature CHAIN FJ386650_HBe_P-C of FT:mat_peptide FJ386650_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2468). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLLISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELLNLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386651_HBe_P-C Product feature CHAIN FJ386651_HBe_P-C of FT:mat_peptide FJ386651_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2476). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386652_HBe_P-C Product feature CHAIN FJ386652_HBe_P-C of FT:mat_peptide FJ386652_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2518). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ386653_HBe_P-C Product feature CHAIN FJ386653_HBe_P-C of FT:mat_peptide FJ386653_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|FJ386657_HBe_P-C Product feature CHAIN FJ386657_HBe_P-C of FT:mat_peptide FJ386657_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S165). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386659_HBe_P-C Product feature CHAIN FJ386659_HBe_P-C of FT:mat_peptide FJ386659_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S219). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386662_HBe_P-C Product feature CHAIN FJ386662_HBe_P-C of FT:mat_peptide FJ386662_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S269). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDLYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELINLATWVGSNVEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386664_HBe_P-C Product feature CHAIN FJ386664_HBe_P-C of FT:mat_peptide FJ386664_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S310). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386667_HBe_P-C Product feature CHAIN FJ386667_HBe_P-C of FT:mat_peptide FJ386667_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S379). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRFPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386672_HBe_P-C Product feature CHAIN FJ386672_HBe_P-C of FT:mat_peptide FJ386672_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S606). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGSSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386673_HBe_P-C Product feature CHAIN FJ386673_HBe_P-C of FT:mat_peptide FJ386673_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S633). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ386678_HBe_P-C Product feature CHAIN FJ386678_HBe_P-C of FT:mat_peptide FJ386678_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1147). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ386679_HBe_P-C Product feature CHAIN FJ386679_HBe_P-C of FT:mat_peptide FJ386679_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1217). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ386685_HBe_P-C Product feature CHAIN FJ386685_HBe_P-C of FT:mat_peptide FJ386685_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1568). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASXELLSFLPSDFFPSIRDLXDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ518810_HBe_P-C Product feature CHAIN FJ518810_HBe_P-C of FT:mat_peptide FJ518810_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIQDLIDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ518813_HBe_P-C Product feature CHAIN FJ518813_HBe_P-C of FT:mat_peptide FJ518813_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562218_HBe_P-C Product feature CHAIN FJ562218_HBe_P-C of FT:mat_peptide FJ562218_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562232_HBe_P-C Product feature CHAIN FJ562232_HBe_P-C of FT:mat_peptide FJ562232_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I45). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562238_HBe_P-C Product feature CHAIN FJ562238_HBe_P-C of FT:mat_peptide FJ562238_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I62). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDLYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAAVCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562243_HBe_P-C Product feature CHAIN FJ562243_HBe_P-C of FT:mat_peptide FJ562243_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I71). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562244_HBe_P-C Product feature CHAIN FJ562244_HBe_P-C of FT:mat_peptide FJ562244_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I72). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562245_HBe_P-C Product feature CHAIN FJ562245_HBe_P-C of FT:mat_peptide FJ562245_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I73). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562248_HBe_P-C Product feature CHAIN FJ562248_HBe_P-C of FT:mat_peptide FJ562248_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I76). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAVRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVKVNMGLKRGQKSWFHISCPTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562252_HBe_P-C Product feature CHAIN FJ562252_HBe_P-C of FT:mat_peptide FJ562252_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I85). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ562258_HBe_P-C Product feature CHAIN FJ562258_HBe_P-C of FT:mat_peptide FJ562258_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I97). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562264_HBe_P-C Product feature CHAIN FJ562264_HBe_P-C of FT:mat_peptide FJ562264_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I114). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPTIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ562265_HBe_P-C Product feature CHAIN FJ562265_HBe_P-C of FT:mat_peptide FJ562265_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I116). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562266_HBe_P-C Product feature CHAIN FJ562266_HBe_P-C of FT:mat_peptide FJ562266_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I118). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ562268_HBe_P-C Product feature CHAIN FJ562268_HBe_P-C of FT:mat_peptide FJ562268_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I121). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562269_HBe_P-C Product feature CHAIN FJ562269_HBe_P-C of FT:mat_peptide FJ562269_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I122). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562272_HBe_P-C Product feature CHAIN FJ562272_HBe_P-C of FT:mat_peptide FJ562272_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I125). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562273_HBe_P-C Product feature CHAIN FJ562273_HBe_P-C of FT:mat_peptide FJ562273_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I127). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELTNLATWVGSNLEDPASRELVVGYVNGNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562274_HBe_P-C Product feature CHAIN FJ562274_HBe_P-C of FT:mat_peptide FJ562274_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I128). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562279_HBe_P-C Product feature CHAIN FJ562279_HBe_P-C of FT:mat_peptide FJ562279_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I140). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562281_HBe_P-C Product feature CHAIN FJ562281_HBe_P-C of FT:mat_peptide FJ562281_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I143). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562282_HBe_P-C Product feature CHAIN FJ562282_HBe_P-C of FT:mat_peptide FJ562282_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I144). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFLLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562283_HBe_P-C Product feature CHAIN FJ562283_HBe_P-C of FT:mat_peptide FJ562283_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I145). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562285_HBe_P-C Product feature CHAIN FJ562285_HBe_P-C of FT:mat_peptide FJ562285_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I147). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562288_HBe_P-C Product feature CHAIN FJ562288_HBe_P-C of FT:mat_peptide FJ562288_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I153). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562290_HBe_P-C Product feature CHAIN FJ562290_HBe_P-C of FT:mat_peptide FJ562290_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I162). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562293_HBe_P-C Product feature CHAIN FJ562293_HBe_P-C of FT:mat_peptide FJ562293_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I167). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562295_HBe_P-C Product feature CHAIN FJ562295_HBe_P-C of FT:mat_peptide FJ562295_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I169). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562297_HBe_P-C Product feature CHAIN FJ562297_HBe_P-C of FT:mat_peptide FJ562297_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I172). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562298_HBe_P-C Product feature CHAIN FJ562298_HBe_P-C of FT:mat_peptide FJ562298_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I174). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562299_HBe_P-C Product feature CHAIN FJ562299_HBe_P-C of FT:mat_peptide FJ562299_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I175). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562304_HBe_P-C Product feature CHAIN FJ562304_HBe_P-C of FT:mat_peptide FJ562304_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I190). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQEILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562307_HBe_P-C Product feature CHAIN FJ562307_HBe_P-C of FT:mat_peptide FJ562307_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I197). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562308_HBe_P-C Product feature CHAIN FJ562308_HBe_P-C of FT:mat_peptide FJ562308_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I199). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPNA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562318_HBe_P-C Product feature CHAIN FJ562318_HBe_P-C of FT:mat_peptide FJ562318_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I211). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562319_HBe_P-C Product feature CHAIN FJ562319_HBe_P-C of FT:mat_peptide FJ562319_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I212). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562320_HBe_P-C Product feature CHAIN FJ562320_HBe_P-C of FT:mat_peptide FJ562320_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I213). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562323_HBe_P-C Product feature CHAIN FJ562323_HBe_P-C of FT:mat_peptide FJ562323_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I217). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562324_HBe_P-C Product feature CHAIN FJ562324_HBe_P-C of FT:mat_peptide FJ562324_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I219). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562325_HBe_P-C Product feature CHAIN FJ562325_HBe_P-C of FT:mat_peptide FJ562325_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I223). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562327_HBe_P-C Product feature CHAIN FJ562327_HBe_P-C of FT:mat_peptide FJ562327_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I228). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHSCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSSLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562329_HBe_P-C Product feature CHAIN FJ562329_HBe_P-C of FT:mat_peptide FJ562329_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I230). Complete genome. [Hepadnaviridae] (length=212 residues).
KQLFHLCLIISCSCPTVQASKLLIGWLWGMDIDPYKEFGAPVDILFFFPSDFFPSIQDLLDTAWPLYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELGVGYVNGNMGLKFRQIWWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562332_HBe_P-C Product feature CHAIN FJ562332_HBe_P-C of FT:mat_peptide FJ562332_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I42). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLSHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562333_HBe_P-C Product feature CHAIN FJ562333_HBe_P-C of FT:mat_peptide FJ562333_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I78). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562334_HBe_P-C Product feature CHAIN FJ562334_HBe_P-C of FT:mat_peptide FJ562334_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I82). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715341_HBe_P-C Product feature CHAIN FJ715341_HBe_P-C of FT:mat_peptide FJ715341_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC11). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715342_HBe_P-C Product feature CHAIN FJ715342_HBe_P-C of FT:mat_peptide FJ715342_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRMSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715343_HBe_P-C Product feature CHAIN FJ715343_HBe_P-C of FT:mat_peptide FJ715343_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLVTWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNALFLSTLAETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715344_HBe_P-C Product feature CHAIN FJ715344_HBe_P-C of FT:mat_peptide FJ715344_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGMSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715350_HBe_P-C Product feature CHAIN FJ715350_HBe_P-C of FT:mat_peptide FJ715350_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715351_HBe_P-C Product feature CHAIN FJ715351_HBe_P-C of FT:mat_peptide FJ715351_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715352_HBe_P-C Product feature CHAIN FJ715352_HBe_P-C of FT:mat_peptide FJ715352_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715353_HBe_P-C Product feature CHAIN FJ715353_HBe_P-C of FT:mat_peptide FJ715353_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715355_HBe_P-C Product feature CHAIN FJ715355_HBe_P-C of FT:mat_peptide FJ715355_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715357_HBe_P-C Product feature CHAIN FJ715357_HBe_P-C of FT:mat_peptide FJ715357_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSGFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715358_HBe_P-C Product feature CHAIN FJ715358_HBe_P-C of FT:mat_peptide FJ715358_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715359_HBe_P-C Product feature CHAIN FJ715359_HBe_P-C of FT:mat_peptide FJ715359_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715364_HBe_P-C Product feature CHAIN FJ715364_HBe_P-C of FT:mat_peptide FJ715364_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC72). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRLPNAPILSTLPETTVVRRRGSSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715365_HBe_P-C Product feature CHAIN FJ715365_HBe_P-C of FT:mat_peptide FJ715365_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC73). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715366_HBe_P-C Product feature CHAIN FJ715366_HBe_P-C of FT:mat_peptide FJ715366_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC74). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSSRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715367_HBe_P-C Product feature CHAIN FJ715367_HBe_P-C of FT:mat_peptide FJ715367_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC75). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFVPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715368_HBe_P-C Product feature CHAIN FJ715368_HBe_P-C of FT:mat_peptide FJ715368_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC81). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715370_HBe_P-C Product feature CHAIN FJ715370_HBe_P-C of FT:mat_peptide FJ715370_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC83). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715371_HBe_P-C Product feature CHAIN FJ715371_HBe_P-C of FT:mat_peptide FJ715371_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715372_HBe_P-C Product feature CHAIN FJ715372_HBe_P-C of FT:mat_peptide FJ715372_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQPRESQC
>gnl|hbvpro|FJ715374_HBe_P-C Product feature CHAIN FJ715374_HBe_P-C of FT:mat_peptide FJ715374_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715375_HBe_P-C Product feature CHAIN FJ715375_HBe_P-C of FT:mat_peptide FJ715375_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREAVPEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715376_HBe_P-C Product feature CHAIN FJ715376_HBe_P-C of FT:mat_peptide FJ715376_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTTSALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715377_HBe_P-C Product feature CHAIN FJ715377_HBe_P-C of FT:mat_peptide FJ715377_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715378_HBe_P-C Product feature CHAIN FJ715378_HBe_P-C of FT:mat_peptide FJ715378_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715379_HBe_P-C Product feature CHAIN FJ715379_HBe_P-C of FT:mat_peptide FJ715379_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715380_HBe_P-C Product feature CHAIN FJ715380_HBe_P-C of FT:mat_peptide FJ715380_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLILSCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715381_HBe_P-C Product feature CHAIN FJ715381_HBe_P-C of FT:mat_peptide FJ715381_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPT
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715382_HBe_P-C Product feature CHAIN FJ715382_HBe_P-C of FT:mat_peptide FJ715382_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715383_HBe_P-C Product feature CHAIN FJ715383_HBe_P-C of FT:mat_peptide FJ715383_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRGRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715389_HBe_P-C Product feature CHAIN FJ715389_HBe_P-C of FT:mat_peptide FJ715389_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM62). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPFIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715390_HBe_P-C Product feature CHAIN FJ715390_HBe_P-C of FT:mat_peptide FJ715390_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM63). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLISFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715391_HBe_P-C Product feature CHAIN FJ715391_HBe_P-C of FT:mat_peptide FJ715391_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLRETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715392_HBe_P-C Product feature CHAIN FJ715392_HBe_P-C of FT:mat_peptide FJ715392_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM71). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEYCSPH
HTALRQAILCWGELMNLATWAGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715395_HBe_P-C Product feature CHAIN FJ715395_HBe_P-C of FT:mat_peptide FJ715395_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM81). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715397_HBe_P-C Product feature CHAIN FJ715397_HBe_P-C of FT:mat_peptide FJ715397_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM83). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715398_HBe_P-C Product feature CHAIN FJ715398_HBe_P-C of FT:mat_peptide FJ715398_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715400_HBe_P-C Product feature CHAIN FJ715400_HBe_P-C of FT:mat_peptide FJ715400_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715402_HBe_P-C Product feature CHAIN FJ715402_HBe_P-C of FT:mat_peptide FJ715402_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715403_HBe_P-C Product feature CHAIN FJ715403_HBe_P-C of FT:mat_peptide FJ715403_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVRIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRGRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715404_HBe_P-C Product feature CHAIN FJ715404_HBe_P-C of FT:mat_peptide FJ715404_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELPSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSLRRRRSQSRESQC
>gnl|hbvpro|FJ715405_HBe_P-C Product feature CHAIN FJ715405_HBe_P-C of FT:mat_peptide FJ715405_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715406_HBe_P-C Product feature CHAIN FJ715406_HBe_P-C of FT:mat_peptide FJ715406_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELPSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715407_HBe_P-C Product feature CHAIN FJ715407_HBe_P-C of FT:mat_peptide FJ715407_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN41). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715409_HBe_P-C Product feature CHAIN FJ715409_HBe_P-C of FT:mat_peptide FJ715409_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715418_HBe_P-C Product feature CHAIN FJ715418_HBe_P-C of FT:mat_peptide FJ715418_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLQSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715421_HBe_P-C Product feature CHAIN FJ715421_HBe_P-C of FT:mat_peptide FJ715421_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN71). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVSVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPT
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715422_HBe_P-C Product feature CHAIN FJ715422_HBe_P-C of FT:mat_peptide FJ715422_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN72). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVIRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ715424_HBe_P-C Product feature CHAIN FJ715424_HBe_P-C of FT:mat_peptide FJ715424_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN74). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRGRSQSRESQC
>gnl|hbvpro|FJ751764_HBe_P-C Product feature CHAIN FJ751764_HBe_P-C of FT:mat_peptide FJ751764_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ751765_HBe_P-C Product feature CHAIN FJ751765_HBe_P-C of FT:mat_peptide FJ751765_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFSSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ751770_HBe_P-C Product feature CHAIN FJ751770_HBe_P-C of FT:mat_peptide FJ751770_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=211 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|FJ787439_HBe_P-C Product feature CHAIN FJ787439_HBe_P-C of FT:mat_peptide FJ787439_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787441_HBe_P-C Product feature CHAIN FJ787441_HBe_P-C of FT:mat_peptide FJ787441_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787442_HBe_P-C Product feature CHAIN FJ787442_HBe_P-C of FT:mat_peptide FJ787442_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLSGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787443_HBe_P-C Product feature CHAIN FJ787443_HBe_P-C of FT:mat_peptide FJ787443_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787447_HBe_P-C Product feature CHAIN FJ787447_HBe_P-C of FT:mat_peptide FJ787447_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S461-2). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787449_HBe_P-C Product feature CHAIN FJ787449_HBe_P-C of FT:mat_peptide FJ787449_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S567-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|FJ787453_HBe_P-C Product feature CHAIN FJ787453_HBe_P-C of FT:mat_peptide FJ787453_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787454_HBe_P-C Product feature CHAIN FJ787454_HBe_P-C of FT:mat_peptide FJ787454_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQPFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787455_HBe_P-C Product feature CHAIN FJ787455_HBe_P-C of FT:mat_peptide FJ787455_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRGRSQSRESQC
>gnl|hbvpro|FJ787456_HBe_P-C Product feature CHAIN FJ787456_HBe_P-C of FT:mat_peptide FJ787456_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVTHVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787457_HBe_P-C Product feature CHAIN FJ787457_HBe_P-C of FT:mat_peptide FJ787457_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELFSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|FJ787458_HBe_P-C Product feature CHAIN FJ787458_HBe_P-C of FT:mat_peptide FJ787458_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-9). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787461_HBe_P-C Product feature CHAIN FJ787461_HBe_P-C of FT:mat_peptide FJ787461_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQEILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787462_HBe_P-C Product feature CHAIN FJ787462_HBe_P-C of FT:mat_peptide FJ787462_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787463_HBe_P-C Product feature CHAIN FJ787463_HBe_P-C of FT:mat_peptide FJ787463_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-6). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787464_HBe_P-C Product feature CHAIN FJ787464_HBe_P-C of FT:mat_peptide FJ787464_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787465_HBe_P-C Product feature CHAIN FJ787465_HBe_P-C of FT:mat_peptide FJ787465_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-5). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLYLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787466_HBe_P-C Product feature CHAIN FJ787466_HBe_P-C of FT:mat_peptide FJ787466_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787467_HBe_P-C Product feature CHAIN FJ787467_HBe_P-C of FT:mat_peptide FJ787467_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787468_HBe_P-C Product feature CHAIN FJ787468_HBe_P-C of FT:mat_peptide FJ787468_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787469_HBe_P-C Product feature CHAIN FJ787469_HBe_P-C of FT:mat_peptide FJ787469_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPLPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787471_HBe_P-C Product feature CHAIN FJ787471_HBe_P-C of FT:mat_peptide FJ787471_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|FJ787479_HBe_P-C Product feature CHAIN FJ787479_HBe_P-C of FT:mat_peptide FJ787479_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ787481_HBe_P-C Product feature CHAIN FJ787481_HBe_P-C of FT:mat_peptide FJ787481_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-2). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ848339_HBe_P-C Product feature CHAIN FJ848339_HBe_P-C of FT:mat_peptide FJ848339_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, Pol, HBSP). [Hepadnaviridae] (length=210 residues).
FFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASGELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHT
ALRQAFVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYR
PPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899763_HBe_P-C Product feature CHAIN FJ899763_HBe_P-C of FT:mat_peptide FJ899763_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899775_HBe_P-C Product feature CHAIN FJ899775_HBe_P-C of FT:mat_peptide FJ899775_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899777_HBe_P-C Product feature CHAIN FJ899777_HBe_P-C of FT:mat_peptide FJ899777_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ899788_HBe_P-C Product feature CHAIN FJ899788_HBe_P-C of FT:mat_peptide FJ899788_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWSHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ899789_HBe_P-C Product feature CHAIN FJ899789_HBe_P-C of FT:mat_peptide FJ899789_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ904423_HBe_P-C Product feature CHAIN FJ904423_HBe_P-C of FT:mat_peptide FJ904423_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate A78). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRESVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPIA
YRPSNAPILSTLPETTVVRQRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227693_HBe_P-C Product feature CHAIN GQ227693_HBe_P-C of FT:mat_peptide GQ227693_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-1). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227694_HBe_P-C Product feature CHAIN GQ227694_HBe_P-C of FT:mat_peptide GQ227694_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-2). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVPFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227695_HBe_P-C Product feature CHAIN GQ227695_HBe_P-C of FT:mat_peptide GQ227695_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-5). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGTDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRGSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ227696_HBe_P-C Product feature CHAIN GQ227696_HBe_P-C of FT:mat_peptide GQ227696_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLTTWVGSNLEDQASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ259588_HBe_P-C Product feature CHAIN GQ259588_HBe_P-C of FT:mat_peptide GQ259588_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-22). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358154_HBe_P-C Product feature CHAIN GQ358154_HBe_P-C of FT:mat_peptide GQ358154_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SLK126). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358157_HBe_P-C Product feature CHAIN GQ358157_HBe_P-C of FT:mat_peptide GQ358157_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M007). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ358158_HBe_C-C Product feature CHAIN GQ358158_HBe_C-C of FT:mat_peptide GQ358158_HBe_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M154). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377514_HBe_P-C Product feature CHAIN GQ377514_HBe_P-C of FT:mat_peptide GQ377514_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J8). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377515_HBe_P-C Product feature CHAIN GQ377515_HBe_P-C of FT:mat_peptide GQ377515_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377517_HBe_P-C Product feature CHAIN GQ377517_HBe_P-C of FT:mat_peptide GQ377517_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377518_HBe_P-C Product feature CHAIN GQ377518_HBe_P-C of FT:mat_peptide GQ377518_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ377521_HBe_P-C Product feature CHAIN GQ377521_HBe_P-C of FT:mat_peptide GQ377521_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|GQ377523_HBe_P-C Product feature CHAIN GQ377523_HBe_P-C of FT:mat_peptide GQ377523_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J21). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377524_HBe_P-C Product feature CHAIN GQ377524_HBe_P-C of FT:mat_peptide GQ377524_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J23). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377526_HBe_P-C Product feature CHAIN GQ377526_HBe_P-C of FT:mat_peptide GQ377526_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J27). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377527_HBe_P-C Product feature CHAIN GQ377527_HBe_P-C of FT:mat_peptide GQ377527_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J28). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377528_HBe_P-C Product feature CHAIN GQ377528_HBe_P-C of FT:mat_peptide GQ377528_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J29). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377529_HBe_P-C Product feature CHAIN GQ377529_HBe_P-C of FT:mat_peptide GQ377529_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J34). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377531_HBe_P-C Product feature CHAIN GQ377531_HBe_P-C of FT:mat_peptide GQ377531_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J36). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377533_HBe_P-C Product feature CHAIN GQ377533_HBe_P-C of FT:mat_peptide GQ377533_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J39). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377535_HBe_P-C Product feature CHAIN GQ377535_HBe_P-C of FT:mat_peptide GQ377535_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J45). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377536_HBe_P-C Product feature CHAIN GQ377536_HBe_P-C of FT:mat_peptide GQ377536_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J47). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377538_HBe_P-C Product feature CHAIN GQ377538_HBe_P-C of FT:mat_peptide GQ377538_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J52). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377540_HBe_P-C Product feature CHAIN GQ377540_HBe_P-C of FT:mat_peptide GQ377540_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J57). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377541_HBe_P-C Product feature CHAIN GQ377541_HBe_P-C of FT:mat_peptide GQ377541_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J58). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377543_HBe_P-C Product feature CHAIN GQ377543_HBe_P-C of FT:mat_peptide GQ377543_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J63). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ377545_HBe_P-C Product feature CHAIN GQ377545_HBe_P-C of FT:mat_peptide GQ377545_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J76). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377551_HBe_P-C Product feature CHAIN GQ377551_HBe_P-C of FT:mat_peptide GQ377551_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J82). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377552_HBe_P-C Product feature CHAIN GQ377552_HBe_P-C of FT:mat_peptide GQ377552_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J83). Complete genome. [Hepadnaviridae] (length=212 residues).
KQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGGSEELLSFLPSDLFPFIRDILDRGDALYREALECPEHCSPP
HTALRQAILCWGELMNLTPWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377553_HBe_P-C Product feature CHAIN GQ377553_HBe_P-C of FT:mat_peptide GQ377553_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J84). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377554_HBe_P-C Product feature CHAIN GQ377554_HBe_P-C of FT:mat_peptide GQ377554_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J85). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377555_HBe_P-C Product feature CHAIN GQ377555_HBe_P-C of FT:mat_peptide GQ377555_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J86). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377559_HBe_P-C Product feature CHAIN GQ377559_HBe_P-C of FT:mat_peptide GQ377559_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J92). Complete genome. [Hepadnaviridae] (length=212 residues).
TQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377562_HBe_P-C Product feature CHAIN GQ377562_HBe_P-C of FT:mat_peptide GQ377562_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J97). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377563_HBe_P-C Product feature CHAIN GQ377563_HBe_P-C of FT:mat_peptide GQ377563_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J98). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLEWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377570_HBe_P-C Product feature CHAIN GQ377570_HBe_P-C of FT:mat_peptide GQ377570_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J110). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377571_HBe_P-C Product feature CHAIN GQ377571_HBe_P-C of FT:mat_peptide GQ377571_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J112). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377572_HBe_P-C Product feature CHAIN GQ377572_HBe_P-C of FT:mat_peptide GQ377572_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J113). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377574_HBe_P-C Product feature CHAIN GQ377574_HBe_P-C of FT:mat_peptide GQ377574_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J115). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377576_HBe_P-C Product feature CHAIN GQ377576_HBe_P-C of FT:mat_peptide GQ377576_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J117). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377577_HBe_P-C Product feature CHAIN GQ377577_HBe_P-C of FT:mat_peptide GQ377577_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J118). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377578_HBe_P-C Product feature CHAIN GQ377578_HBe_P-C of FT:mat_peptide GQ377578_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J125). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377579_HBe_P-C Product feature CHAIN GQ377579_HBe_P-C of FT:mat_peptide GQ377579_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J126). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377580_HBe_P-C Product feature CHAIN GQ377580_HBe_P-C of FT:mat_peptide GQ377580_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J127). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377583_HBe_P-C Product feature CHAIN GQ377583_HBe_P-C of FT:mat_peptide GQ377583_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J132). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377584_HBe_P-C Product feature CHAIN GQ377584_HBe_P-C of FT:mat_peptide GQ377584_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J133). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377585_HBe_P-C Product feature CHAIN GQ377585_HBe_P-C of FT:mat_peptide GQ377585_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J134). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377591_HBe_P-C Product feature CHAIN GQ377591_HBe_P-C of FT:mat_peptide GQ377591_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J148). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377593_HBe_P-C Product feature CHAIN GQ377593_HBe_P-C of FT:mat_peptide GQ377593_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J150). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377597_HBe_P-C Product feature CHAIN GQ377597_HBe_P-C of FT:mat_peptide GQ377597_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J157). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLMWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377598_HBe_P-C Product feature CHAIN GQ377598_HBe_P-C of FT:mat_peptide GQ377598_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J158). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377600_HBe_P-C Product feature CHAIN GQ377600_HBe_P-C of FT:mat_peptide GQ377600_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J161). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377601_HBe_P-C Product feature CHAIN GQ377601_HBe_P-C of FT:mat_peptide GQ377601_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J164). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377605_HBe_P-C Product feature CHAIN GQ377605_HBe_P-C of FT:mat_peptide GQ377605_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J169). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ377609_HBe_P-C Product feature CHAIN GQ377609_HBe_P-C of FT:mat_peptide GQ377609_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J176). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377615_HBe_P-C Product feature CHAIN GQ377615_HBe_P-C of FT:mat_peptide GQ377615_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J186). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377616_HBe_P-C Product feature CHAIN GQ377616_HBe_P-C of FT:mat_peptide GQ377616_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J192). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377617_HBe_P-C Product feature CHAIN GQ377617_HBe_P-C of FT:mat_peptide GQ377617_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J193). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377618_HBe_P-C Product feature CHAIN GQ377618_HBe_P-C of FT:mat_peptide GQ377618_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J194). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377619_HBe_P-C Product feature CHAIN GQ377619_HBe_P-C of FT:mat_peptide GQ377619_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J195). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377620_HBe_P-C Product feature CHAIN GQ377620_HBe_P-C of FT:mat_peptide GQ377620_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J197). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDLDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377623_HBe_P-C Product feature CHAIN GQ377623_HBe_P-C of FT:mat_peptide GQ377623_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J208). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSHH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPEITVVRQRGRSPRRRTPSPRRRRSQSPRCRRSQSREPRC
>gnl|hbvpro|GQ377624_HBe_P-C Product feature CHAIN GQ377624_HBe_P-C of FT:mat_peptide GQ377624_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J221). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377628_HBe_P-C Product feature CHAIN GQ377628_HBe_P-C of FT:mat_peptide GQ377628_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J232). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377631_HBe_P-C Product feature CHAIN GQ377631_HBe_P-C of FT:mat_peptide GQ377631_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J239). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377632_HBe_P-C Product feature CHAIN GQ377632_HBe_P-C of FT:mat_peptide GQ377632_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J240). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377636_HBe_P-C Product feature CHAIN GQ377636_HBe_P-C of FT:mat_peptide GQ377636_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J248). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377637_HBe_P-C Product feature CHAIN GQ377637_HBe_P-C of FT:mat_peptide GQ377637_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J249). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377640_HBe_P-C Product feature CHAIN GQ377640_HBe_P-C of FT:mat_peptide GQ377640_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J253). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ377642_HBe_P-C Product feature CHAIN GQ377642_HBe_P-C of FT:mat_peptide GQ377642_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J256). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475305_HBe_P-C Product feature CHAIN GQ475305_HBe_P-C of FT:mat_peptide GQ475305_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR1CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475306_HBe_P-C Product feature CHAIN GQ475306_HBe_P-C of FT:mat_peptide GQ475306_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR2CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475307_HBe_P-C Product feature CHAIN GQ475307_HBe_P-C of FT:mat_peptide GQ475307_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR3CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475308_HBe_P-C Product feature CHAIN GQ475308_HBe_P-C of FT:mat_peptide GQ475308_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR4CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475309_HBe_P-C Product feature CHAIN GQ475309_HBe_P-C of FT:mat_peptide GQ475309_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR5CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475310_HBe_P-C Product feature CHAIN GQ475310_HBe_P-C of FT:mat_peptide GQ475310_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR6CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475311_HBe_P-C Product feature CHAIN GQ475311_HBe_P-C of FT:mat_peptide GQ475311_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR7CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475312_HBe_P-C Product feature CHAIN GQ475312_HBe_P-C of FT:mat_peptide GQ475312_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR8CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475313_HBe_P-C Product feature CHAIN GQ475313_HBe_P-C of FT:mat_peptide GQ475313_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR9CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475314_HBe_P-C Product feature CHAIN GQ475314_HBe_P-C of FT:mat_peptide GQ475314_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR10CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475315_HBe_P-C Product feature CHAIN GQ475315_HBe_P-C of FT:mat_peptide GQ475315_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR11CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475316_HBe_P-C Product feature CHAIN GQ475316_HBe_P-C of FT:mat_peptide GQ475316_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR12CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475317_HBe_P-C Product feature CHAIN GQ475317_HBe_P-C of FT:mat_peptide GQ475317_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR13CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475318_HBe_P-C Product feature CHAIN GQ475318_HBe_P-C of FT:mat_peptide GQ475318_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR14CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475319_HBe_P-C Product feature CHAIN GQ475319_HBe_P-C of FT:mat_peptide GQ475319_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR15CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475320_HBe_P-C Product feature CHAIN GQ475320_HBe_P-C of FT:mat_peptide GQ475320_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR16CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475321_HBe_P-C Product feature CHAIN GQ475321_HBe_P-C of FT:mat_peptide GQ475321_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR17CHB). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ475322_HBe_P-C Product feature CHAIN GQ475322_HBe_P-C of FT:mat_peptide GQ475322_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR18LC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475325_HBe_P-C Product feature CHAIN GQ475325_HBe_P-C of FT:mat_peptide GQ475325_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR21LC). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|GQ475326_HBe_P-C Product feature CHAIN GQ475326_HBe_P-C of FT:mat_peptide GQ475326_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR22LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ475327_HBe_P-C Product feature CHAIN GQ475327_HBe_P-C of FT:mat_peptide GQ475327_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR23LC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475328_HBe_P-C Product feature CHAIN GQ475328_HBe_P-C of FT:mat_peptide GQ475328_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR24LC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475329_HBe_P-C Product feature CHAIN GQ475329_HBe_P-C of FT:mat_peptide GQ475329_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR25LC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475330_HBe_P-C Product feature CHAIN GQ475330_HBe_P-C of FT:mat_peptide GQ475330_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR26LC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475331_HBe_P-C Product feature CHAIN GQ475331_HBe_P-C of FT:mat_peptide GQ475331_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR27LC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475332_HBe_P-C Product feature CHAIN GQ475332_HBe_P-C of FT:mat_peptide GQ475332_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR28LC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475333_HBe_P-C Product feature CHAIN GQ475333_HBe_P-C of FT:mat_peptide GQ475333_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR29LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475334_HBe_P-C Product feature CHAIN GQ475334_HBe_P-C of FT:mat_peptide GQ475334_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR30LC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475338_HBe_P-C Product feature CHAIN GQ475338_HBe_P-C of FT:mat_peptide GQ475338_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR34LC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475339_HBe_P-C Product feature CHAIN GQ475339_HBe_P-C of FT:mat_peptide GQ475339_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR35HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475342_HBe_P-C Product feature CHAIN GQ475342_HBe_P-C of FT:mat_peptide GQ475342_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR38HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475344_HBe_P-C Product feature CHAIN GQ475344_HBe_P-C of FT:mat_peptide GQ475344_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR40HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475345_HBe_P-C Product feature CHAIN GQ475345_HBe_P-C of FT:mat_peptide GQ475345_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR41HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475346_HBe_P-C Product feature CHAIN GQ475346_HBe_P-C of FT:mat_peptide GQ475346_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR42HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475347_HBe_P-C Product feature CHAIN GQ475347_HBe_P-C of FT:mat_peptide GQ475347_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR43HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475354_HBe_P-C Product feature CHAIN GQ475354_HBe_P-C of FT:mat_peptide GQ475354_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR50HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ475355_HBe_P-C Product feature CHAIN GQ475355_HBe_P-C of FT:mat_peptide GQ475355_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR51HCC). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKARQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855523_HBe_P-C Product feature CHAIN GQ855523_HBe_P-C of FT:mat_peptide GQ855523_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 37). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855525_HBe_P-C Product feature CHAIN GQ855525_HBe_P-C of FT:mat_peptide GQ855525_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 96). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855528_HBe_P-C Product feature CHAIN GQ855528_HBe_P-C of FT:mat_peptide GQ855528_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 140). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855534_HBe_P-C Product feature CHAIN GQ855534_HBe_P-C of FT:mat_peptide GQ855534_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 266). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855541_HBe_P-C Product feature CHAIN GQ855541_HBe_P-C of FT:mat_peptide GQ855541_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 385). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQLLRFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855543_HBe_P-C Product feature CHAIN GQ855543_HBe_P-C of FT:mat_peptide GQ855543_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 416). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|GQ855544_HBe_P-C Product feature CHAIN GQ855544_HBe_P-C of FT:mat_peptide GQ855544_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 423). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ855548_HBe_P-C Product feature CHAIN GQ855548_HBe_P-C of FT:mat_peptide GQ855548_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 512). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ872210_HBe_P-C Product feature CHAIN GQ872210_HBe_P-C of FT:mat_peptide GQ872210_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKKFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ872211_HBe_P-C Product feature CHAIN GQ872211_HBe_P-C of FT:mat_peptide GQ872211_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924604_HBe_P-C Product feature CHAIN GQ924604_HBe_P-C of FT:mat_peptide GQ924604_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924609_HBe_P-C Product feature CHAIN GQ924609_HBe_P-C of FT:mat_peptide GQ924609_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRXRSQSPRRRRSQSREXQC
>gnl|hbvpro|GQ924612_HBe_P-C Product feature CHAIN GQ924612_HBe_P-C of FT:mat_peptide GQ924612_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30a). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|GQ924613_HBe_P-C Product feature CHAIN GQ924613_HBe_P-C of FT:mat_peptide GQ924613_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30b). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|GQ924614_HBe_P-C Product feature CHAIN GQ924614_HBe_P-C of FT:mat_peptide GQ924614_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M31). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924616_HBe_P-C Product feature CHAIN GQ924616_HBe_P-C of FT:mat_peptide GQ924616_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M33). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924620_HBe_C-C Product feature CHAIN GQ924620_HBe_C-C of FT:mat_peptide GQ924620_HBe_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M38). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQATLCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924629_HBe_P-C Product feature CHAIN GQ924629_HBe_P-C of FT:mat_peptide GQ924629_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M51). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSXRRRTPSSCRXRSQSXSRRRSQCRECQX
>gnl|hbvpro|GQ924633_HBe_P-C Product feature CHAIN GQ924633_HBe_P-C of FT:mat_peptide GQ924633_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M56). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924636_HBe_P-C Product feature CHAIN GQ924636_HBe_P-C of FT:mat_peptide GQ924636_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M68). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSHRRRTPSPRRRRSQSPRRRRSQCRECQC
>gnl|hbvpro|GQ924642_HBe_P-C Product feature CHAIN GQ924642_HBe_P-C of FT:mat_peptide GQ924642_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M77). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIYCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPNDFFPSMRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQIFWFHISCLMFGRETVLEYLVSFGVWIRTPIA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924649_HBe_P-C Product feature CHAIN GQ924649_HBe_P-C of FT:mat_peptide GQ924649_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M86). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924655_HBe_P-C Product feature CHAIN GQ924655_HBe_P-C of FT:mat_peptide GQ924655_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M92). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ924658_HBe_P-C Product feature CHAIN GQ924658_HBe_P-C of FT:mat_peptide GQ924658_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M95). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU434374_HBe_P-C Product feature CHAIN GU434374_HBe_P-C of FT:mat_peptide GU434374_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 214-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563561_HBe_P-C Product feature CHAIN GU563561_HBe_P-C of FT:mat_peptide GU563561_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BV-153). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU721029_HBe_P-C Product feature CHAIN GU721029_HBe_P-C of FT:mat_peptide GU721029_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CMCL107). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011465_HBe_P-C Product feature CHAIN HM011465_HBe_P-C of FT:mat_peptide HM011465_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011486_HBe_P-C Product feature CHAIN HM011486_HBe_P-C of FT:mat_peptide HM011486_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPASREXVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXX
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRXSXC
>gnl|hbvpro|HM011488_HBe_P-C Product feature CHAIN HM011488_HBe_P-C of FT:mat_peptide HM011488_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXXMDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011489_HBe_P-C Product feature CHAIN HM011489_HBe_P-C of FT:mat_peptide HM011489_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011491_HBe_P-C Product feature CHAIN HM011491_HBe_P-C of FT:mat_peptide HM011491_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRQALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011497_HBe_P-C Product feature CHAIN HM011497_HBe_P-C of FT:mat_peptide HM011497_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSSH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011502_HBe_P-C Product feature CHAIN HM011502_HBe_P-C of FT:mat_peptide HM011502_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRZSQC
>gnl|hbvpro|HM042269_HBe_P-C Product feature CHAIN HM042269_HBe_P-C of FT:mat_peptide HM042269_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 475). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLVTWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750131_HBe_P-C Product feature CHAIN HM750131_HBe_P-C of FT:mat_peptide HM750131_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-57). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750132_HBe_P-C Product feature CHAIN HM750132_HBe_P-C of FT:mat_peptide HM750132_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-165). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750134_HBe_P-C Product feature CHAIN HM750134_HBe_P-C of FT:mat_peptide HM750134_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750135_HBe_P-C Product feature CHAIN HM750135_HBe_P-C of FT:mat_peptide HM750135_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGKKTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|HM750136_HBe_P-C Product feature CHAIN HM750136_HBe_P-C of FT:mat_peptide HM750136_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSDC-53). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750137_HBe_P-C Product feature CHAIN HM750137_HBe_P-C of FT:mat_peptide HM750137_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750138_HBe_P-C Product feature CHAIN HM750138_HBe_P-C of FT:mat_peptide HM750138_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-100). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750139_HBe_P-C Product feature CHAIN HM750139_HBe_P-C of FT:mat_peptide HM750139_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750140_HBe_P-C Product feature CHAIN HM750140_HBe_P-C of FT:mat_peptide HM750140_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-56). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750141_HBe_P-C Product feature CHAIN HM750141_HBe_P-C of FT:mat_peptide HM750141_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-115). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDAASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ638218_HBe_P-C Product feature CHAIN HQ638218_HBe_P-C of FT:mat_peptide HQ638218_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate A64-1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700456_HBe_P-C Product feature CHAIN HQ700456_HBe_P-C of FT:mat_peptide HQ700456_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_HA121_1984). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700476_HBe_P-C Product feature CHAIN HQ700476_HBe_P-C of FT:mat_peptide HQ700476_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_PA58_1999). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLXDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRXPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700495_HBe_P-C Product feature CHAIN HQ700495_HBe_P-C of FT:mat_peptide HQ700495_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155PF_2004). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700496_HBe_P-C Product feature CHAIN HQ700496_HBe_P-C of FT:mat_peptide HQ700496_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155C_2004). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700502_HBe_P-C Product feature CHAIN HQ700502_HBe_P-C of FT:mat_peptide HQ700502_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Is_1991). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700504_HBe_P-C Product feature CHAIN HQ700504_HBe_P-C of FT:mat_peptide HQ700504_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Ve_1992). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700506_HBe_P-C Product feature CHAIN HQ700506_HBe_P-C of FT:mat_peptide HQ700506_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NC_TA32_2003). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700516_HBe_P-C Product feature CHAIN HQ700516_HBe_P-C of FT:mat_peptide HQ700516_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_D029_2005). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700517_HBe_P-C Product feature CHAIN HQ700517_HBe_P-C of FT:mat_peptide HQ700517_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_D058A_2005). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGXETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700522_HBe_P-C Product feature CHAIN HQ700522_HBe_P-C of FT:mat_peptide HQ700522_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_H086A_2004). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700543_HBe_P-C Product feature CHAIN HQ700543_HBe_P-C of FT:mat_peptide HQ700543_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_P124A_2005). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNXAXXXKXLXWFPISXXTFGRETVLXYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700544_HBe_P-C Product feature CHAIN HQ700544_HBe_P-C of FT:mat_peptide HQ700544_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_T003_2A). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=210 residues).
LFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHT
ALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYR
PPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700555_HBe_P-C Product feature CHAIN HQ700555_HBe_P-C of FT:mat_peptide HQ700555_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD4171_2001). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700556_HBe_P-C Product feature CHAIN HQ700556_HBe_P-C of FT:mat_peptide HQ700556_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BA4986_2002). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700558_HBe_P-C Product feature CHAIN HQ700558_HBe_P-C of FT:mat_peptide HQ700558_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5375_2001). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700559_HBe_P-C Product feature CHAIN HQ700559_HBe_P-C of FT:mat_peptide HQ700559_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5561_2001). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700561_HBe_P-C Product feature CHAIN HQ700561_HBe_P-C of FT:mat_peptide HQ700561_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BF7376_2002). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700562_HBe_P-C Product feature CHAIN HQ700562_HBe_P-C of FT:mat_peptide HQ700562_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tomga_BH5413_2002). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700563_HBe_P-C Product feature CHAIN HQ700563_HBe_P-C of FT:mat_peptide HQ700563_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BL9389_2002). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700564_HBe_P-C Product feature CHAIN HQ700564_HBe_P-C of FT:mat_peptide HQ700564_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BQ3589_2001). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700565_HBe_P-C Product feature CHAIN HQ700565_HBe_P-C of FT:mat_peptide HQ700565_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BR6895_2001). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700566_HBe_P-C Product feature CHAIN HQ700566_HBe_P-C of FT:mat_peptide HQ700566_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_JN1142_2004). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700567_HBe_P-C Product feature CHAIN HQ700567_HBe_P-C of FT:mat_peptide HQ700567_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To268_2006). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700568_HBe_P-C Product feature CHAIN HQ700568_HBe_P-C of FT:mat_peptide HQ700568_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To281_2006). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700569_HBe_P-C Product feature CHAIN HQ700569_HBe_P-C of FT:mat_peptide HQ700569_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To347_2006). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700570_HBe_P-C Product feature CHAIN HQ700570_HBe_P-C of FT:mat_peptide HQ700570_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To356_2006). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|HQ700571_HBe_P-C Product feature CHAIN HQ700571_HBe_P-C of FT:mat_peptide HQ700571_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To391_2006). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700572_HBe_P-C Product feature CHAIN HQ700572_HBe_P-C of FT:mat_peptide HQ700572_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To422_2007). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700573_HBe_P-C Product feature CHAIN HQ700573_HBe_P-C of FT:mat_peptide HQ700573_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To426_2007). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700574_HBe_P-C Product feature CHAIN HQ700574_HBe_P-C of FT:mat_peptide HQ700574_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To400_2006). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700575_HBe_P-C Product feature CHAIN HQ700575_HBe_P-C of FT:mat_peptide HQ700575_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To244_2006). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGGNLEDPASRELVVNYVNINMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700577_HBe_P-C Product feature CHAIN HQ700577_HBe_P-C of FT:mat_peptide HQ700577_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To293_2006). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLXDPASREXVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF436920_HBe_P-C Product feature CHAIN JF436920_HBe_P-C of FT:mat_peptide JF436920_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SZ6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828905_HBe_P-C Product feature CHAIN JF828905_HBe_P-C of FT:mat_peptide JF828905_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-1). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSLRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828906_HBe_P-C Product feature CHAIN JF828906_HBe_P-C of FT:mat_peptide JF828906_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-2). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828907_HBe_P-C Product feature CHAIN JF828907_HBe_P-C of FT:mat_peptide JF828907_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-3). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828908_HBe_P-C Product feature CHAIN JF828908_HBe_P-C of FT:mat_peptide JF828908_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-4). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828910_HBe_P-C Product feature CHAIN JF828910_HBe_P-C of FT:mat_peptide JF828910_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-8). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGGLMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828911_HBe_P-C Product feature CHAIN JF828911_HBe_P-C of FT:mat_peptide JF828911_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-9). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828912_HBe_P-C Product feature CHAIN JF828912_HBe_P-C of FT:mat_peptide JF828912_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-11). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828913_HBe_P-C Product feature CHAIN JF828913_HBe_P-C of FT:mat_peptide JF828913_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828915_HBe_P-C Product feature CHAIN JF828915_HBe_P-C of FT:mat_peptide JF828915_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828916_HBe_P-C Product feature CHAIN JF828916_HBe_P-C of FT:mat_peptide JF828916_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828917_HBe_P-C Product feature CHAIN JF828917_HBe_P-C of FT:mat_peptide JF828917_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828918_HBe_P-C Product feature CHAIN JF828918_HBe_P-C of FT:mat_peptide JF828918_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828919_HBe_P-C Product feature CHAIN JF828919_HBe_P-C of FT:mat_peptide JF828919_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828920_HBe_P-C Product feature CHAIN JF828920_HBe_P-C of FT:mat_peptide JF828920_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-14). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828921_HBe_P-C Product feature CHAIN JF828921_HBe_P-C of FT:mat_peptide JF828921_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828922_HBe_P-C Product feature CHAIN JF828922_HBe_P-C of FT:mat_peptide JF828922_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828923_HBe_P-C Product feature CHAIN JF828923_HBe_P-C of FT:mat_peptide JF828923_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828924_HBe_P-C Product feature CHAIN JF828924_HBe_P-C of FT:mat_peptide JF828924_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828925_HBe_P-C Product feature CHAIN JF828925_HBe_P-C of FT:mat_peptide JF828925_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828926_HBe_P-C Product feature CHAIN JF828926_HBe_P-C of FT:mat_peptide JF828926_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828928_HBe_P-C Product feature CHAIN JF828928_HBe_P-C of FT:mat_peptide JF828928_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828929_HBe_P-C Product feature CHAIN JF828929_HBe_P-C of FT:mat_peptide JF828929_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828930_HBe_P-C Product feature CHAIN JF828930_HBe_P-C of FT:mat_peptide JF828930_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828931_HBe_P-C Product feature CHAIN JF828931_HBe_P-C of FT:mat_peptide JF828931_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-15). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF828937_HBe_P-C Product feature CHAIN JF828937_HBe_P-C of FT:mat_peptide JF828937_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES72-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWAGSNLEGPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JF899336_HBe_P-C Product feature CHAIN JF899336_HBe_P-C of FT:mat_peptide JF899336_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10B3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN104433_HBe_P-C Product feature CHAIN JN104433_HBe_P-C of FT:mat_peptide JN104433_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN104434_HBe_P-C Product feature CHAIN JN104434_HBe_P-C of FT:mat_peptide JN104434_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPCRRRSQSRESQC
>gnl|hbvpro|JN104435_HBe_P-C Product feature CHAIN JN104435_HBe_P-C of FT:mat_peptide JN104435_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN104437_HBe_P-C Product feature CHAIN JN104437_HBe_P-C of FT:mat_peptide JN104437_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYANVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN104440_HBe_P-C Product feature CHAIN JN104440_HBe_P-C of FT:mat_peptide JN104440_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN315779_HBe_P-C Product feature CHAIN JN315779_HBe_P-C of FT:mat_peptide JN315779_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELLNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN400087_HBe_P-C Product feature CHAIN JN400087_HBe_P-C of FT:mat_peptide JN400087_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-75-Mother). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSWESQC
>gnl|hbvpro|JN400088_HBe_P-C Product feature CHAIN JN400088_HBe_P-C of FT:mat_peptide JN400088_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Baby). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDRLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN400089_HBe_P-C Product feature CHAIN JN400089_HBe_P-C of FT:mat_peptide JN400089_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Mother). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSWESQC
>gnl|hbvpro|JN827414_HBe_P-C Product feature CHAIN JN827414_HBe_P-C of FT:mat_peptide JN827414_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0015). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827415_HBe_P-C Product feature CHAIN JN827415_HBe_P-C of FT:mat_peptide JN827415_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0032). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827416_HBe_P-C Product feature CHAIN JN827416_HBe_P-C of FT:mat_peptide JN827416_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0294). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827417_HBe_P-C Product feature CHAIN JN827417_HBe_P-C of FT:mat_peptide JN827417_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0300). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827418_HBe_P-C Product feature CHAIN JN827418_HBe_P-C of FT:mat_peptide JN827418_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0904). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827420_HBe_P-C Product feature CHAIN JN827420_HBe_P-C of FT:mat_peptide JN827420_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4681). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827421_HBe_P-C Product feature CHAIN JN827421_HBe_P-C of FT:mat_peptide JN827421_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5205). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827422_HBe_P-C Product feature CHAIN JN827422_HBe_P-C of FT:mat_peptide JN827422_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5494). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827423_HBe_P-C Product feature CHAIN JN827423_HBe_P-C of FT:mat_peptide JN827423_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6359). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827424_HBe_P-C Product feature CHAIN JN827424_HBe_P-C of FT:mat_peptide JN827424_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2566). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN827425_HBe_P-C Product feature CHAIN JN827425_HBe_P-C of FT:mat_peptide JN827425_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3765). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027317_HBe_P-C Product feature CHAIN JQ027317_HBe_P-C of FT:mat_peptide JQ027317_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGXNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027318_HBe_P-C Product feature CHAIN JQ027318_HBe_P-C of FT:mat_peptide JQ027318_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ027319_HBe_P-C Product feature CHAIN JQ027319_HBe_P-C of FT:mat_peptide JQ027319_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ027320_HBe_P-C Product feature CHAIN JQ027320_HBe_P-C of FT:mat_peptide JQ027320_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ027321_HBe_P-C Product feature CHAIN JQ027321_HBe_P-C of FT:mat_peptide JQ027321_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027322_HBe_P-C Product feature CHAIN JQ027322_HBe_P-C of FT:mat_peptide JQ027322_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|JQ027323_HBe_P-C Product feature CHAIN JQ027323_HBe_P-C of FT:mat_peptide JQ027323_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLDDPASRELIVSYVNVNMGLKXRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ027324_HBe_P-C Product feature CHAIN JQ027324_HBe_P-C of FT:mat_peptide JQ027324_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRZTVLEYLVSFGVWMRTPPA
YRPQNAPILSTLPETXVVRPRGRXPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|JQ027333_HBe_P-C Product feature CHAIN JQ027333_HBe_P-C of FT:mat_peptide JQ027333_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040127_HBe_P-C Product feature CHAIN JQ040127_HBe_P-C of FT:mat_peptide JQ040127_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=213 residues).
MQLFXLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLSFLPXDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQFG
>gnl|hbvpro|JQ040132_HBe_P-C Product feature CHAIN JQ040132_HBe_P-C of FT:mat_peptide JQ040132_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 144). Complete genome. [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLIDTASALYXEALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGXXTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQCQ
>gnl|hbvpro|JQ040133_HBe_P-C Product feature CHAIN JQ040133_HBe_P-C of FT:mat_peptide JQ040133_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 160). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040143_HBe_P-C Product feature CHAIN JQ040143_HBe_P-C of FT:mat_peptide JQ040143_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 264). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPH
HTALRQAFVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|JQ040145_HBe_P-C Product feature CHAIN JQ040145_HBe_P-C of FT:mat_peptide JQ040145_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 277). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPIXSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040149_HBe_P-C Product feature CHAIN JQ040149_HBe_P-C of FT:mat_peptide JQ040149_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G76). Complete genome. [Hepadnaviridae] (length=212 residues).
MQFFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELXVXYVNVNMGLKIRQLLWFXISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ040151_HBe_P-C Product feature CHAIN JQ040151_HBe_P-C of FT:mat_peptide JQ040151_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G79). Complete genome. [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040152_HBe_P-C Product feature CHAIN JQ040152_HBe_P-C of FT:mat_peptide JQ040152_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G172). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPH
HTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRXRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040154_HBe_P-C Product feature CHAIN JQ040154_HBe_P-C of FT:mat_peptide JQ040154_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G181). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040156_HBe_P-C Product feature CHAIN JQ040156_HBe_P-C of FT:mat_peptide JQ040156_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G186). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGXDIDPXKEFGASSELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040162_HBe_P-C Product feature CHAIN JQ040162_HBe_P-C of FT:mat_peptide JQ040162_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G216). Complete genome. [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040163_HBe_P-C Product feature CHAIN JQ040163_HBe_P-C of FT:mat_peptide JQ040163_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G217). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040164_HBe_P-C Product feature CHAIN JQ040164_HBe_P-C of FT:mat_peptide JQ040164_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G221). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASXELLSFLPSDFFPAIRDLXDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JQ040165_HBe_P-C Product feature CHAIN JQ040165_HBe_P-C of FT:mat_peptide JQ040165_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G222). Complete genome. [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLXSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040167_HBe_P-C Product feature CHAIN JQ040167_HBe_P-C of FT:mat_peptide JQ040167_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G225). Complete genome. [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPLDFFPSIRDLLDTASALXREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040168_HBe_P-C Product feature CHAIN JQ040168_HBe_P-C of FT:mat_peptide JQ040168_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G233). Complete genome. [Hepadnaviridae] (length=212 residues).
MQXFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ040172_HBe_P-C Product feature CHAIN JQ040172_HBe_P-C of FT:mat_peptide JQ040172_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G243). Complete genome. [Hepadnaviridae] (length=212 residues).
MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341517_HBe_P-C Product feature CHAIN JQ341517_HBe_P-C of FT:mat_peptide JQ341517_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFXASVELLSFLPSDFFPNVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPTSREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341518_HBe_P-C Product feature CHAIN JQ341518_HBe_P-C of FT:mat_peptide JQ341518_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIXCWGELMNLATWVGXNLEDXXSRXLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341541_HBe_P-C Product feature CHAIN JQ341541_HBe_P-C of FT:mat_peptide JQ341541_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno50). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALXREALESPEHCSPH
HTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPXXAPILSTLPETTVVRRRXRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ341544_HBe_P-C Product feature CHAIN JQ341544_HBe_P-C of FT:mat_peptide JQ341544_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno54). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALXSPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPXAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ429078_HBe_P-C Product feature CHAIN JQ429078_HBe_P-C of FT:mat_peptide JQ429078_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08.40.117). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLPFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQVILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRCRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ688403_HBe_P-C Product feature CHAIN JQ688403_HBe_P-C of FT:mat_peptide JQ688403_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ688404_HBe_P-C Product feature CHAIN JQ688404_HBe_P-C of FT:mat_peptide JQ688404_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707707_HBe_P-C Product feature CHAIN JQ707707_HBe_P-C of FT:mat_peptide JQ707707_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_10). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707708_HBe_P-C Product feature CHAIN JQ707708_HBe_P-C of FT:mat_peptide JQ707708_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_12). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707709_HBe_P-C Product feature CHAIN JQ707709_HBe_P-C of FT:mat_peptide JQ707709_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_13). Partial genome (Contains: HBe, HBc, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707710_HBe_P-C Product feature CHAIN JQ707710_HBe_P-C of FT:mat_peptide JQ707710_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707711_HBe_P-C Product feature CHAIN JQ707711_HBe_P-C of FT:mat_peptide JQ707711_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_15). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707712_HBe_P-C Product feature CHAIN JQ707712_HBe_P-C of FT:mat_peptide JQ707712_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_16). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707713_HBe_P-C Product feature CHAIN JQ707713_HBe_P-C of FT:mat_peptide JQ707713_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_19-5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707715_HBe_P-C Product feature CHAIN JQ707715_HBe_P-C of FT:mat_peptide JQ707715_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_22). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707716_HBe_P-C Product feature CHAIN JQ707716_HBe_P-C of FT:mat_peptide JQ707716_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_23). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707717_HBe_P-C Product feature CHAIN JQ707717_HBe_P-C of FT:mat_peptide JQ707717_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_25). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707718_HBe_P-C Product feature CHAIN JQ707718_HBe_P-C of FT:mat_peptide JQ707718_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_28). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707719_HBe_P-C Product feature CHAIN JQ707719_HBe_P-C of FT:mat_peptide JQ707719_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_29). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707720_HBe_P-C Product feature CHAIN JQ707720_HBe_P-C of FT:mat_peptide JQ707720_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_32-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707721_HBe_P-C Product feature CHAIN JQ707721_HBe_P-C of FT:mat_peptide JQ707721_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_33). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707722_HBe_P-C Product feature CHAIN JQ707722_HBe_P-C of FT:mat_peptide JQ707722_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_34). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707723_HBe_P-C Product feature CHAIN JQ707723_HBe_P-C of FT:mat_peptide JQ707723_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_35). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707724_HBe_P-C Product feature CHAIN JQ707724_HBe_P-C of FT:mat_peptide JQ707724_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_38). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707725_HBe_P-C Product feature CHAIN JQ707725_HBe_P-C of FT:mat_peptide JQ707725_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_39). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707726_HBe_P-C Product feature CHAIN JQ707726_HBe_P-C of FT:mat_peptide JQ707726_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_4). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707727_HBe_P-C Product feature CHAIN JQ707727_HBe_P-C of FT:mat_peptide JQ707727_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_40). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707728_HBe_P-C Product feature CHAIN JQ707728_HBe_P-C of FT:mat_peptide JQ707728_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_41). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707729_HBe_P-C Product feature CHAIN JQ707729_HBe_P-C of FT:mat_peptide JQ707729_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_42). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707730_HBe_P-C Product feature CHAIN JQ707730_HBe_P-C of FT:mat_peptide JQ707730_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_47). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707731_HBe_P-C Product feature CHAIN JQ707731_HBe_P-C of FT:mat_peptide JQ707731_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707732_HBe_P-C Product feature CHAIN JQ707732_HBe_P-C of FT:mat_peptide JQ707732_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707733_HBe_P-C Product feature CHAIN JQ707733_HBe_P-C of FT:mat_peptide JQ707733_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_8). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707768_HBe_P-C Product feature CHAIN JQ707768_HBe_P-C of FT:mat_peptide JQ707768_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_10A-6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETCVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707769_HBe_P-C Product feature CHAIN JQ707769_HBe_P-C of FT:mat_peptide JQ707769_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_13A). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETCVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707770_HBe_P-C Product feature CHAIN JQ707770_HBe_P-C of FT:mat_peptide JQ707770_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_14B). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETCVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707771_HBe_P-C Product feature CHAIN JQ707771_HBe_P-C of FT:mat_peptide JQ707771_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_20B). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETCVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707772_HBe_P-C Product feature CHAIN JQ707772_HBe_P-C of FT:mat_peptide JQ707772_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_26A). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETCVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707773_HBe_P-C Product feature CHAIN JQ707773_HBe_P-C of FT:mat_peptide JQ707773_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_27A). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETCVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707774_HBe_P-C Product feature CHAIN JQ707774_HBe_P-C of FT:mat_peptide JQ707774_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_C4). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETCVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801470_HBe_P-C Product feature CHAIN JQ801470_HBe_P-C of FT:mat_peptide JQ801470_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801472_HBe_P-C Product feature CHAIN JQ801472_HBe_P-C of FT:mat_peptide JQ801472_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPVNAPILSTLPETTVVRPRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801473_HBe_P-C Product feature CHAIN JQ801473_HBe_P-C of FT:mat_peptide JQ801473_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFVVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801475_HBe_P-C Product feature CHAIN JQ801475_HBe_P-C of FT:mat_peptide JQ801475_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801481_HBe_P-C Product feature CHAIN JQ801481_HBe_P-C of FT:mat_peptide JQ801481_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS26). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801482_HBe_P-C Product feature CHAIN JQ801482_HBe_P-C of FT:mat_peptide JQ801482_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS27). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801483_HBe_P-C Product feature CHAIN JQ801483_HBe_P-C of FT:mat_peptide JQ801483_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS28). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801486_HBe_P-C Product feature CHAIN JQ801486_HBe_P-C of FT:mat_peptide JQ801486_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS33). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801487_HBe_P-C Product feature CHAIN JQ801487_HBe_P-C of FT:mat_peptide JQ801487_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS34). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801488_HBe_P-C Product feature CHAIN JQ801488_HBe_P-C of FT:mat_peptide JQ801488_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS35). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801489_HBe_P-C Product feature CHAIN JQ801489_HBe_P-C of FT:mat_peptide JQ801489_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS36). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGESMNLATWVGSNLEDPASRELVVSYVNVNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPQTTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801490_HBe_P-C Product feature CHAIN JQ801490_HBe_P-C of FT:mat_peptide JQ801490_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS37). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ801495_HBe_P-C Product feature CHAIN JQ801495_HBe_P-C of FT:mat_peptide JQ801495_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPGSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801496_HBe_P-C Product feature CHAIN JQ801496_HBe_P-C of FT:mat_peptide JQ801496_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801497_HBe_P-C Product feature CHAIN JQ801497_HBe_P-C of FT:mat_peptide JQ801497_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801500_HBe_P-C Product feature CHAIN JQ801500_HBe_P-C of FT:mat_peptide JQ801500_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRESVVSYVNVNMGIKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801501_HBe_P-C Product feature CHAIN JQ801501_HBe_P-C of FT:mat_peptide JQ801501_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801502_HBe_P-C Product feature CHAIN JQ801502_HBe_P-C of FT:mat_peptide JQ801502_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801504_HBe_P-C Product feature CHAIN JQ801504_HBe_P-C of FT:mat_peptide JQ801504_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801505_HBe_P-C Product feature CHAIN JQ801505_HBe_P-C of FT:mat_peptide JQ801505_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801509_HBe_P-C Product feature CHAIN JQ801509_HBe_P-C of FT:mat_peptide JQ801509_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL17). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801511_HBe_P-C Product feature CHAIN JQ801511_HBe_P-C of FT:mat_peptide JQ801511_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801513_HBe_P-C Product feature CHAIN JQ801513_HBe_P-C of FT:mat_peptide JQ801513_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL21). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801517_HBe_P-C Product feature CHAIN JQ801517_HBe_P-C of FT:mat_peptide JQ801517_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL25). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPDDFFPSVRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGIKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLP
YRPPNAPILSTLPETTVVRQRRRSLRRRTPSPRRRRSQSPRRGRSPSRGSQC
>gnl|hbvpro|JQ801519_HBe_P-C Product feature CHAIN JQ801519_HBe_P-C of FT:mat_peptide JQ801519_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL27). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801520_HBe_P-C Product feature CHAIN JQ801520_HBe_P-C of FT:mat_peptide JQ801520_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL28). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRKTPSPPTRRSQSPPRRRSQSRESQC
>gnl|hbvpro|JQ801522_HBe_P-C Product feature CHAIN JQ801522_HBe_P-C of FT:mat_peptide JQ801522_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL30). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSRRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ801523_HBe_P-C Product feature CHAIN JQ801523_HBe_P-C of FT:mat_peptide JQ801523_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL31). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSLLDPLYTASALYREALKSPEHCSPH
HTALRQAILCWGELMNLAAWVGSNLEDPASRELLVSYVNVNTGLKIRQLLWFHITCLTLGRETVLEELVPFARWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPTPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026877_HBe_P-C Product feature CHAIN JX026877_HBe_P-C of FT:mat_peptide JX026877_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPGHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026885_HBe_P-C Product feature CHAIN JX026885_HBe_P-C of FT:mat_peptide JX026885_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-64). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX026888_HBe_P-C Product feature CHAIN JX026888_HBe_P-C of FT:mat_peptide JX026888_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRLPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX036335_HBe_P-C Product feature CHAIN JX036335_HBe_P-C of FT:mat_peptide JX036335_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-71_C2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=209 residues).
FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTA
LRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRP
PNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX036336_HBe_P-C Product feature CHAIN JX036336_HBe_P-C of FT:mat_peptide JX036336_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-23_C2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=209 residues).
FHLCLIISCSCPTVQASKLRLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTA
LRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRP
PNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX036337_HBe_P-C Product feature CHAIN JX036337_HBe_P-C of FT:mat_peptide JX036337_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-75_C2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=209 residues).
FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTA
LRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRP
PNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX036338_HBe_P-C Product feature CHAIN JX036338_HBe_P-C of FT:mat_peptide JX036338_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-29_CD1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=209 residues).
FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTA
LRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRP
PNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX036339_HBe_P-C Product feature CHAIN JX036339_HBe_P-C of FT:mat_peptide JX036339_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-77_CD). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=209 residues).
FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTA
LRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRP
LNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX429903_HBe_P-C Product feature CHAIN JX429903_HBe_P-C of FT:mat_peptide JX429903_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-42). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429904_HBe_P-C Product feature CHAIN JX429904_HBe_P-C of FT:mat_peptide JX429904_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-46). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429905_HBe_P-C Product feature CHAIN JX429905_HBe_P-C of FT:mat_peptide JX429905_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-47). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALASPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429906_HBe_P-C Product feature CHAIN JX429906_HBe_P-C of FT:mat_peptide JX429906_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-48). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429907_HBe_P-C Product feature CHAIN JX429907_HBe_P-C of FT:mat_peptide JX429907_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-50). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429909_HBe_P-C Product feature CHAIN JX429909_HBe_P-C of FT:mat_peptide JX429909_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-59). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429912_HBe_P-C Product feature CHAIN JX429912_HBe_P-C of FT:mat_peptide JX429912_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429913_HBe_P-C Product feature CHAIN JX429913_HBe_P-C of FT:mat_peptide JX429913_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429915_HBe_P-C Product feature CHAIN JX429915_HBe_P-C of FT:mat_peptide JX429915_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429916_HBe_P-C Product feature CHAIN JX429916_HBe_P-C of FT:mat_peptide JX429916_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-35). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429917_HBe_P-C Product feature CHAIN JX429917_HBe_P-C of FT:mat_peptide JX429917_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-36). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX429918_HBe_P-C Product feature CHAIN JX429918_HBe_P-C of FT:mat_peptide JX429918_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-44). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYEEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504536_HBe_P-C Product feature CHAIN JX504536_HBe_P-C of FT:mat_peptide JX504536_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-44). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVARRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504537_HBe_P-C Product feature CHAIN JX504537_HBe_P-C of FT:mat_peptide JX504537_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-49). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504539_HBe_P-C Product feature CHAIN JX504539_HBe_P-C of FT:mat_peptide JX504539_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLRDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504541_HBe_P-C Product feature CHAIN JX504541_HBe_P-C of FT:mat_peptide JX504541_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504542_HBe_P-C Product feature CHAIN JX504542_HBe_P-C of FT:mat_peptide JX504542_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504544_HBe_P-C Product feature CHAIN JX504544_HBe_P-C of FT:mat_peptide JX504544_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504545_HBe_P-C Product feature CHAIN JX504545_HBe_P-C of FT:mat_peptide JX504545_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-37). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX504546_HBe_P-C Product feature CHAIN JX504546_HBe_P-C of FT:mat_peptide JX504546_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-40). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507211_HBe_P-C Product feature CHAIN JX507211_HBe_P-C of FT:mat_peptide JX507211_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30). Complete genome. [Hepadnaviridae] (length=212 residues).
ALLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASREAVVNYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPLNAPILSTLPETTVVRQRGRSTRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507212_HBe_P-C Product feature CHAIN JX507212_HBe_P-C of FT:mat_peptide JX507212_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQAYKLCLGWLWGMDIDPYKEFGASAQLLSFLPSDFFPSIRDLLDTAAALYREALESPEQCSPH
HTALRQAILCWGELMNLATWVGSNLEDPTSREAVVGYVNVNMGLKLRQXLWFHISCLTFGRHTVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRQRXRSPRRRTSPPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX507214_HBe_P-C Product feature CHAIN JX507214_HBe_P-C of FT:mat_peptide JX507214_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 99). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTTLRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX560519_HBe_P-C Product feature CHAIN JX560519_HBe_P-C of FT:mat_peptide JX560519_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH76). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX560520_HBe_P-C Product feature CHAIN JX560520_HBe_P-C of FT:mat_peptide JX560520_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH139). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661488_HBe_P-C Product feature CHAIN JX661488_HBe_P-C of FT:mat_peptide JX661488_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1212-C5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JX661489_HBe_P-C Product feature CHAIN JX661489_HBe_P-C of FT:mat_peptide JX661489_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1218-C9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661490_HBe_P-C Product feature CHAIN JX661490_HBe_P-C of FT:mat_peptide JX661490_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1217-C8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCTRVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661491_HBe_P-C Product feature CHAIN JX661491_HBe_P-C of FT:mat_peptide JX661491_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1222-C10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661492_HBe_P-C Product feature CHAIN JX661492_HBe_P-C of FT:mat_peptide JX661492_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1215-C7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661493_HBe_P-C Product feature CHAIN JX661493_HBe_P-C of FT:mat_peptide JX661493_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1226-C13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661495_HBe_P-C Product feature CHAIN JX661495_HBe_P-C of FT:mat_peptide JX661495_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1223-C11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661496_HBe_P-C Product feature CHAIN JX661496_HBe_P-C of FT:mat_peptide JX661496_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1208-C4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX661497_HBe_P-C Product feature CHAIN JX661497_HBe_P-C of FT:mat_peptide JX661497_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1228-C14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAFLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JX870000_HBe_P-C Product feature CHAIN JX870000_HBe_P-C of FT:mat_peptide JX870000_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 245). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSLH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVIRRRGRSPRRRXPXPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774179_HBe_P-C Product feature CHAIN KC774179_HBe_P-C of FT:mat_peptide KC774179_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SX11xa1580). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774180_HBe_P-C Product feature CHAIN KC774180_HBe_P-C of FT:mat_peptide KC774180_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1002). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774181_HBe_P-C Product feature CHAIN KC774181_HBe_P-C of FT:mat_peptide KC774181_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1012). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774182_HBe_P-C Product feature CHAIN KC774182_HBe_P-C of FT:mat_peptide KC774182_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1013). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774184_HBe_P-C Product feature CHAIN KC774184_HBe_P-C of FT:mat_peptide KC774184_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1022). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774185_HBe_P-C Product feature CHAIN KC774185_HBe_P-C of FT:mat_peptide KC774185_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1023). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774187_HBe_P-C Product feature CHAIN KC774187_HBe_P-C of FT:mat_peptide KC774187_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1027). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774196_HBe_P-C Product feature CHAIN KC774196_HBe_P-C of FT:mat_peptide KC774196_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2015). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774206_HBe_P-C Product feature CHAIN KC774206_HBe_P-C of FT:mat_peptide KC774206_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2079). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774213_HBe_P-C Product feature CHAIN KC774213_HBe_P-C of FT:mat_peptide KC774213_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2123). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774214_HBe_P-C Product feature CHAIN KC774214_HBe_P-C of FT:mat_peptide KC774214_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2124). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774215_HBe_P-C Product feature CHAIN KC774215_HBe_P-C of FT:mat_peptide KC774215_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2125). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774216_HBe_P-C Product feature CHAIN KC774216_HBe_P-C of FT:mat_peptide KC774216_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2126). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774233_HBe_P-C Product feature CHAIN KC774233_HBe_P-C of FT:mat_peptide KC774233_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1035). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774235_HBe_P-C Product feature CHAIN KC774235_HBe_P-C of FT:mat_peptide KC774235_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1041). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774236_HBe_P-C Product feature CHAIN KC774236_HBe_P-C of FT:mat_peptide KC774236_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1042). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774237_HBe_P-C Product feature CHAIN KC774237_HBe_P-C of FT:mat_peptide KC774237_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1051). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774238_HBe_P-C Product feature CHAIN KC774238_HBe_P-C of FT:mat_peptide KC774238_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1052). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774239_HBe_P-C Product feature CHAIN KC774239_HBe_P-C of FT:mat_peptide KC774239_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1063). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774240_HBe_P-C Product feature CHAIN KC774240_HBe_P-C of FT:mat_peptide KC774240_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1066). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIFSYVNVNMGLKIKQLLGFHISCLTFGKKTVLEYLGSFGVGIPTPPA
YKPPNAPILSTLPETTVVKRQGRSPEKKTPSPQKQRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774241_HBe_P-C Product feature CHAIN KC774241_HBe_P-C of FT:mat_peptide KC774241_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1067). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774242_HBe_P-C Product feature CHAIN KC774242_HBe_P-C of FT:mat_peptide KC774242_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1070). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774244_HBe_P-C Product feature CHAIN KC774244_HBe_P-C of FT:mat_peptide KC774244_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1012). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774250_HBe_P-C Product feature CHAIN KC774250_HBe_P-C of FT:mat_peptide KC774250_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1029). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774251_HBe_P-C Product feature CHAIN KC774251_HBe_P-C of FT:mat_peptide KC774251_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1030). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774252_HBe_P-C Product feature CHAIN KC774252_HBe_P-C of FT:mat_peptide KC774252_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1031). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|KC774253_HBe_P-C Product feature CHAIN KC774253_HBe_P-C of FT:mat_peptide KC774253_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1039). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELSNLATWVGSNLEDPASRELVVRYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774254_HBe_P-C Product feature CHAIN KC774254_HBe_P-C of FT:mat_peptide KC774254_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1046). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774255_HBe_P-C Product feature CHAIN KC774255_HBe_P-C of FT:mat_peptide KC774255_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1050). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774260_HBe_P-C Product feature CHAIN KC774260_HBe_P-C of FT:mat_peptide KC774260_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1065). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774261_HBe_P-C Product feature CHAIN KC774261_HBe_P-C of FT:mat_peptide KC774261_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1067). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774267_HBe_P-C Product feature CHAIN KC774267_HBe_P-C of FT:mat_peptide KC774267_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1084). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774268_HBe_P-C Product feature CHAIN KC774268_HBe_P-C of FT:mat_peptide KC774268_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1085). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774269_HBe_P-C Product feature CHAIN KC774269_HBe_P-C of FT:mat_peptide KC774269_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1086). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774270_HBe_P-C Product feature CHAIN KC774270_HBe_P-C of FT:mat_peptide KC774270_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1093). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774271_HBe_P-C Product feature CHAIN KC774271_HBe_P-C of FT:mat_peptide KC774271_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1094). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774272_HBe_P-C Product feature CHAIN KC774272_HBe_P-C of FT:mat_peptide KC774272_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1107). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774274_HBe_P-C Product feature CHAIN KC774274_HBe_P-C of FT:mat_peptide KC774274_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1124). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774276_HBe_P-C Product feature CHAIN KC774276_HBe_P-C of FT:mat_peptide KC774276_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1128). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774277_HBe_P-C Product feature CHAIN KC774277_HBe_P-C of FT:mat_peptide KC774277_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2151). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774278_HBe_P-C Product feature CHAIN KC774278_HBe_P-C of FT:mat_peptide KC774278_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2155). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774279_HBe_P-C Product feature CHAIN KC774279_HBe_P-C of FT:mat_peptide KC774279_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2157). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774280_HBe_P-C Product feature CHAIN KC774280_HBe_P-C of FT:mat_peptide KC774280_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1053). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774281_HBe_P-C Product feature CHAIN KC774281_HBe_P-C of FT:mat_peptide KC774281_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1058). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774282_HBe_P-C Product feature CHAIN KC774282_HBe_P-C of FT:mat_peptide KC774282_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1060). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774283_HBe_P-C Product feature CHAIN KC774283_HBe_P-C of FT:mat_peptide KC774283_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1062). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774284_HBe_P-C Product feature CHAIN KC774284_HBe_P-C of FT:mat_peptide KC774284_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1065). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KC774285_HBe_P-C Product feature CHAIN KC774285_HBe_P-C of FT:mat_peptide KC774285_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1067). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774286_HBe_P-C Product feature CHAIN KC774286_HBe_P-C of FT:mat_peptide KC774286_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1076). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774287_HBe_P-C Product feature CHAIN KC774287_HBe_P-C of FT:mat_peptide KC774287_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1087). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774288_HBe_P-C Product feature CHAIN KC774288_HBe_P-C of FT:mat_peptide KC774288_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1175). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLKPLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRTRSQSRESQC
>gnl|hbvpro|KC774289_HBe_P-C Product feature CHAIN KC774289_HBe_P-C of FT:mat_peptide KC774289_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1180). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774290_HBe_P-C Product feature CHAIN KC774290_HBe_P-C of FT:mat_peptide KC774290_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1183). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774292_HBe_P-C Product feature CHAIN KC774292_HBe_P-C of FT:mat_peptide KC774292_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1196). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774293_HBe_P-C Product feature CHAIN KC774293_HBe_P-C of FT:mat_peptide KC774293_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1204). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774295_HBe_P-C Product feature CHAIN KC774295_HBe_P-C of FT:mat_peptide KC774295_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1207). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774296_HBe_P-C Product feature CHAIN KC774296_HBe_P-C of FT:mat_peptide KC774296_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1210). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQG
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774297_HBe_P-C Product feature CHAIN KC774297_HBe_P-C of FT:mat_peptide KC774297_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1580). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774298_HBe_P-C Product feature CHAIN KC774298_HBe_P-C of FT:mat_peptide KC774298_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1586). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774299_HBe_P-C Product feature CHAIN KC774299_HBe_P-C of FT:mat_peptide KC774299_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1601). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774300_HBe_P-C Product feature CHAIN KC774300_HBe_P-C of FT:mat_peptide KC774300_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1602). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQTRESQC
>gnl|hbvpro|KC774301_HBe_P-C Product feature CHAIN KC774301_HBe_P-C of FT:mat_peptide KC774301_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1627). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774302_HBe_P-C Product feature CHAIN KC774302_HBe_P-C of FT:mat_peptide KC774302_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1650). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC774303_HBe_P-C Product feature CHAIN KC774303_HBe_P-C of FT:mat_peptide KC774303_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1659). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774304_HBe_P-C Product feature CHAIN KC774304_HBe_P-C of FT:mat_peptide KC774304_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1662). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774306_HBe_P-C Product feature CHAIN KC774306_HBe_P-C of FT:mat_peptide KC774306_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2006). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774308_HBe_P-C Product feature CHAIN KC774308_HBe_P-C of FT:mat_peptide KC774308_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2019). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774309_HBe_P-C Product feature CHAIN KC774309_HBe_P-C of FT:mat_peptide KC774309_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2020). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774310_HBe_P-C Product feature CHAIN KC774310_HBe_P-C of FT:mat_peptide KC774310_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2022). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774311_HBe_P-C Product feature CHAIN KC774311_HBe_P-C of FT:mat_peptide KC774311_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2026). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774312_HBe_P-C Product feature CHAIN KC774312_HBe_P-C of FT:mat_peptide KC774312_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2029). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774313_HBe_P-C Product feature CHAIN KC774313_HBe_P-C of FT:mat_peptide KC774313_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2032). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRKTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774314_HBe_P-C Product feature CHAIN KC774314_HBe_P-C of FT:mat_peptide KC774314_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2033). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC774315_HBe_P-C Product feature CHAIN KC774315_HBe_P-C of FT:mat_peptide KC774315_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2039). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774316_HBe_P-C Product feature CHAIN KC774316_HBe_P-C of FT:mat_peptide KC774316_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2041). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774318_HBe_P-C Product feature CHAIN KC774318_HBe_P-C of FT:mat_peptide KC774318_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2043). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774319_HBe_P-C Product feature CHAIN KC774319_HBe_P-C of FT:mat_peptide KC774319_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2044). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETAVVRQRRRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774320_HBe_P-C Product feature CHAIN KC774320_HBe_P-C of FT:mat_peptide KC774320_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2051). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774321_HBe_P-C Product feature CHAIN KC774321_HBe_P-C of FT:mat_peptide KC774321_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2052). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KC774325_HBe_P-C Product feature CHAIN KC774325_HBe_P-C of FT:mat_peptide KC774325_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2063). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774326_HBe_P-C Product feature CHAIN KC774326_HBe_P-C of FT:mat_peptide KC774326_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2067). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774327_HBe_P-C Product feature CHAIN KC774327_HBe_P-C of FT:mat_peptide KC774327_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2069). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774329_HBe_P-C Product feature CHAIN KC774329_HBe_P-C of FT:mat_peptide KC774329_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2074). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774330_HBe_P-C Product feature CHAIN KC774330_HBe_P-C of FT:mat_peptide KC774330_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2075). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774331_HBe_P-C Product feature CHAIN KC774331_HBe_P-C of FT:mat_peptide KC774331_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2077). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774333_HBe_P-C Product feature CHAIN KC774333_HBe_P-C of FT:mat_peptide KC774333_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1006). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774334_HBe_P-C Product feature CHAIN KC774334_HBe_P-C of FT:mat_peptide KC774334_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1007). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|KC774335_HBe_P-C Product feature CHAIN KC774335_HBe_P-C of FT:mat_peptide KC774335_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1013). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774336_HBe_P-C Product feature CHAIN KC774336_HBe_P-C of FT:mat_peptide KC774336_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1015). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774337_HBe_P-C Product feature CHAIN KC774337_HBe_P-C of FT:mat_peptide KC774337_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1019). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774338_HBe_P-C Product feature CHAIN KC774338_HBe_P-C of FT:mat_peptide KC774338_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1027). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774339_HBe_P-C Product feature CHAIN KC774339_HBe_P-C of FT:mat_peptide KC774339_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1029). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774340_HBe_P-C Product feature CHAIN KC774340_HBe_P-C of FT:mat_peptide KC774340_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1034). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPNA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774342_HBe_P-C Product feature CHAIN KC774342_HBe_P-C of FT:mat_peptide KC774342_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1044). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774343_HBe_P-C Product feature CHAIN KC774343_HBe_P-C of FT:mat_peptide KC774343_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1046). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774345_HBe_P-C Product feature CHAIN KC774345_HBe_P-C of FT:mat_peptide KC774345_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1076). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774347_HBe_P-C Product feature CHAIN KC774347_HBe_P-C of FT:mat_peptide KC774347_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1092). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774348_HBe_P-C Product feature CHAIN KC774348_HBe_P-C of FT:mat_peptide KC774348_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1093). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774351_HBe_P-C Product feature CHAIN KC774351_HBe_P-C of FT:mat_peptide KC774351_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1031). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774352_HBe_P-C Product feature CHAIN KC774352_HBe_P-C of FT:mat_peptide KC774352_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1042). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQIPRRRRSQSRESQC
>gnl|hbvpro|KC774353_HBe_P-C Product feature CHAIN KC774353_HBe_P-C of FT:mat_peptide KC774353_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1043). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|KC774354_HBe_P-C Product feature CHAIN KC774354_HBe_P-C of FT:mat_peptide KC774354_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1048). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KC774355_HBe_P-C Product feature CHAIN KC774355_HBe_P-C of FT:mat_peptide KC774355_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1070). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KC774356_HBe_P-C Product feature CHAIN KC774356_HBe_P-C of FT:mat_peptide KC774356_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1080). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774357_HBe_P-C Product feature CHAIN KC774357_HBe_P-C of FT:mat_peptide KC774357_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1081). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774358_HBe_P-C Product feature CHAIN KC774358_HBe_P-C of FT:mat_peptide KC774358_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1098). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774359_HBe_P-C Product feature CHAIN KC774359_HBe_P-C of FT:mat_peptide KC774359_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1099). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774360_HBe_P-C Product feature CHAIN KC774360_HBe_P-C of FT:mat_peptide KC774360_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1105). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774361_HBe_P-C Product feature CHAIN KC774361_HBe_P-C of FT:mat_peptide KC774361_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1106). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KC875261_HBe_P-C Product feature CHAIN KC875261_HBe_P-C of FT:mat_peptide KC875261_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV26). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875262_HBe_P-C Product feature CHAIN KC875262_HBe_P-C of FT:mat_peptide KC875262_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV36). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875263_HBe_P-C Product feature CHAIN KC875263_HBe_P-C of FT:mat_peptide KC875263_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV61). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAPVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875264_HBe_P-C Product feature CHAIN KC875264_HBe_P-C of FT:mat_peptide KC875264_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV49). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPHA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875265_HBe_P-C Product feature CHAIN KC875265_HBe_P-C of FT:mat_peptide KC875265_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV50). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPHA
YRPPNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875267_HBe_P-C Product feature CHAIN KC875267_HBe_P-C of FT:mat_peptide KC875267_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV33). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875268_HBe_P-C Product feature CHAIN KC875268_HBe_P-C of FT:mat_peptide KC875268_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV68). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRSSQSRESQC
>gnl|hbvpro|KC875269_HBe_P-C Product feature CHAIN KC875269_HBe_P-C of FT:mat_peptide KC875269_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV62). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKIRELLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875270_HBe_P-C Product feature CHAIN KC875270_HBe_P-C of FT:mat_peptide KC875270_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV63). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875271_HBe_P-C Product feature CHAIN KC875271_HBe_P-C of FT:mat_peptide KC875271_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV65). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGVKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPG
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875272_HBe_P-C Product feature CHAIN KC875272_HBe_P-C of FT:mat_peptide KC875272_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV64). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214651_HBe_P-C Product feature CHAIN KF214651_HBe_P-C of FT:mat_peptide KF214651_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KF214670_HBe_P-C Product feature CHAIN KF214670_HBe_P-C of FT:mat_peptide KF214670_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2010-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPNVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214671_HBe_P-C Product feature CHAIN KF214671_HBe_P-C of FT:mat_peptide KF214671_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2007-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWICTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214672_HBe_P-C Product feature CHAIN KF214672_HBe_P-C of FT:mat_peptide KF214672_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-18). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214673_HBe_P-C Product feature CHAIN KF214673_HBe_P-C of FT:mat_peptide KF214673_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214675_HBe_P-C Product feature CHAIN KF214675_HBe_P-C of FT:mat_peptide KF214675_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLNLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214676_HBe_P-C Product feature CHAIN KF214676_HBe_P-C of FT:mat_peptide KF214676_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214677_HBe_P-C Product feature CHAIN KF214677_HBe_P-C of FT:mat_peptide KF214677_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-15). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFPLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAASLYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KF214678_HBe_P-C Product feature CHAIN KF214678_HBe_P-C of FT:mat_peptide KF214678_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-9). Partial genome (Contains: HBe, HBc, HBx, LHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF485389_HBe_P-C Product feature CHAIN KF485389_HBe_P-C of FT:mat_peptide KF485389_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF485390_HBe_P-C Product feature CHAIN KF485390_HBe_P-C of FT:mat_peptide KF485390_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKESGASVEILSFLPSDFFPXIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVXSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF495606_HBe_P-C Product feature CHAIN KF495606_HBe_P-C of FT:mat_peptide KF495606_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NT-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873526_HBe_P-C Product feature CHAIN KF873526_HBe_P-C of FT:mat_peptide KF873526_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 040_K_Laj). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873536_HBe_P-C Product feature CHAIN KF873536_HBe_P-C of FT:mat_peptide KF873536_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 062_WA_Man). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKXRQXLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPXNAPILSTLPETTVVRQRGRXXRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KF873539_HBe_P-C Product feature CHAIN KF873539_HBe_P-C of FT:mat_peptide KF873539_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 033_TI_Ngu). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYRDALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELXVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873541_HBe_P-C Product feature CHAIN KF873541_HBe_P-C of FT:mat_peptide KF873541_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 042_DR_Wad). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF873544_HBe_P-C Product feature CHAIN KF873544_HBe_P-C of FT:mat_peptide KF873544_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 009_DR_Wad). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDXYKEFGASXQLLSFLPSDFFPSIRDLLDTASALYQEALESQEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDXASRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173281_HBe_P-C Product feature CHAIN KJ173281_HBe_P-C of FT:mat_peptide KJ173281_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX009C(e216)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173282_HBe_P-C Product feature CHAIN KJ173282_HBe_P-C of FT:mat_peptide KJ173282_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX009M(e217)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173283_HBe_P-C Product feature CHAIN KJ173283_HBe_P-C of FT:mat_peptide KJ173283_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX022C(e230)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173284_HBe_P-C Product feature CHAIN KJ173284_HBe_P-C of FT:mat_peptide KJ173284_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX022M(e231)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173285_HBe_P-C Product feature CHAIN KJ173285_HBe_P-C of FT:mat_peptide KJ173285_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX026C(e241)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173286_HBe_P-C Product feature CHAIN KJ173286_HBe_P-C of FT:mat_peptide KJ173286_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX026M(e242)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173287_HBe_P-C Product feature CHAIN KJ173287_HBe_P-C of FT:mat_peptide KJ173287_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX028C(e244)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRKSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173288_HBe_P-C Product feature CHAIN KJ173288_HBe_P-C of FT:mat_peptide KJ173288_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX028M(e245n)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173289_HBe_P-C Product feature CHAIN KJ173289_HBe_P-C of FT:mat_peptide KJ173289_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX038C(e252)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173291_HBe_P-C Product feature CHAIN KJ173291_HBe_P-C of FT:mat_peptide KJ173291_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX050C(e275n)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173292_HBe_P-C Product feature CHAIN KJ173292_HBe_P-C of FT:mat_peptide KJ173292_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX050M(e276n)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173293_HBe_P-C Product feature CHAIN KJ173293_HBe_P-C of FT:mat_peptide KJ173293_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX063C(e307)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173294_HBe_P-C Product feature CHAIN KJ173294_HBe_P-C of FT:mat_peptide KJ173294_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX063M(e308)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173295_HBe_P-C Product feature CHAIN KJ173295_HBe_P-C of FT:mat_peptide KJ173295_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH001C(e44)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPXRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|KJ173296_HBe_P-C Product feature CHAIN KJ173296_HBe_P-C of FT:mat_peptide KJ173296_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH001M(e45)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173301_HBe_P-C Product feature CHAIN KJ173301_HBe_P-C of FT:mat_peptide KJ173301_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB129C(m130)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173302_HBe_P-C Product feature CHAIN KJ173302_HBe_P-C of FT:mat_peptide KJ173302_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB129M(m129)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173303_HBe_P-C Product feature CHAIN KJ173303_HBe_P-C of FT:mat_peptide KJ173303_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB215C(m216)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173304_HBe_P-C Product feature CHAIN KJ173304_HBe_P-C of FT:mat_peptide KJ173304_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB215M(m215)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173305_HBe_P-C Product feature CHAIN KJ173305_HBe_P-C of FT:mat_peptide KJ173305_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB023C(m24)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173306_HBe_P-C Product feature CHAIN KJ173306_HBe_P-C of FT:mat_peptide KJ173306_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB023M(M23)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173307_HBe_P-C Product feature CHAIN KJ173307_HBe_P-C of FT:mat_peptide KJ173307_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB255C(m256)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173308_HBe_P-C Product feature CHAIN KJ173308_HBe_P-C of FT:mat_peptide KJ173308_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB255M(m255)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173309_HBe_P-C Product feature CHAIN KJ173309_HBe_P-C of FT:mat_peptide KJ173309_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB045C(m46)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173310_HBe_P-C Product feature CHAIN KJ173310_HBe_P-C of FT:mat_peptide KJ173310_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB045M(m45)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173311_HBe_P-C Product feature CHAIN KJ173311_HBe_P-C of FT:mat_peptide KJ173311_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH005C(e49)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ173312_HBe_P-C Product feature CHAIN KJ173312_HBe_P-C of FT:mat_peptide KJ173312_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH005M(e50)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173313_HBe_P-C Product feature CHAIN KJ173313_HBe_P-C of FT:mat_peptide KJ173313_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH006C(e34)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173314_HBe_P-C Product feature CHAIN KJ173314_HBe_P-C of FT:mat_peptide KJ173314_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH006M(e35)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173315_HBe_P-C Product feature CHAIN KJ173315_HBe_P-C of FT:mat_peptide KJ173315_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH017C(e36)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173316_HBe_P-C Product feature CHAIN KJ173316_HBe_P-C of FT:mat_peptide KJ173316_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH017M(e37)). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173317_HBe_P-C Product feature CHAIN KJ173317_HBe_P-C of FT:mat_peptide KJ173317_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH25C(e38)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ173321_HBe_P-C Product feature CHAIN KJ173321_HBe_P-C of FT:mat_peptide KJ173321_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH30C(e43)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173324_HBe_P-C Product feature CHAIN KJ173324_HBe_P-C of FT:mat_peptide KJ173324_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P001-M(003)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173327_HBe_P-C Product feature CHAIN KJ173327_HBe_P-C of FT:mat_peptide KJ173327_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P005_C(017)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173328_HBe_P-C Product feature CHAIN KJ173328_HBe_P-C of FT:mat_peptide KJ173328_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P005-M(327)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173331_HBe_P-C Product feature CHAIN KJ173331_HBe_P-C of FT:mat_peptide KJ173331_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY002C(e101)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173332_HBe_P-C Product feature CHAIN KJ173332_HBe_P-C of FT:mat_peptide KJ173332_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY002M(e102)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173333_HBe_P-C Product feature CHAIN KJ173333_HBe_P-C of FT:mat_peptide KJ173333_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY003C(e104)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173335_HBe_P-C Product feature CHAIN KJ173335_HBe_P-C of FT:mat_peptide KJ173335_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY010C(e112)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173336_HBe_P-C Product feature CHAIN KJ173336_HBe_P-C of FT:mat_peptide KJ173336_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY010M(e113)). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173337_HBe_P-C Product feature CHAIN KJ173337_HBe_P-C of FT:mat_peptide KJ173337_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY028C(e133)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173391_HBe_P-C Product feature CHAIN KJ173391_HBe_P-C of FT:mat_peptide KJ173391_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac01-M(m601)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173392_HBe_P-C Product feature CHAIN KJ173392_HBe_P-C of FT:mat_peptide KJ173392_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac01-C(m602)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173393_HBe_P-C Product feature CHAIN KJ173393_HBe_P-C of FT:mat_peptide KJ173393_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac04-M(m611)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173394_HBe_P-C Product feature CHAIN KJ173394_HBe_P-C of FT:mat_peptide KJ173394_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac04-C(m612)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173395_HBe_P-C Product feature CHAIN KJ173395_HBe_P-C of FT:mat_peptide KJ173395_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac06-M(m619)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173396_HBe_P-C Product feature CHAIN KJ173396_HBe_P-C of FT:mat_peptide KJ173396_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac06-C(m620)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173426_HBe_P-C Product feature CHAIN KJ173426_HBe_P-C of FT:mat_peptide KJ173426_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_CLP(3)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173427_HBe_P-C Product feature CHAIN KJ173427_HBe_P-C of FT:mat_peptide KJ173427_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N01-M(011A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173428_HBe_P-C Product feature CHAIN KJ173428_HBe_P-C of FT:mat_peptide KJ173428_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N01-C(011B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173429_HBe_P-C Product feature CHAIN KJ173429_HBe_P-C of FT:mat_peptide KJ173429_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N02-M(085A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ173430_HBe_P-C Product feature CHAIN KJ173430_HBe_P-C of FT:mat_peptide KJ173430_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N02-C(085B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ173431_HBe_P-C Product feature CHAIN KJ173431_HBe_P-C of FT:mat_peptide KJ173431_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N04-M(158A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173432_HBe_P-C Product feature CHAIN KJ173432_HBe_P-C of FT:mat_peptide KJ173432_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N04-C(158B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173433_HBe_P-C Product feature CHAIN KJ173433_HBe_P-C of FT:mat_peptide KJ173433_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N05-M(159A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173434_HBe_P-C Product feature CHAIN KJ173434_HBe_P-C of FT:mat_peptide KJ173434_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N05-C(159B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173435_HBe_P-C Product feature CHAIN KJ173435_HBe_P-C of FT:mat_peptide KJ173435_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N06-M(166A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173436_HBe_P-C Product feature CHAIN KJ173436_HBe_P-C of FT:mat_peptide KJ173436_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N06-C(166B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173437_HBe_P-C Product feature CHAIN KJ173437_HBe_P-C of FT:mat_peptide KJ173437_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N08-M(6615A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173438_HBe_P-C Product feature CHAIN KJ173438_HBe_P-C of FT:mat_peptide KJ173438_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N08-C(3547B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173439_HBe_P-C Product feature CHAIN KJ173439_HBe_P-C of FT:mat_peptide KJ173439_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N12-M(6600A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173440_HBe_P-C Product feature CHAIN KJ173440_HBe_P-C of FT:mat_peptide KJ173440_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N12-C(4131B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173441_HBe_P-C Product feature CHAIN KJ173441_HBe_P-C of FT:mat_peptide KJ173441_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N17-M(199A)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173442_HBe_P-C Product feature CHAIN KJ173442_HBe_P-C of FT:mat_peptide KJ173442_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N17-C(199B)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173443_HBe_P-C Product feature CHAIN KJ173443_HBe_P-C of FT:mat_peptide KJ173443_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N207M(e413)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173444_HBe_P-C Product feature CHAIN KJ173444_HBe_P-C of FT:mat_peptide KJ173444_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N207C(e414)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173445_HBe_P-C Product feature CHAIN KJ173445_HBe_P-C of FT:mat_peptide KJ173445_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N208M(e415)). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ173446_HBe_P-C Product feature CHAIN KJ173446_HBe_P-C of FT:mat_peptide KJ173446_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N208C(e416)). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410489_HBe_P-C Product feature CHAIN KJ410489_HBe_P-C of FT:mat_peptide KJ410489_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1202). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ410491_HBe_P-C Product feature CHAIN KJ410491_HBe_P-C of FT:mat_peptide KJ410491_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1323). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWDMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ410492_HBe_P-C Product feature CHAIN KJ410492_HBe_P-C of FT:mat_peptide KJ410492_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1313). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ410494_HBe_P-C Product feature CHAIN KJ410494_HBe_P-C of FT:mat_peptide KJ410494_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1100). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ410495_HBe_P-C Product feature CHAIN KJ410495_HBe_P-C of FT:mat_peptide KJ410495_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1324). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410496_HBe_P-C Product feature CHAIN KJ410496_HBe_P-C of FT:mat_peptide KJ410496_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1095). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRSRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410498_HBe_P-C Product feature CHAIN KJ410498_HBe_P-C of FT:mat_peptide KJ410498_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK0015). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KJ410501_HBe_P-C Product feature CHAIN KJ410501_HBe_P-C of FT:mat_peptide KJ410501_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK532). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410505_HBe_P-C Product feature CHAIN KJ410505_HBe_P-C of FT:mat_peptide KJ410505_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HBV320). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410508_HBe_P-C Product feature CHAIN KJ410508_HBe_P-C of FT:mat_peptide KJ410508_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK346). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCIIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410510_HBe_P-C Product feature CHAIN KJ410510_HBe_P-C of FT:mat_peptide KJ410510_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK323). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGRLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTANALHREALESPEHCSPH
HTAFRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGMKISQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410511_HBe_P-C Product feature CHAIN KJ410511_HBe_P-C of FT:mat_peptide KJ410511_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPIA
YRPPNAPILSTLPETTVIRQRGRSPRRRTPSPRRRRSQSPRRRRSKSRESGC
>gnl|hbvpro|KJ410513_HBe_P-C Product feature CHAIN KJ410513_HBe_P-C of FT:mat_peptide KJ410513_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK523). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410514_HBe_P-C Product feature CHAIN KJ410514_HBe_P-C of FT:mat_peptide KJ410514_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK76). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASREAVVRYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPG
YRPPNAPILSTLPETTVLRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ410518_HBe_P-C Product feature CHAIN KJ410518_HBe_P-C of FT:mat_peptide KJ410518_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK313). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPDHCSAH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRGRGRSPRRRTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|KJ410519_HBe_P-C Product feature CHAIN KJ410519_HBe_P-C of FT:mat_peptide KJ410519_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK514). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598635_HBe_P-C Product feature CHAIN KJ598635_HBe_P-C of FT:mat_peptide KJ598635_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598636_HBe_P-C Product feature CHAIN KJ598636_HBe_P-C of FT:mat_peptide KJ598636_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598637_HBe_P-C Product feature CHAIN KJ598637_HBe_P-C of FT:mat_peptide KJ598637_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C5). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598638_HBe_P-C Product feature CHAIN KJ598638_HBe_P-C of FT:mat_peptide KJ598638_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598639_HBe_P-C Product feature CHAIN KJ598639_HBe_P-C of FT:mat_peptide KJ598639_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598640_HBe_P-C Product feature CHAIN KJ598640_HBe_P-C of FT:mat_peptide KJ598640_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C10). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598641_HBe_P-C Product feature CHAIN KJ598641_HBe_P-C of FT:mat_peptide KJ598641_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB113). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598642_HBe_P-C Product feature CHAIN KJ598642_HBe_P-C of FT:mat_peptide KJ598642_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1A4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREAFESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598644_HBe_P-C Product feature CHAIN KJ598644_HBe_P-C of FT:mat_peptide KJ598644_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB114). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598645_HBe_P-C Product feature CHAIN KJ598645_HBe_P-C of FT:mat_peptide KJ598645_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB210). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
RQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598646_HBe_P-C Product feature CHAIN KJ598646_HBe_P-C of FT:mat_peptide KJ598646_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598647_HBe_P-C Product feature CHAIN KJ598647_HBe_P-C of FT:mat_peptide KJ598647_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598648_HBe_P-C Product feature CHAIN KJ598648_HBe_P-C of FT:mat_peptide KJ598648_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S7). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598649_HBe_P-C Product feature CHAIN KJ598649_HBe_P-C of FT:mat_peptide KJ598649_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2SA8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598650_HBe_P-C Product feature CHAIN KJ598650_HBe_P-C of FT:mat_peptide KJ598650_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2SA15). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPLDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598651_HBe_P-C Product feature CHAIN KJ598651_HBe_P-C of FT:mat_peptide KJ598651_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2SB4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598652_HBe_P-C Product feature CHAIN KJ598652_HBe_P-C of FT:mat_peptide KJ598652_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598653_HBe_P-C Product feature CHAIN KJ598653_HBe_P-C of FT:mat_peptide KJ598653_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB28). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598654_HBe_P-C Product feature CHAIN KJ598654_HBe_P-C of FT:mat_peptide KJ598654_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB211). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTSSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598655_HBe_P-C Product feature CHAIN KJ598655_HBe_P-C of FT:mat_peptide KJ598655_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB212). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598656_HBe_P-C Product feature CHAIN KJ598656_HBe_P-C of FT:mat_peptide KJ598656_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB214). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSSRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598657_HBe_P-C Product feature CHAIN KJ598657_HBe_P-C of FT:mat_peptide KJ598657_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB215). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTSSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598658_HBe_P-C Product feature CHAIN KJ598658_HBe_P-C of FT:mat_peptide KJ598658_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2A8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598659_HBe_P-C Product feature CHAIN KJ598659_HBe_P-C of FT:mat_peptide KJ598659_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598660_HBe_P-C Product feature CHAIN KJ598660_HBe_P-C of FT:mat_peptide KJ598660_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB213). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598661_HBe_P-C Product feature CHAIN KJ598661_HBe_P-C of FT:mat_peptide KJ598661_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598679_HBe_P-C Product feature CHAIN KJ598679_HBe_P-C of FT:mat_peptide KJ598679_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB41). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598681_HBe_P-C Product feature CHAIN KJ598681_HBe_P-C of FT:mat_peptide KJ598681_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB43). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598686_HBe_P-C Product feature CHAIN KJ598686_HBe_P-C of FT:mat_peptide KJ598686_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB411). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598688_HBe_P-C Product feature CHAIN KJ598688_HBe_P-C of FT:mat_peptide KJ598688_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC110). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598689_HBe_P-C Product feature CHAIN KJ598689_HBe_P-C of FT:mat_peptide KJ598689_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC140). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598690_HBe_P-C Product feature CHAIN KJ598690_HBe_P-C of FT:mat_peptide KJ598690_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC18). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598691_HBe_P-C Product feature CHAIN KJ598691_HBe_P-C of FT:mat_peptide KJ598691_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQPRESQC
>gnl|hbvpro|KJ598694_HBe_P-C Product feature CHAIN KJ598694_HBe_P-C of FT:mat_peptide KJ598694_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC115). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598695_HBe_P-C Product feature CHAIN KJ598695_HBe_P-C of FT:mat_peptide KJ598695_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC116). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598696_HBe_P-C Product feature CHAIN KJ598696_HBe_P-C of FT:mat_peptide KJ598696_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC121). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598697_HBe_P-C Product feature CHAIN KJ598697_HBe_P-C of FT:mat_peptide KJ598697_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC123). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598698_HBe_P-C Product feature CHAIN KJ598698_HBe_P-C of FT:mat_peptide KJ598698_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC128). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598699_HBe_P-C Product feature CHAIN KJ598699_HBe_P-C of FT:mat_peptide KJ598699_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC129). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFPLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598701_HBe_P-C Product feature CHAIN KJ598701_HBe_P-C of FT:mat_peptide KJ598701_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SSC132). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598705_HBe_P-C Product feature CHAIN KJ598705_HBe_P-C of FT:mat_peptide KJ598705_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB51). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598706_HBe_P-C Product feature CHAIN KJ598706_HBe_P-C of FT:mat_peptide KJ598706_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB54). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598707_HBe_P-C Product feature CHAIN KJ598707_HBe_P-C of FT:mat_peptide KJ598707_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB56). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598708_HBe_P-C Product feature CHAIN KJ598708_HBe_P-C of FT:mat_peptide KJ598708_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB58). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598709_HBe_P-C Product feature CHAIN KJ598709_HBe_P-C of FT:mat_peptide KJ598709_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB511). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598710_HBe_P-C Product feature CHAIN KJ598710_HBe_P-C of FT:mat_peptide KJ598710_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB513). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598711_HBe_P-C Product feature CHAIN KJ598711_HBe_P-C of FT:mat_peptide KJ598711_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB515). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598712_HBe_P-C Product feature CHAIN KJ598712_HBe_P-C of FT:mat_peptide KJ598712_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB517). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598713_HBe_P-C Product feature CHAIN KJ598713_HBe_P-C of FT:mat_peptide KJ598713_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB518). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598714_HBe_P-C Product feature CHAIN KJ598714_HBe_P-C of FT:mat_peptide KJ598714_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB520). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598715_HBe_P-C Product feature CHAIN KJ598715_HBe_P-C of FT:mat_peptide KJ598715_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB521). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598716_HBe_P-C Product feature CHAIN KJ598716_HBe_P-C of FT:mat_peptide KJ598716_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB5101). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598717_HBe_P-C Product feature CHAIN KJ598717_HBe_P-C of FT:mat_peptide KJ598717_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB5102). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598718_HBe_P-C Product feature CHAIN KJ598718_HBe_P-C of FT:mat_peptide KJ598718_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB5103). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598719_HBe_P-C Product feature CHAIN KJ598719_HBe_P-C of FT:mat_peptide KJ598719_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB5105). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598725_HBe_P-C Product feature CHAIN KJ598725_HBe_P-C of FT:mat_peptide KJ598725_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB69). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVIRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598740_HBe_P-C Product feature CHAIN KJ598740_HBe_P-C of FT:mat_peptide KJ598740_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB71). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598749_HBe_P-C Product feature CHAIN KJ598749_HBe_P-C of FT:mat_peptide KJ598749_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB715). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598752_HBe_P-C Product feature CHAIN KJ598752_HBe_P-C of FT:mat_peptide KJ598752_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB720). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598753_HBe_P-C Product feature CHAIN KJ598753_HBe_P-C of FT:mat_peptide KJ598753_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB721). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ598762_HBe_P-C Product feature CHAIN KJ598762_HBe_P-C of FT:mat_peptide KJ598762_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SLC1A0). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALCREALESPGHCSPH
HTALRQAILCCGELMNLATWVGNNLEDQASRELVVSYVNANMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSREHQC
>gnl|hbvpro|KJ598772_HBe_P-C Product feature CHAIN KJ598772_HBe_P-C of FT:mat_peptide KJ598772_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB812). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETAVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ790199_HBe_P-C Product feature CHAIN KJ790199_HBe_P-C of FT:mat_peptide KJ790199_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803754_HBe_P-C Product feature CHAIN KJ803754_HBe_P-C of FT:mat_peptide KJ803754_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY832150). Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPQDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETAVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ803757_HBe_P-C Product feature CHAIN KJ803757_HBe_P-C of FT:mat_peptide KJ803757_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY333850). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASRLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHH
HTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWMRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803759_HBe_P-C Product feature CHAIN KJ803759_HBe_P-C of FT:mat_peptide KJ803759_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY114622). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803761_HBe_P-C Product feature CHAIN KJ803761_HBe_P-C of FT:mat_peptide KJ803761_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY761182). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELLNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803762_HBe_P-C Product feature CHAIN KJ803762_HBe_P-C of FT:mat_peptide KJ803762_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY799841). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRQRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KJ803766_HBe_P-C Product feature CHAIN KJ803766_HBe_P-C of FT:mat_peptide KJ803766_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY5113). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRSPRRRTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KJ803770_HBe_P-C Product feature CHAIN KJ803770_HBe_P-C of FT:mat_peptide KJ803770_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY836190). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGEVMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803774_HBe_P-C Product feature CHAIN KJ803774_HBe_P-C of FT:mat_peptide KJ803774_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY98472). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTLWRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803776_HBe_P-C Product feature CHAIN KJ803776_HBe_P-C of FT:mat_peptide KJ803776_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY854757). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTAIRQAILCWGELMNLATWVGGNLEDPTSREAVVGYVNVNMGLKFRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803777_HBe_P-C Product feature CHAIN KJ803777_HBe_P-C of FT:mat_peptide KJ803777_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY772684). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLLLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPQNAPILSTLPETTVVRQRGRSLRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KJ803779_HBe_P-C Product feature CHAIN KJ803779_HBe_P-C of FT:mat_peptide KJ803779_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY814443). Complete genome. [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETCVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQCC
>gnl|hbvpro|KJ803780_HBe_P-C Product feature CHAIN KJ803780_HBe_P-C of FT:mat_peptide KJ803780_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY797212). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803790_HBe_P-C Product feature CHAIN KJ803790_HBe_P-C of FT:mat_peptide KJ803790_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY853912). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQCRESQC
>gnl|hbvpro|KJ803792_HBe_P-C Product feature CHAIN KJ803792_HBe_P-C of FT:mat_peptide KJ803792_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY851636). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803793_HBe_P-C Product feature CHAIN KJ803793_HBe_P-C of FT:mat_peptide KJ803793_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY843805). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803799_HBe_P-C Product feature CHAIN KJ803799_HBe_P-C of FT:mat_peptide KJ803799_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY677465). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803811_HBe_P-C Product feature CHAIN KJ803811_HBe_P-C of FT:mat_peptide KJ803811_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY511545). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803813_HBe_P-C Product feature CHAIN KJ803813_HBe_P-C of FT:mat_peptide KJ803813_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY402913). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803814_HBe_P-C Product feature CHAIN KJ803814_HBe_P-C of FT:mat_peptide KJ803814_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY062175). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPLRRTSQSRESQC
>gnl|hbvpro|KJ803815_HBe_P-C Product feature CHAIN KJ803815_HBe_P-C of FT:mat_peptide KJ803815_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY070852). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPLRRTSQSRESQC
>gnl|hbvpro|KJ803818_HBe_P-C Product feature CHAIN KJ803818_HBe_P-C of FT:mat_peptide KJ803818_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY403021). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ803823_HBe_P-C Product feature CHAIN KJ803823_HBe_P-C of FT:mat_peptide KJ803823_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY342396). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPV
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KJ803826_HBe_P-C Product feature CHAIN KJ803826_HBe_P-C of FT:mat_peptide KJ803826_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY491357). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KM213037_HBe_P-C Product feature CHAIN KM213037_HBe_P-C of FT:mat_peptide KM213037_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate X15-k1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM229703_HBe_P-C Product feature CHAIN KM229703_HBe_P-C of FT:mat_peptide KM229703_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3115). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM359441_HBe_P-C Product feature CHAIN KM359441_HBe_P-C of FT:mat_peptide KM359441_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875404_HBe_P-C Product feature CHAIN KM875404_HBe_P-C of FT:mat_peptide KM875404_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt1N). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTT
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875412_HBe_P-C Product feature CHAIN KM875412_HBe_P-C of FT:mat_peptide KM875412_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt6N). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQVILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKLRHLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875424_HBe_P-C Product feature CHAIN KM875424_HBe_P-C of FT:mat_peptide KM875424_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt13N). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875425_HBe_P-C Product feature CHAIN KM875425_HBe_P-C of FT:mat_peptide KM875425_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt13T). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRALLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM875430_HBe_P-C Product feature CHAIN KM875430_HBe_P-C of FT:mat_peptide KM875430_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pt16N). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP027477_HBe_P-C Product feature CHAIN KP027477_HBe_P-C of FT:mat_peptide KP027477_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148315_HBe_P-C Product feature CHAIN KP148315_HBe_P-C of FT:mat_peptide KP148315_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148462_HBe_P-C Product feature CHAIN KP148462_HBe_P-C of FT:mat_peptide KP148462_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP148463_HBe_P-C Product feature CHAIN KP148463_HBe_P-C of FT:mat_peptide KP148463_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148464_HBe_P-C Product feature CHAIN KP148464_HBe_P-C of FT:mat_peptide KP148464_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148465_HBe_P-C Product feature CHAIN KP148465_HBe_P-C of FT:mat_peptide KP148465_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-22). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148466_HBe_P-C Product feature CHAIN KP148466_HBe_P-C of FT:mat_peptide KP148466_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y17-25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148468_HBe_P-C Product feature CHAIN KP148468_HBe_P-C of FT:mat_peptide KP148468_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148469_HBe_P-C Product feature CHAIN KP148469_HBe_P-C of FT:mat_peptide KP148469_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148470_HBe_P-C Product feature CHAIN KP148470_HBe_P-C of FT:mat_peptide KP148470_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALGSPEHCSPH
HTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148471_HBe_P-C Product feature CHAIN KP148471_HBe_P-C of FT:mat_peptide KP148471_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148472_HBe_P-C Product feature CHAIN KP148472_HBe_P-C of FT:mat_peptide KP148472_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-8). Complete genome. [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWFWGMDIDPYKEFGASVELLSLFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPP
AYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148473_HBe_P-C Product feature CHAIN KP148473_HBe_P-C of FT:mat_peptide KP148473_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCFGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148474_HBe_P-C Product feature CHAIN KP148474_HBe_P-C of FT:mat_peptide KP148474_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVSVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148475_HBe_P-C Product feature CHAIN KP148475_HBe_P-C of FT:mat_peptide KP148475_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISRLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148476_HBe_P-C Product feature CHAIN KP148476_HBe_P-C of FT:mat_peptide KP148476_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREAFESPEHCSPH
HTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148477_HBe_P-C Product feature CHAIN KP148477_HBe_P-C of FT:mat_peptide KP148477_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-18). Complete genome. [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWFWGMDIDPYKEFGASVELLSLFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPP
AYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148480_HBe_P-C Product feature CHAIN KP148480_HBe_P-C of FT:mat_peptide KP148480_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-23). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDYFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148481_HBe_P-C Product feature CHAIN KP148481_HBe_P-C of FT:mat_peptide KP148481_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148482_HBe_P-C Product feature CHAIN KP148482_HBe_P-C of FT:mat_peptide KP148482_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-25). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148487_HBe_P-C Product feature CHAIN KP148487_HBe_P-C of FT:mat_peptide KP148487_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-30). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148488_HBe_P-C Product feature CHAIN KP148488_HBe_P-C of FT:mat_peptide KP148488_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-31). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRHRRSQSRESQC
>gnl|hbvpro|KP148489_HBe_P-C Product feature CHAIN KP148489_HBe_P-C of FT:mat_peptide KP148489_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-32). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148492_HBe_P-C Product feature CHAIN KP148492_HBe_P-C of FT:mat_peptide KP148492_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-35). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148493_HBe_P-C Product feature CHAIN KP148493_HBe_P-C of FT:mat_peptide KP148493_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y177-37). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148512_HBe_P-C Product feature CHAIN KP148512_HBe_P-C of FT:mat_peptide KP148512_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148513_HBe_P-C Product feature CHAIN KP148513_HBe_P-C of FT:mat_peptide KP148513_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148517_HBe_P-C Product feature CHAIN KP148517_HBe_P-C of FT:mat_peptide KP148517_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148520_HBe_P-C Product feature CHAIN KP148520_HBe_P-C of FT:mat_peptide KP148520_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGVSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148521_HBe_P-C Product feature CHAIN KP148521_HBe_P-C of FT:mat_peptide KP148521_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148523_HBe_P-C Product feature CHAIN KP148523_HBe_P-C of FT:mat_peptide KP148523_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-29). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148524_HBe_P-C Product feature CHAIN KP148524_HBe_P-C of FT:mat_peptide KP148524_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-30). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148525_HBe_P-C Product feature CHAIN KP148525_HBe_P-C of FT:mat_peptide KP148525_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-32). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDYFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILRWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGAWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRGSQSRESQC
>gnl|hbvpro|KP148526_HBe_P-C Product feature CHAIN KP148526_HBe_P-C of FT:mat_peptide KP148526_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-33). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148528_HBe_P-C Product feature CHAIN KP148528_HBe_P-C of FT:mat_peptide KP148528_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-36). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148529_HBe_P-C Product feature CHAIN KP148529_HBe_P-C of FT:mat_peptide KP148529_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-38). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148531_HBe_P-C Product feature CHAIN KP148531_HBe_P-C of FT:mat_peptide KP148531_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-43). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148532_HBe_P-C Product feature CHAIN KP148532_HBe_P-C of FT:mat_peptide KP148532_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-44). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASRLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148534_HBe_P-C Product feature CHAIN KP148534_HBe_P-C of FT:mat_peptide KP148534_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-49). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148535_HBe_P-C Product feature CHAIN KP148535_HBe_P-C of FT:mat_peptide KP148535_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-50). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148538_HBe_P-C Product feature CHAIN KP148538_HBe_P-C of FT:mat_peptide KP148538_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-2-63). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148540_HBe_P-C Product feature CHAIN KP148540_HBe_P-C of FT:mat_peptide KP148540_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALGQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148545_HBe_P-C Product feature CHAIN KP148545_HBe_P-C of FT:mat_peptide KP148545_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148546_HBe_P-C Product feature CHAIN KP148546_HBe_P-C of FT:mat_peptide KP148546_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTFPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148547_HBe_P-C Product feature CHAIN KP148547_HBe_P-C of FT:mat_peptide KP148547_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRPQSRESQC
>gnl|hbvpro|KP148548_HBe_P-C Product feature CHAIN KP148548_HBe_P-C of FT:mat_peptide KP148548_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVDVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148549_HBe_P-C Product feature CHAIN KP148549_HBe_P-C of FT:mat_peptide KP148549_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-23). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148551_HBe_P-C Product feature CHAIN KP148551_HBe_P-C of FT:mat_peptide KP148551_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-32). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148554_HBe_P-C Product feature CHAIN KP148554_HBe_P-C of FT:mat_peptide KP148554_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-36). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148555_HBe_P-C Product feature CHAIN KP148555_HBe_P-C of FT:mat_peptide KP148555_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-37). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148557_HBe_P-C Product feature CHAIN KP148557_HBe_P-C of FT:mat_peptide KP148557_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-40). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPPPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148558_HBe_P-C Product feature CHAIN KP148558_HBe_P-C of FT:mat_peptide KP148558_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-44). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIPCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148559_HBe_P-C Product feature CHAIN KP148559_HBe_P-C of FT:mat_peptide KP148559_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-45). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPSVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRQRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148560_HBe_P-C Product feature CHAIN KP148560_HBe_P-C of FT:mat_peptide KP148560_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-48). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148561_HBe_P-C Product feature CHAIN KP148561_HBe_P-C of FT:mat_peptide KP148561_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-50). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148562_HBe_P-C Product feature CHAIN KP148562_HBe_P-C of FT:mat_peptide KP148562_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-55). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPV
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148563_HBe_P-C Product feature CHAIN KP148563_HBe_P-C of FT:mat_peptide KP148563_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-56). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLPFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148564_HBe_P-C Product feature CHAIN KP148564_HBe_P-C of FT:mat_peptide KP148564_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-57). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPISSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148566_HBe_P-C Product feature CHAIN KP148566_HBe_P-C of FT:mat_peptide KP148566_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-59). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRGALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148568_HBe_P-C Product feature CHAIN KP148568_HBe_P-C of FT:mat_peptide KP148568_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-62). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKAFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148570_HBe_P-C Product feature CHAIN KP148570_HBe_P-C of FT:mat_peptide KP148570_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-65). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148571_HBe_P-C Product feature CHAIN KP148571_HBe_P-C of FT:mat_peptide KP148571_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-67). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148572_HBe_P-C Product feature CHAIN KP148572_HBe_P-C of FT:mat_peptide KP148572_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-68). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLGTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148573_HBe_P-C Product feature CHAIN KP148573_HBe_P-C of FT:mat_peptide KP148573_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-70). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP148574_HBe_P-C Product feature CHAIN KP148574_HBe_P-C of FT:mat_peptide KP148574_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y26-3-71). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP784761_HBe_P-C Product feature CHAIN KP784761_HBe_P-C of FT:mat_peptide KP784761_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6130). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013762_HBe_P-C Product feature CHAIN KR013762_HBe_P-C of FT:mat_peptide KR013762_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQLPRRRRSQSRESQC
>gnl|hbvpro|KR013770_HBe_P-C Product feature CHAIN KR013770_HBe_P-C of FT:mat_peptide KR013770_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013771_HBe_P-C Product feature CHAIN KR013771_HBe_P-C of FT:mat_peptide KR013771_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFLPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSRSWESQC
>gnl|hbvpro|KR013772_HBe_P-C Product feature CHAIN KR013772_HBe_P-C of FT:mat_peptide KR013772_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPGHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREFQC
>gnl|hbvpro|KR013773_HBe_P-C Product feature CHAIN KR013773_HBe_P-C of FT:mat_peptide KR013773_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCRGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013774_HBe_P-C Product feature CHAIN KR013774_HBe_P-C of FT:mat_peptide KR013774_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013776_HBe_P-C Product feature CHAIN KR013776_HBe_P-C of FT:mat_peptide KR013776_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013779_HBe_P-C Product feature CHAIN KR013779_HBe_P-C of FT:mat_peptide KR013779_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013780_HBe_P-C Product feature CHAIN KR013780_HBe_P-C of FT:mat_peptide KR013780_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCFTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013781_HBe_P-C Product feature CHAIN KR013781_HBe_P-C of FT:mat_peptide KR013781_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVESLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013782_HBe_P-C Product feature CHAIN KR013782_HBe_P-C of FT:mat_peptide KR013782_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013783_HBe_P-C Product feature CHAIN KR013783_HBe_P-C of FT:mat_peptide KR013783_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013784_HBe_P-C Product feature CHAIN KR013784_HBe_P-C of FT:mat_peptide KR013784_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLPDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013785_HBe_P-C Product feature CHAIN KR013785_HBe_P-C of FT:mat_peptide KR013785_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013786_HBe_P-C Product feature CHAIN KR013786_HBe_P-C of FT:mat_peptide KR013786_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013787_HBe_P-C Product feature CHAIN KR013787_HBe_P-C of FT:mat_peptide KR013787_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013788_HBe_P-C Product feature CHAIN KR013788_HBe_P-C of FT:mat_peptide KR013788_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013789_HBe_P-C Product feature CHAIN KR013789_HBe_P-C of FT:mat_peptide KR013789_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013790_HBe_P-C Product feature CHAIN KR013790_HBe_P-C of FT:mat_peptide KR013790_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013791_HBe_P-C Product feature CHAIN KR013791_HBe_P-C of FT:mat_peptide KR013791_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013792_HBe_P-C Product feature CHAIN KR013792_HBe_P-C of FT:mat_peptide KR013792_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013793_HBe_P-C Product feature CHAIN KR013793_HBe_P-C of FT:mat_peptide KR013793_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLKDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013794_HBe_P-C Product feature CHAIN KR013794_HBe_P-C of FT:mat_peptide KR013794_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013796_HBe_P-C Product feature CHAIN KR013796_HBe_P-C of FT:mat_peptide KR013796_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMDLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YGPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KR013797_HBe_P-C Product feature CHAIN KR013797_HBe_P-C of FT:mat_peptide KR013797_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013798_HBe_P-C Product feature CHAIN KR013798_HBe_P-C of FT:mat_peptide KR013798_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013799_HBe_P-C Product feature CHAIN KR013799_HBe_P-C of FT:mat_peptide KR013799_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013800_HBe_P-C Product feature CHAIN KR013800_HBe_P-C of FT:mat_peptide KR013800_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013801_HBe_P-C Product feature CHAIN KR013801_HBe_P-C of FT:mat_peptide KR013801_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYIEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPLPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013802_HBe_P-C Product feature CHAIN KR013802_HBe_P-C of FT:mat_peptide KR013802_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPR
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KR013803_HBe_P-C Product feature CHAIN KR013803_HBe_P-C of FT:mat_peptide KR013803_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013808_HBe_P-C Product feature CHAIN KR013808_HBe_P-C of FT:mat_peptide KR013808_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHIPCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013809_HBe_P-C Product feature CHAIN KR013809_HBe_P-C of FT:mat_peptide KR013809_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPKRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013810_HBe_P-C Product feature CHAIN KR013810_HBe_P-C of FT:mat_peptide KR013810_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013811_HBe_P-C Product feature CHAIN KR013811_HBe_P-C of FT:mat_peptide KR013811_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013812_HBe_P-C Product feature CHAIN KR013812_HBe_P-C of FT:mat_peptide KR013812_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013813_HBe_P-C Product feature CHAIN KR013813_HBe_P-C of FT:mat_peptide KR013813_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013814_HBe_P-C Product feature CHAIN KR013814_HBe_P-C of FT:mat_peptide KR013814_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013815_HBe_P-C Product feature CHAIN KR013815_HBe_P-C of FT:mat_peptide KR013815_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013817_HBe_P-C Product feature CHAIN KR013817_HBe_P-C of FT:mat_peptide KR013817_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWPWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013818_HBe_P-C Product feature CHAIN KR013818_HBe_P-C of FT:mat_peptide KR013818_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDAYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013819_HBe_P-C Product feature CHAIN KR013819_HBe_P-C of FT:mat_peptide KR013819_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGEWMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPDAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013820_HBe_P-C Product feature CHAIN KR013820_HBe_P-C of FT:mat_peptide KR013820_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWNMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013821_HBe_P-C Product feature CHAIN KR013821_HBe_P-C of FT:mat_peptide KR013821_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013822_HBe_P-C Product feature CHAIN KR013822_HBe_P-C of FT:mat_peptide KR013822_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLLHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KR013823_HBe_P-C Product feature CHAIN KR013823_HBe_P-C of FT:mat_peptide KR013823_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRGRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KR013824_HBe_P-C Product feature CHAIN KR013824_HBe_P-C of FT:mat_peptide KR013824_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWPWSMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013825_HBe_P-C Product feature CHAIN KR013825_HBe_P-C of FT:mat_peptide KR013825_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KR013826_HBe_P-C Product feature CHAIN KR013826_HBe_P-C of FT:mat_peptide KR013826_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013828_HBe_P-C Product feature CHAIN KR013828_HBe_P-C of FT:mat_peptide KR013828_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013829_HBe_P-C Product feature CHAIN KR013829_HBe_P-C of FT:mat_peptide KR013829_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013830_HBe_P-C Product feature CHAIN KR013830_HBe_P-C of FT:mat_peptide KR013830_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLINSCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013831_HBe_P-C Product feature CHAIN KR013831_HBe_P-C of FT:mat_peptide KR013831_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQTSKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRDRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KR013832_HBe_P-C Product feature CHAIN KR013832_HBe_P-C of FT:mat_peptide KR013832_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013833_HBe_P-C Product feature CHAIN KR013833_HBe_P-C of FT:mat_peptide KR013833_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013834_HBe_P-C Product feature CHAIN KR013834_HBe_P-C of FT:mat_peptide KR013834_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013837_HBe_P-C Product feature CHAIN KR013837_HBe_P-C of FT:mat_peptide KR013837_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDILDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013840_HBe_P-C Product feature CHAIN KR013840_HBe_P-C of FT:mat_peptide KR013840_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKGFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013846_HBe_P-C Product feature CHAIN KR013846_HBe_P-C of FT:mat_peptide KR013846_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPPVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGAWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013850_HBe_P-C Product feature CHAIN KR013850_HBe_P-C of FT:mat_peptide KR013850_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013851_HBe_P-C Product feature CHAIN KR013851_HBe_P-C of FT:mat_peptide KR013851_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPAFRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLKYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013852_HBe_P-C Product feature CHAIN KR013852_HBe_P-C of FT:mat_peptide KR013852_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013853_HBe_P-C Product feature CHAIN KR013853_HBe_P-C of FT:mat_peptide KR013853_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNSEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013854_HBe_P-C Product feature CHAIN KR013854_HBe_P-C of FT:mat_peptide KR013854_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEGPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013855_HBe_P-C Product feature CHAIN KR013855_HBe_P-C of FT:mat_peptide KR013855_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPYDSFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013856_HBe_P-C Product feature CHAIN KR013856_HBe_P-C of FT:mat_peptide KR013856_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDTDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013857_HBe_P-C Product feature CHAIN KR013857_HBe_P-C of FT:mat_peptide KR013857_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLGTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013858_HBe_P-C Product feature CHAIN KR013858_HBe_P-C of FT:mat_peptide KR013858_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013859_HBe_P-C Product feature CHAIN KR013859_HBe_P-C of FT:mat_peptide KR013859_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013860_HBe_P-C Product feature CHAIN KR013860_HBe_P-C of FT:mat_peptide KR013860_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013861_HBe_P-C Product feature CHAIN KR013861_HBe_P-C of FT:mat_peptide KR013861_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRRAILCWGELMNLATWVGSNLEDPASREFVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013862_HBe_P-C Product feature CHAIN KR013862_HBe_P-C of FT:mat_peptide KR013862_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013871_HBe_P-C Product feature CHAIN KR013871_HBe_P-C of FT:mat_peptide KR013871_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYSVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013873_HBe_P-C Product feature CHAIN KR013873_HBe_P-C of FT:mat_peptide KR013873_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013875_HBe_P-C Product feature CHAIN KR013875_HBe_P-C of FT:mat_peptide KR013875_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013877_HBe_P-C Product feature CHAIN KR013877_HBe_P-C of FT:mat_peptide KR013877_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013904_HBe_P-C Product feature CHAIN KR013904_HBe_P-C of FT:mat_peptide KR013904_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFLPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013908_HBe_P-C Product feature CHAIN KR013908_HBe_P-C of FT:mat_peptide KR013908_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013909_HBe_P-C Product feature CHAIN KR013909_HBe_P-C of FT:mat_peptide KR013909_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013935_HBe_P-C Product feature CHAIN KR013935_HBe_P-C of FT:mat_peptide KR013935_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013942_HBe_P-C Product feature CHAIN KR013942_HBe_P-C of FT:mat_peptide KR013942_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKVRQLLWFHISCLAFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRCRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013943_HBe_P-C Product feature CHAIN KR013943_HBe_P-C of FT:mat_peptide KR013943_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLLHLCLIISCSCPTVQASKLCLGWLWGMDLDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013961_HBe_P-C Product feature CHAIN KR013961_HBe_P-C of FT:mat_peptide KR013961_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKKFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCPTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013969_HBe_P-C Product feature CHAIN KR013969_HBe_P-C of FT:mat_peptide KR013969_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013974_HBe_P-C Product feature CHAIN KR013974_HBe_P-C of FT:mat_peptide KR013974_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRGLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWTRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|KR013975_HBe_P-C Product feature CHAIN KR013975_HBe_P-C of FT:mat_peptide KR013975_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLRLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR013984_HBe_P-C Product feature CHAIN KR013984_HBe_P-C of FT:mat_peptide KR013984_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRPQSPRRRRSQSRESQC
>gnl|hbvpro|KR013996_HBe_P-C Product feature CHAIN KR013996_HBe_P-C of FT:mat_peptide KR013996_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=211 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTTLRQAILCWGELMNLATWVGGNLEDPASRELVVSYVYVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQ
>gnl|hbvpro|KR014055_HBe_P-C Product feature CHAIN KR014055_HBe_P-C of FT:mat_peptide KR014055_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPERCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR014059_HBe_P-C Product feature CHAIN KR014059_HBe_P-C of FT:mat_peptide KR014059_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLVDTASALYREALESPEHCSPH
HTALRQAIVCWGELMNLATWVGSNLEGPASRELEVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR014060_HBe_P-C Product feature CHAIN KR014060_HBe_P-C of FT:mat_peptide KR014060_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPERCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR014098_HBe_P-C Product feature CHAIN KR014098_HBe_P-C of FT:mat_peptide KR014098_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT284753_HBe_P-C Product feature CHAIN KT284753_HBe_P-C of FT:mat_peptide KT284753_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10139). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT284754_HBe_P-C Product feature CHAIN KT284754_HBe_P-C of FT:mat_peptide KT284754_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17162). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT284755_HBe_P-C Product feature CHAIN KT284755_HBe_P-C of FT:mat_peptide KT284755_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19168). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT284756_HBe_P-C Product feature CHAIN KT284756_HBe_P-C of FT:mat_peptide KT284756_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 21316). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT284758_HBe_P-C Product feature CHAIN KT284758_HBe_P-C of FT:mat_peptide KT284758_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 303). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT284759_HBe_P-C Product feature CHAIN KT284759_HBe_P-C of FT:mat_peptide KT284759_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 313). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT307718_HBe_P-C Product feature CHAIN KT307718_HBe_P-C of FT:mat_peptide KT307718_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV001). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT307719_HBe_P-C Product feature CHAIN KT307719_HBe_P-C of FT:mat_peptide KT307719_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV003). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREGLESPEHCSPH
PTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT364718_HBe_P-C Product feature CHAIN KT364718_HBe_P-C of FT:mat_peptide KT364718_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV004). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT364719_HBe_P-C Product feature CHAIN KT364719_HBe_P-C of FT:mat_peptide KT364719_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV005). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT364720_HBe_P-C Product feature CHAIN KT364720_HBe_P-C of FT:mat_peptide KT364720_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV006). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT364721_HBe_P-C Product feature CHAIN KT364721_HBe_P-C of FT:mat_peptide KT364721_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV007). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT364751_HBe_P-C Product feature CHAIN KT364751_HBe_P-C of FT:mat_peptide KT364751_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HN-47). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT364752_HBe_P-C Product feature CHAIN KT364752_HBe_P-C of FT:mat_peptide KT364752_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HN-44). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366463_HBe_P-C Product feature CHAIN KT366463_HBe_P-C of FT:mat_peptide KT366463_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C-EICI.4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT987423_HBe_P-C Product feature CHAIN KT987423_HBe_P-C of FT:mat_peptide KT987423_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV008). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT987424_HBe_P-C Product feature CHAIN KT987424_HBe_P-C of FT:mat_peptide KT987424_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV010). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT987425_HBe_P-C Product feature CHAIN KT987425_HBe_P-C of FT:mat_peptide KT987425_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV011). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT987426_HBe_P-C Product feature CHAIN KT987426_HBe_P-C of FT:mat_peptide KT987426_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV009). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU051423_HBe_P-C Product feature CHAIN KU051423_HBe_P-C of FT:mat_peptide KU051423_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV012). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPSNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU051424_HBe_P-C Product feature CHAIN KU051424_HBe_P-C of FT:mat_peptide KU051424_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV014). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU051425_HBe_P-C Product feature CHAIN KU051425_HBe_P-C of FT:mat_peptide KU051425_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV018). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU051426_HBe_P-C Product feature CHAIN KU051426_HBe_P-C of FT:mat_peptide KU051426_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV017). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU051427_HBe_P-C Product feature CHAIN KU051427_HBe_P-C of FT:mat_peptide KU051427_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MMHBV002). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU577049_HBe_P-C Product feature CHAIN KU577049_HBe_P-C of FT:mat_peptide KU577049_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 204-1). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668280_HBe_P-C Product feature CHAIN KU668280_HBe_P-C of FT:mat_peptide KU668280_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 66-86c). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=211 residues).
MQPFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKELGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAY
RPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQR
>gnl|hbvpro|KU679936_HBe_P-C Product feature CHAIN KU679936_HBe_P-C of FT:mat_peptide KU679936_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 075_K_Ngk). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|KU679937_HBe_P-C Product feature CHAIN KU679937_HBe_P-C of FT:mat_peptide KU679937_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 076_TI_Ngu). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCXXX
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCXTFGRXXVLEYLVSFGVWIRTPIA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|KU963886_HBe_P-C Product feature CHAIN KU963886_HBe_P-C of FT:mat_peptide KU963886_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963887_HBe_P-C Product feature CHAIN KU963887_HBe_P-C of FT:mat_peptide KU963887_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963888_HBe_P-C Product feature CHAIN KU963888_HBe_P-C of FT:mat_peptide KU963888_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963889_HBe_P-C Product feature CHAIN KU963889_HBe_P-C of FT:mat_peptide KU963889_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963890_HBe_P-C Product feature CHAIN KU963890_HBe_P-C of FT:mat_peptide KU963890_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963891_HBe_P-C Product feature CHAIN KU963891_HBe_P-C of FT:mat_peptide KU963891_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTTSALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963892_HBe_P-C Product feature CHAIN KU963892_HBe_P-C of FT:mat_peptide KU963892_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963893_HBe_P-C Product feature CHAIN KU963893_HBe_P-C of FT:mat_peptide KU963893_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963894_HBe_P-C Product feature CHAIN KU963894_HBe_P-C of FT:mat_peptide KU963894_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963895_HBe_P-C Product feature CHAIN KU963895_HBe_P-C of FT:mat_peptide KU963895_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963896_HBe_P-C Product feature CHAIN KU963896_HBe_P-C of FT:mat_peptide KU963896_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963897_HBe_P-C Product feature CHAIN KU963897_HBe_P-C of FT:mat_peptide KU963897_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963898_HBe_P-C Product feature CHAIN KU963898_HBe_P-C of FT:mat_peptide KU963898_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDIASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963899_HBe_P-C Product feature CHAIN KU963899_HBe_P-C of FT:mat_peptide KU963899_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963900_HBe_P-C Product feature CHAIN KU963900_HBe_P-C of FT:mat_peptide KU963900_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963901_HBe_P-C Product feature CHAIN KU963901_HBe_P-C of FT:mat_peptide KU963901_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963902_HBe_P-C Product feature CHAIN KU963902_HBe_P-C of FT:mat_peptide KU963902_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963903_HBe_P-C Product feature CHAIN KU963903_HBe_P-C of FT:mat_peptide KU963903_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963904_HBe_P-C Product feature CHAIN KU963904_HBe_P-C of FT:mat_peptide KU963904_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963905_HBe_P-C Product feature CHAIN KU963905_HBe_P-C of FT:mat_peptide KU963905_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963906_HBe_P-C Product feature CHAIN KU963906_HBe_P-C of FT:mat_peptide KU963906_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963907_HBe_P-C Product feature CHAIN KU963907_HBe_P-C of FT:mat_peptide KU963907_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963908_HBe_P-C Product feature CHAIN KU963908_HBe_P-C of FT:mat_peptide KU963908_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963909_HBe_P-C Product feature CHAIN KU963909_HBe_P-C of FT:mat_peptide KU963909_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963910_HBe_P-C Product feature CHAIN KU963910_HBe_P-C of FT:mat_peptide KU963910_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963911_HBe_P-C Product feature CHAIN KU963911_HBe_P-C of FT:mat_peptide KU963911_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963912_HBe_P-C Product feature CHAIN KU963912_HBe_P-C of FT:mat_peptide KU963912_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963913_HBe_P-C Product feature CHAIN KU963913_HBe_P-C of FT:mat_peptide KU963913_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963914_HBe_P-C Product feature CHAIN KU963914_HBe_P-C of FT:mat_peptide KU963914_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963915_HBe_P-C Product feature CHAIN KU963915_HBe_P-C of FT:mat_peptide KU963915_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963916_HBe_P-C Product feature CHAIN KU963916_HBe_P-C of FT:mat_peptide KU963916_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963917_HBe_P-C Product feature CHAIN KU963917_HBe_P-C of FT:mat_peptide KU963917_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVDMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963918_HBe_P-C Product feature CHAIN KU963918_HBe_P-C of FT:mat_peptide KU963918_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963919_HBe_P-C Product feature CHAIN KU963919_HBe_P-C of FT:mat_peptide KU963919_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963920_HBe_P-C Product feature CHAIN KU963920_HBe_P-C of FT:mat_peptide KU963920_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963921_HBe_P-C Product feature CHAIN KU963921_HBe_P-C of FT:mat_peptide KU963921_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963922_HBe_P-C Product feature CHAIN KU963922_HBe_P-C of FT:mat_peptide KU963922_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963923_HBe_P-C Product feature CHAIN KU963923_HBe_P-C of FT:mat_peptide KU963923_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963924_HBe_P-C Product feature CHAIN KU963924_HBe_P-C of FT:mat_peptide KU963924_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963925_HBe_P-C Product feature CHAIN KU963925_HBe_P-C of FT:mat_peptide KU963925_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963926_HBe_P-C Product feature CHAIN KU963926_HBe_P-C of FT:mat_peptide KU963926_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVQLLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963927_HBe_P-C Product feature CHAIN KU963927_HBe_P-C of FT:mat_peptide KU963927_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963928_HBe_P-C Product feature CHAIN KU963928_HBe_P-C of FT:mat_peptide KU963928_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963929_HBe_P-C Product feature CHAIN KU963929_HBe_P-C of FT:mat_peptide KU963929_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963992_HBe_P-C Product feature CHAIN KU963992_HBe_P-C of FT:mat_peptide KU963992_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 14_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963996_HBe_P-C Product feature CHAIN KU963996_HBe_P-C of FT:mat_peptide KU963996_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 14_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU963997_HBe_P-C Product feature CHAIN KU963997_HBe_P-C of FT:mat_peptide KU963997_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 14_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964002_HBe_P-C Product feature CHAIN KU964002_HBe_P-C of FT:mat_peptide KU964002_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 14_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTIVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964020_HBe_P-C Product feature CHAIN KU964020_HBe_P-C of FT:mat_peptide KU964020_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964021_HBe_P-C Product feature CHAIN KU964021_HBe_P-C of FT:mat_peptide KU964021_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964022_HBe_P-C Product feature CHAIN KU964022_HBe_P-C of FT:mat_peptide KU964022_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964023_HBe_P-C Product feature CHAIN KU964023_HBe_P-C of FT:mat_peptide KU964023_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964024_HBe_P-C Product feature CHAIN KU964024_HBe_P-C of FT:mat_peptide KU964024_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964025_HBe_P-C Product feature CHAIN KU964025_HBe_P-C of FT:mat_peptide KU964025_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964026_HBe_P-C Product feature CHAIN KU964026_HBe_P-C of FT:mat_peptide KU964026_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964027_HBe_P-C Product feature CHAIN KU964027_HBe_P-C of FT:mat_peptide KU964027_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964028_HBe_P-C Product feature CHAIN KU964028_HBe_P-C of FT:mat_peptide KU964028_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964029_HBe_P-C Product feature CHAIN KU964029_HBe_P-C of FT:mat_peptide KU964029_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964030_HBe_P-C Product feature CHAIN KU964030_HBe_P-C of FT:mat_peptide KU964030_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964031_HBe_P-C Product feature CHAIN KU964031_HBe_P-C of FT:mat_peptide KU964031_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964032_HBe_P-C Product feature CHAIN KU964032_HBe_P-C of FT:mat_peptide KU964032_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964033_HBe_P-C Product feature CHAIN KU964033_HBe_P-C of FT:mat_peptide KU964033_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964034_HBe_P-C Product feature CHAIN KU964034_HBe_P-C of FT:mat_peptide KU964034_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964035_HBe_P-C Product feature CHAIN KU964035_HBe_P-C of FT:mat_peptide KU964035_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964036_HBe_P-C Product feature CHAIN KU964036_HBe_P-C of FT:mat_peptide KU964036_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964037_HBe_P-C Product feature CHAIN KU964037_HBe_P-C of FT:mat_peptide KU964037_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964038_HBe_P-C Product feature CHAIN KU964038_HBe_P-C of FT:mat_peptide KU964038_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964039_HBe_P-C Product feature CHAIN KU964039_HBe_P-C of FT:mat_peptide KU964039_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964040_HBe_P-C Product feature CHAIN KU964040_HBe_P-C of FT:mat_peptide KU964040_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964041_HBe_P-C Product feature CHAIN KU964041_HBe_P-C of FT:mat_peptide KU964041_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964042_HBe_P-C Product feature CHAIN KU964042_HBe_P-C of FT:mat_peptide KU964042_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_9). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964043_HBe_P-C Product feature CHAIN KU964043_HBe_P-C of FT:mat_peptide KU964043_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964044_HBe_P-C Product feature CHAIN KU964044_HBe_P-C of FT:mat_peptide KU964044_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964045_HBe_P-C Product feature CHAIN KU964045_HBe_P-C of FT:mat_peptide KU964045_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964046_HBe_P-C Product feature CHAIN KU964046_HBe_P-C of FT:mat_peptide KU964046_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KU964047_HBe_P-C Product feature CHAIN KU964047_HBe_P-C of FT:mat_peptide KU964047_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964048_HBe_P-C Product feature CHAIN KU964048_HBe_P-C of FT:mat_peptide KU964048_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964049_HBe_P-C Product feature CHAIN KU964049_HBe_P-C of FT:mat_peptide KU964049_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVRSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964050_HBe_P-C Product feature CHAIN KU964050_HBe_P-C of FT:mat_peptide KU964050_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964051_HBe_P-C Product feature CHAIN KU964051_HBe_P-C of FT:mat_peptide KU964051_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964052_HBe_P-C Product feature CHAIN KU964052_HBe_P-C of FT:mat_peptide KU964052_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964053_HBe_P-C Product feature CHAIN KU964053_HBe_P-C of FT:mat_peptide KU964053_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964054_HBe_P-C Product feature CHAIN KU964054_HBe_P-C of FT:mat_peptide KU964054_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964055_HBe_P-C Product feature CHAIN KU964055_HBe_P-C of FT:mat_peptide KU964055_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964056_HBe_P-C Product feature CHAIN KU964056_HBe_P-C of FT:mat_peptide KU964056_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964057_HBe_P-C Product feature CHAIN KU964057_HBe_P-C of FT:mat_peptide KU964057_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964058_HBe_P-C Product feature CHAIN KU964058_HBe_P-C of FT:mat_peptide KU964058_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964059_HBe_P-C Product feature CHAIN KU964059_HBe_P-C of FT:mat_peptide KU964059_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964060_HBe_P-C Product feature CHAIN KU964060_HBe_P-C of FT:mat_peptide KU964060_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964061_HBe_P-C Product feature CHAIN KU964061_HBe_P-C of FT:mat_peptide KU964061_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964062_HBe_P-C Product feature CHAIN KU964062_HBe_P-C of FT:mat_peptide KU964062_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964063_HBe_P-C Product feature CHAIN KU964063_HBe_P-C of FT:mat_peptide KU964063_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964064_HBe_P-C Product feature CHAIN KU964064_HBe_P-C of FT:mat_peptide KU964064_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964065_HBe_P-C Product feature CHAIN KU964065_HBe_P-C of FT:mat_peptide KU964065_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964066_HBe_P-C Product feature CHAIN KU964066_HBe_P-C of FT:mat_peptide KU964066_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964067_HBe_P-C Product feature CHAIN KU964067_HBe_P-C of FT:mat_peptide KU964067_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964068_HBe_P-C Product feature CHAIN KU964068_HBe_P-C of FT:mat_peptide KU964068_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964069_HBe_P-C Product feature CHAIN KU964069_HBe_P-C of FT:mat_peptide KU964069_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964070_HBe_P-C Product feature CHAIN KU964070_HBe_P-C of FT:mat_peptide KU964070_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964071_HBe_P-C Product feature CHAIN KU964071_HBe_P-C of FT:mat_peptide KU964071_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964072_HBe_P-C Product feature CHAIN KU964072_HBe_P-C of FT:mat_peptide KU964072_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964073_HBe_P-C Product feature CHAIN KU964073_HBe_P-C of FT:mat_peptide KU964073_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964074_HBe_P-C Product feature CHAIN KU964074_HBe_P-C of FT:mat_peptide KU964074_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964075_HBe_P-C Product feature CHAIN KU964075_HBe_P-C of FT:mat_peptide KU964075_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964076_HBe_P-C Product feature CHAIN KU964076_HBe_P-C of FT:mat_peptide KU964076_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_13). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU964077_HBe_P-C Product feature CHAIN KU964077_HBe_P-C of FT:mat_peptide KU964077_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKITQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964078_HBe_P-C Product feature CHAIN KU964078_HBe_P-C of FT:mat_peptide KU964078_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTTLRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964176_HBe_P-C Product feature CHAIN KU964176_HBe_P-C of FT:mat_peptide KU964176_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964180_HBe_P-C Product feature CHAIN KU964180_HBe_P-C of FT:mat_peptide KU964180_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26_12). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMKLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964185_HBe_P-C Product feature CHAIN KU964185_HBe_P-C of FT:mat_peptide KU964185_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964186_HBe_P-C Product feature CHAIN KU964186_HBe_P-C of FT:mat_peptide KU964186_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964187_HBe_P-C Product feature CHAIN KU964187_HBe_P-C of FT:mat_peptide KU964187_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964188_HBe_P-C Product feature CHAIN KU964188_HBe_P-C of FT:mat_peptide KU964188_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964189_HBe_P-C Product feature CHAIN KU964189_HBe_P-C of FT:mat_peptide KU964189_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964190_HBe_P-C Product feature CHAIN KU964190_HBe_P-C of FT:mat_peptide KU964190_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964191_HBe_P-C Product feature CHAIN KU964191_HBe_P-C of FT:mat_peptide KU964191_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLXFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964192_HBe_P-C Product feature CHAIN KU964192_HBe_P-C of FT:mat_peptide KU964192_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964193_HBe_P-C Product feature CHAIN KU964193_HBe_P-C of FT:mat_peptide KU964193_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964194_HBe_P-C Product feature CHAIN KU964194_HBe_P-C of FT:mat_peptide KU964194_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964195_HBe_P-C Product feature CHAIN KU964195_HBe_P-C of FT:mat_peptide KU964195_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964196_HBe_P-C Product feature CHAIN KU964196_HBe_P-C of FT:mat_peptide KU964196_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964197_HBe_P-C Product feature CHAIN KU964197_HBe_P-C of FT:mat_peptide KU964197_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964198_HBe_P-C Product feature CHAIN KU964198_HBe_P-C of FT:mat_peptide KU964198_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964199_HBe_P-C Product feature CHAIN KU964199_HBe_P-C of FT:mat_peptide KU964199_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964200_HBe_P-C Product feature CHAIN KU964200_HBe_P-C of FT:mat_peptide KU964200_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964201_HBe_P-C Product feature CHAIN KU964201_HBe_P-C of FT:mat_peptide KU964201_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU964202_HBe_P-C Product feature CHAIN KU964202_HBe_P-C of FT:mat_peptide KU964202_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964203_HBe_P-C Product feature CHAIN KU964203_HBe_P-C of FT:mat_peptide KU964203_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964204_HBe_P-C Product feature CHAIN KU964204_HBe_P-C of FT:mat_peptide KU964204_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU964205_HBe_P-C Product feature CHAIN KU964205_HBe_P-C of FT:mat_peptide KU964205_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964206_HBe_P-C Product feature CHAIN KU964206_HBe_P-C of FT:mat_peptide KU964206_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964207_HBe_P-C Product feature CHAIN KU964207_HBe_P-C of FT:mat_peptide KU964207_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU964208_HBe_P-C Product feature CHAIN KU964208_HBe_P-C of FT:mat_peptide KU964208_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFYLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU964209_HBe_P-C Product feature CHAIN KU964209_HBe_P-C of FT:mat_peptide KU964209_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964210_HBe_P-C Product feature CHAIN KU964210_HBe_P-C of FT:mat_peptide KU964210_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU964211_HBe_P-C Product feature CHAIN KU964211_HBe_P-C of FT:mat_peptide KU964211_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU964212_HBe_P-C Product feature CHAIN KU964212_HBe_P-C of FT:mat_peptide KU964212_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964213_HBe_P-C Product feature CHAIN KU964213_HBe_P-C of FT:mat_peptide KU964213_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPTA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KU964214_HBe_P-C Product feature CHAIN KU964214_HBe_P-C of FT:mat_peptide KU964214_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KU964216_HBe_P-C Product feature CHAIN KU964216_HBe_P-C of FT:mat_peptide KU964216_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964217_HBe_P-C Product feature CHAIN KU964217_HBe_P-C of FT:mat_peptide KU964217_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964218_HBe_P-C Product feature CHAIN KU964218_HBe_P-C of FT:mat_peptide KU964218_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964220_HBe_P-C Product feature CHAIN KU964220_HBe_P-C of FT:mat_peptide KU964220_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964221_HBe_P-C Product feature CHAIN KU964221_HBe_P-C of FT:mat_peptide KU964221_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964222_HBe_P-C Product feature CHAIN KU964222_HBe_P-C of FT:mat_peptide KU964222_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964223_HBe_P-C Product feature CHAIN KU964223_HBe_P-C of FT:mat_peptide KU964223_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDLASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964224_HBe_P-C Product feature CHAIN KU964224_HBe_P-C of FT:mat_peptide KU964224_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964225_HBe_P-C Product feature CHAIN KU964225_HBe_P-C of FT:mat_peptide KU964225_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964226_HBe_P-C Product feature CHAIN KU964226_HBe_P-C of FT:mat_peptide KU964226_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964227_HBe_P-C Product feature CHAIN KU964227_HBe_P-C of FT:mat_peptide KU964227_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964228_HBe_P-C Product feature CHAIN KU964228_HBe_P-C of FT:mat_peptide KU964228_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSTRRRRSQSRESQC
>gnl|hbvpro|KU964237_HBe_P-C Product feature CHAIN KU964237_HBe_P-C of FT:mat_peptide KU964237_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVIRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964321_HBe_P-C Product feature CHAIN KU964321_HBe_P-C of FT:mat_peptide KU964321_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964323_HBe_P-C Product feature CHAIN KU964323_HBe_P-C of FT:mat_peptide KU964323_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964324_HBe_P-C Product feature CHAIN KU964324_HBe_P-C of FT:mat_peptide KU964324_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964326_HBe_P-C Product feature CHAIN KU964326_HBe_P-C of FT:mat_peptide KU964326_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964329_HBe_P-C Product feature CHAIN KU964329_HBe_P-C of FT:mat_peptide KU964329_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964332_HBe_P-C Product feature CHAIN KU964332_HBe_P-C of FT:mat_peptide KU964332_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KU964334_HBe_P-C Product feature CHAIN KU964334_HBe_P-C of FT:mat_peptide KU964334_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964336_HBe_P-C Product feature CHAIN KU964336_HBe_P-C of FT:mat_peptide KU964336_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964337_HBe_P-C Product feature CHAIN KU964337_HBe_P-C of FT:mat_peptide KU964337_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964338_HBe_P-C Product feature CHAIN KU964338_HBe_P-C of FT:mat_peptide KU964338_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964339_HBe_P-C Product feature CHAIN KU964339_HBe_P-C of FT:mat_peptide KU964339_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964340_HBe_P-C Product feature CHAIN KU964340_HBe_P-C of FT:mat_peptide KU964340_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964341_HBe_P-C Product feature CHAIN KU964341_HBe_P-C of FT:mat_peptide KU964341_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964342_HBe_P-C Product feature CHAIN KU964342_HBe_P-C of FT:mat_peptide KU964342_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964343_HBe_P-C Product feature CHAIN KU964343_HBe_P-C of FT:mat_peptide KU964343_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVVRGRIRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964344_HBe_P-C Product feature CHAIN KU964344_HBe_P-C of FT:mat_peptide KU964344_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964345_HBe_P-C Product feature CHAIN KU964345_HBe_P-C of FT:mat_peptide KU964345_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964346_HBe_P-C Product feature CHAIN KU964346_HBe_P-C of FT:mat_peptide KU964346_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964347_HBe_P-C Product feature CHAIN KU964347_HBe_P-C of FT:mat_peptide KU964347_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU964348_HBe_P-C Product feature CHAIN KU964348_HBe_P-C of FT:mat_peptide KU964348_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38_15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276840_HBe_P-C Product feature CHAIN KX276840_HBe_P-C of FT:mat_peptide KX276840_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
LQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSSH
HTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|KX276841_HBe_P-C Product feature CHAIN KX276841_HBe_P-C of FT:mat_peptide KX276841_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPH
HTALRQQILCWGELMNLATWVGGNLEDPASRDAVVSYVNVNMGLKLRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|KX276844_HBe_P-C Product feature CHAIN KX276844_HBe_P-C of FT:mat_peptide KX276844_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLXWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCXPH
HTALRQAILCWGELMNLATWVGSNLXDPGSREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWMRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX276846_HBe_P-C Product feature CHAIN KX276846_HBe_P-C of FT:mat_peptide KX276846_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWNMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALFREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPAA
YRPANAPILSTLPETTVVRGRGRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276851_HBe_P-C Product feature CHAIN KX276851_HBe_P-C of FT:mat_peptide KX276851_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPTIRDLLDTASALYREALESPEHCTPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276852_HBe_P-C Product feature CHAIN KX276852_HBe_P-C of FT:mat_peptide KX276852_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSXH
HTALRQAIVCWGELXNLATWVGSNLEDPASRELVVGYVNXNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276853_HBe_P-C Product feature CHAIN KX276853_HBe_P-C of FT:mat_peptide KX276853_HBe_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASXXLLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGXNLBDQASRELVVXYVNVNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPETTVXRGRGRSPRRRTPSPRRRRSQSPRRRRSXSRXSQC
>gnl|hbvpro|KX765818_HBe_P-C Product feature CHAIN KX765818_HBe_P-C of FT:mat_peptide KX765818_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0022). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765819_HBe_P-C Product feature CHAIN KX765819_HBe_P-C of FT:mat_peptide KX765819_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0076). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765820_HBe_P-C Product feature CHAIN KX765820_HBe_P-C of FT:mat_peptide KX765820_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0142). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765821_HBe_P-C Product feature CHAIN KX765821_HBe_P-C of FT:mat_peptide KX765821_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0211). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765822_HBe_P-C Product feature CHAIN KX765822_HBe_P-C of FT:mat_peptide KX765822_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0265). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765823_HBe_P-C Product feature CHAIN KX765823_HBe_P-C of FT:mat_peptide KX765823_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0274). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765824_HBe_P-C Product feature CHAIN KX765824_HBe_P-C of FT:mat_peptide KX765824_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0307). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765825_HBe_P-C Product feature CHAIN KX765825_HBe_P-C of FT:mat_peptide KX765825_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0313). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765826_HBe_P-C Product feature CHAIN KX765826_HBe_P-C of FT:mat_peptide KX765826_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0349). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765827_HBe_P-C Product feature CHAIN KX765827_HBe_P-C of FT:mat_peptide KX765827_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0387). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765828_HBe_P-C Product feature CHAIN KX765828_HBe_P-C of FT:mat_peptide KX765828_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0496). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765829_HBe_P-C Product feature CHAIN KX765829_HBe_P-C of FT:mat_peptide KX765829_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0502). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRESLESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765830_HBe_P-C Product feature CHAIN KX765830_HBe_P-C of FT:mat_peptide KX765830_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0625). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765831_HBe_P-C Product feature CHAIN KX765831_HBe_P-C of FT:mat_peptide KX765831_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0636). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765832_HBe_P-C Product feature CHAIN KX765832_HBe_P-C of FT:mat_peptide KX765832_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0647). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765833_HBe_P-C Product feature CHAIN KX765833_HBe_P-C of FT:mat_peptide KX765833_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0657). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765834_HBe_P-C Product feature CHAIN KX765834_HBe_P-C of FT:mat_peptide KX765834_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0675). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765836_HBe_P-C Product feature CHAIN KX765836_HBe_P-C of FT:mat_peptide KX765836_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0861). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765837_HBe_P-C Product feature CHAIN KX765837_HBe_P-C of FT:mat_peptide KX765837_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0931). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765838_HBe_P-C Product feature CHAIN KX765838_HBe_P-C of FT:mat_peptide KX765838_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0940). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765839_HBe_P-C Product feature CHAIN KX765839_HBe_P-C of FT:mat_peptide KX765839_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1024). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRHRRSQSRESQC
>gnl|hbvpro|KX765840_HBe_P-C Product feature CHAIN KX765840_HBe_P-C of FT:mat_peptide KX765840_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1070). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765842_HBe_P-C Product feature CHAIN KX765842_HBe_P-C of FT:mat_peptide KX765842_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1093). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765843_HBe_P-C Product feature CHAIN KX765843_HBe_P-C of FT:mat_peptide KX765843_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1119). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765844_HBe_P-C Product feature CHAIN KX765844_HBe_P-C of FT:mat_peptide KX765844_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1157). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765845_HBe_P-C Product feature CHAIN KX765845_HBe_P-C of FT:mat_peptide KX765845_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1359). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765846_HBe_P-C Product feature CHAIN KX765846_HBe_P-C of FT:mat_peptide KX765846_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1395). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765847_HBe_P-C Product feature CHAIN KX765847_HBe_P-C of FT:mat_peptide KX765847_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1406). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765848_HBe_P-C Product feature CHAIN KX765848_HBe_P-C of FT:mat_peptide KX765848_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1422). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765849_HBe_P-C Product feature CHAIN KX765849_HBe_P-C of FT:mat_peptide KX765849_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1456). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPXNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765850_HBe_P-C Product feature CHAIN KX765850_HBe_P-C of FT:mat_peptide KX765850_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1480). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765851_HBe_P-C Product feature CHAIN KX765851_HBe_P-C of FT:mat_peptide KX765851_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1520). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765852_HBe_P-C Product feature CHAIN KX765852_HBe_P-C of FT:mat_peptide KX765852_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:1550). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765853_HBe_P-C Product feature CHAIN KX765853_HBe_P-C of FT:mat_peptide KX765853_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:9005). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX765855_HBe_P-C Product feature CHAIN KX765855_HBe_P-C of FT:mat_peptide KX765855_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:9192). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX774503_HBe_P-C Product feature CHAIN KX774503_HBe_P-C of FT:mat_peptide KX774503_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0080). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=209 residues).
FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTA
LRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRP
PNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX774504_HBe_P-C Product feature CHAIN KX774504_HBe_P-C of FT:mat_peptide KX774504_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0277). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=209 residues).
FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTA
LRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRP
PNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX774506_HBe_P-C Product feature CHAIN KX774506_HBe_P-C of FT:mat_peptide KX774506_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PID:0458). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY022423_HBe_P-C Product feature CHAIN KY022423_HBe_P-C of FT:mat_peptide KY022423_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSK0528). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY363256_HBe_P-C Product feature CHAIN KY363256_HBe_P-C of FT:mat_peptide KY363256_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno3.5). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSSLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KY363257_HBe_P-C Product feature CHAIN KY363257_HBe_P-C of FT:mat_peptide KY363257_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno3.6). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KY363266_HBe_P-C Product feature CHAIN KY363266_HBe_P-C of FT:mat_peptide KY363266_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno8.3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRKALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY363267_HBe_P-C Product feature CHAIN KY363267_HBe_P-C of FT:mat_peptide KY363267_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno8.4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPGRRTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KY363274_HBe_P-C Product feature CHAIN KY363274_HBe_P-C of FT:mat_peptide KY363274_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno14.2). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQCRESQC
>gnl|hbvpro|KY363275_HBe_P-C Product feature CHAIN KY363275_HBe_P-C of FT:mat_peptide KY363275_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno14.3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDLDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPH
HTALRQAIVCWGELMNLATWVESNLEDPASRGLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRSPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KY363276_HBe_P-C Product feature CHAIN KY363276_HBe_P-C of FT:mat_peptide KY363276_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno15.3). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY363277_HBe_P-C Product feature CHAIN KY363277_HBe_P-C of FT:mat_peptide KY363277_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno15.5). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLPFLPSDFFPSIRDLLDTASALSREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KY363278_HBe_P-C Product feature CHAIN KY363278_HBe_P-C of FT:mat_peptide KY363278_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno16.1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KY363279_HBe_P-C Product feature CHAIN KY363279_HBe_P-C of FT:mat_peptide KY363279_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno16.3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KY363281_HBe_P-C Product feature CHAIN KY363281_HBe_P-C of FT:mat_peptide KY363281_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno17.4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY363284_HBe_P-C Product feature CHAIN KY363284_HBe_P-C of FT:mat_peptide KY363284_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate geno19.1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLRGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470873_HBe_P-C Product feature CHAIN KY470873_HBe_P-C of FT:mat_peptide KY470873_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLWWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470874_HBe_P-C Product feature CHAIN KY470874_HBe_P-C of FT:mat_peptide KY470874_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGQKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470875_HBe_P-C Product feature CHAIN KY470875_HBe_P-C of FT:mat_peptide KY470875_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLSWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470876_HBe_P-C Product feature CHAIN KY470876_HBe_P-C of FT:mat_peptide KY470876_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-15). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470878_HBe_P-C Product feature CHAIN KY470878_HBe_P-C of FT:mat_peptide KY470878_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470879_HBe_P-C Product feature CHAIN KY470879_HBe_P-C of FT:mat_peptide KY470879_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-21). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470880_HBe_P-C Product feature CHAIN KY470880_HBe_P-C of FT:mat_peptide KY470880_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-23). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470881_HBe_P-C Product feature CHAIN KY470881_HBe_P-C of FT:mat_peptide KY470881_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470882_HBe_P-C Product feature CHAIN KY470882_HBe_P-C of FT:mat_peptide KY470882_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470883_HBe_P-C Product feature CHAIN KY470883_HBe_P-C of FT:mat_peptide KY470883_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470884_HBe_P-C Product feature CHAIN KY470884_HBe_P-C of FT:mat_peptide KY470884_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470885_HBe_P-C Product feature CHAIN KY470885_HBe_P-C of FT:mat_peptide KY470885_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-G06). Complete genome. [Hepadnaviridae] (length=213 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQCW
>gnl|hbvpro|KY470886_HBe_P-C Product feature CHAIN KY470886_HBe_P-C of FT:mat_peptide KY470886_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-G07). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSRSRESQC
>gnl|hbvpro|KY470887_HBe_P-C Product feature CHAIN KY470887_HBe_P-C of FT:mat_peptide KY470887_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-G09). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHIPCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470888_HBe_P-C Product feature CHAIN KY470888_HBe_P-C of FT:mat_peptide KY470888_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-G10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSRSRESQC
>gnl|hbvpro|KY470889_HBe_P-C Product feature CHAIN KY470889_HBe_P-C of FT:mat_peptide KY470889_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-H03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470890_HBe_P-C Product feature CHAIN KY470890_HBe_P-C of FT:mat_peptide KY470890_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-H07). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470891_HBe_P-C Product feature CHAIN KY470891_HBe_P-C of FT:mat_peptide KY470891_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-H09). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470892_HBe_P-C Product feature CHAIN KY470892_HBe_P-C of FT:mat_peptide KY470892_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23-H12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470894_HBe_P-C Product feature CHAIN KY470894_HBe_P-C of FT:mat_peptide KY470894_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-B3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470895_HBe_P-C Product feature CHAIN KY470895_HBe_P-C of FT:mat_peptide KY470895_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-B5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470896_HBe_P-C Product feature CHAIN KY470896_HBe_P-C of FT:mat_peptide KY470896_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-B9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRGTVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470897_HBe_P-C Product feature CHAIN KY470897_HBe_P-C of FT:mat_peptide KY470897_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-C04). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470899_HBe_P-C Product feature CHAIN KY470899_HBe_P-C of FT:mat_peptide KY470899_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-C10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470900_HBe_P-C Product feature CHAIN KY470900_HBe_P-C of FT:mat_peptide KY470900_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-C2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLRLGWLWGMDVDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YGPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470901_HBe_P-C Product feature CHAIN KY470901_HBe_P-C of FT:mat_peptide KY470901_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-D02). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470902_HBe_P-C Product feature CHAIN KY470902_HBe_P-C of FT:mat_peptide KY470902_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-D05). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470903_HBe_P-C Product feature CHAIN KY470903_HBe_P-C of FT:mat_peptide KY470903_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-D06). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470904_HBe_P-C Product feature CHAIN KY470904_HBe_P-C of FT:mat_peptide KY470904_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-D07). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470905_HBe_P-C Product feature CHAIN KY470905_HBe_P-C of FT:mat_peptide KY470905_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24-D12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470906_HBe_P-C Product feature CHAIN KY470906_HBe_P-C of FT:mat_peptide KY470906_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470907_HBe_P-C Product feature CHAIN KY470907_HBe_P-C of FT:mat_peptide KY470907_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470908_HBe_P-C Product feature CHAIN KY470908_HBe_P-C of FT:mat_peptide KY470908_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-17). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVDVNMGLNIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPSA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470909_HBe_P-C Product feature CHAIN KY470909_HBe_P-C of FT:mat_peptide KY470909_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-18). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470910_HBe_P-C Product feature CHAIN KY470910_HBe_P-C of FT:mat_peptide KY470910_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALGQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470911_HBe_P-C Product feature CHAIN KY470911_HBe_P-C of FT:mat_peptide KY470911_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-22). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSA
YRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470912_HBe_P-C Product feature CHAIN KY470912_HBe_P-C of FT:mat_peptide KY470912_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-23). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470913_HBe_P-C Product feature CHAIN KY470913_HBe_P-C of FT:mat_peptide KY470913_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFYLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGVLMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470914_HBe_P-C Product feature CHAIN KY470914_HBe_P-C of FT:mat_peptide KY470914_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470915_HBe_P-C Product feature CHAIN KY470915_HBe_P-C of FT:mat_peptide KY470915_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470916_HBe_P-C Product feature CHAIN KY470916_HBe_P-C of FT:mat_peptide KY470916_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAFLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470917_HBe_P-C Product feature CHAIN KY470917_HBe_P-C of FT:mat_peptide KY470917_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-9). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470918_HBe_P-C Product feature CHAIN KY470918_HBe_P-C of FT:mat_peptide KY470918_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-A07). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGVSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470920_HBe_P-C Product feature CHAIN KY470920_HBe_P-C of FT:mat_peptide KY470920_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-G10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470925_HBe_P-C Product feature CHAIN KY470925_HBe_P-C of FT:mat_peptide KY470925_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CFQ-116). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFRASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRCRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470929_HBe_P-C Product feature CHAIN KY470929_HBe_P-C of FT:mat_peptide KY470929_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CFQ-122). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470933_HBe_P-C Product feature CHAIN KY470933_HBe_P-C of FT:mat_peptide KY470933_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CFQ-22). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470934_HBe_P-C Product feature CHAIN KY470934_HBe_P-C of FT:mat_peptide KY470934_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CFQ-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYWEALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470936_HBe_P-C Product feature CHAIN KY470936_HBe_P-C of FT:mat_peptide KY470936_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KXY-10). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470937_HBe_P-C Product feature CHAIN KY470937_HBe_P-C of FT:mat_peptide KY470937_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KXY-11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYQEALESPEHCSPH
HTALRQAILCCGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISYLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSRSRESQC
>gnl|hbvpro|KY470965_HBe_P-C Product feature CHAIN KY470965_HBe_P-C of FT:mat_peptide KY470965_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYSVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470966_HBe_P-C Product feature CHAIN KY470966_HBe_P-C of FT:mat_peptide KY470966_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-102). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASGELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470967_HBe_P-C Product feature CHAIN KY470967_HBe_P-C of FT:mat_peptide KY470967_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-103). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVSMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470968_HBe_P-C Product feature CHAIN KY470968_HBe_P-C of FT:mat_peptide KY470968_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-104). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470969_HBe_P-C Product feature CHAIN KY470969_HBe_P-C of FT:mat_peptide KY470969_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-105). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYSVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470970_HBe_P-C Product feature CHAIN KY470970_HBe_P-C of FT:mat_peptide KY470970_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-107). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470971_HBe_P-C Product feature CHAIN KY470971_HBe_P-C of FT:mat_peptide KY470971_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFSPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470972_HBe_P-C Product feature CHAIN KY470972_HBe_P-C of FT:mat_peptide KY470972_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-14). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFSPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470973_HBe_P-C Product feature CHAIN KY470973_HBe_P-C of FT:mat_peptide KY470973_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-19). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470974_HBe_P-C Product feature CHAIN KY470974_HBe_P-C of FT:mat_peptide KY470974_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYSVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470975_HBe_P-C Product feature CHAIN KY470975_HBe_P-C of FT:mat_peptide KY470975_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-21). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPADFFPSIRDLLDTASALYRGALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSRSPRRRRSQSRGSQC
>gnl|hbvpro|KY470976_HBe_P-C Product feature CHAIN KY470976_HBe_P-C of FT:mat_peptide KY470976_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-23). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRGSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470977_HBe_P-C Product feature CHAIN KY470977_HBe_P-C of FT:mat_peptide KY470977_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470978_HBe_P-C Product feature CHAIN KY470978_HBe_P-C of FT:mat_peptide KY470978_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPAPRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470979_HBe_P-C Product feature CHAIN KY470979_HBe_P-C of FT:mat_peptide KY470979_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WR-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KY470980_HBe_P-C Product feature CHAIN KY470980_HBe_P-C of FT:mat_peptide KY470980_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-101). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470981_HBe_P-C Product feature CHAIN KY470981_HBe_P-C of FT:mat_peptide KY470981_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-103). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470982_HBe_P-C Product feature CHAIN KY470982_HBe_P-C of FT:mat_peptide KY470982_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-104). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470983_HBe_P-C Product feature CHAIN KY470983_HBe_P-C of FT:mat_peptide KY470983_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470984_HBe_P-C Product feature CHAIN KY470984_HBe_P-C of FT:mat_peptide KY470984_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470985_HBe_P-C Product feature CHAIN KY470985_HBe_P-C of FT:mat_peptide KY470985_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-23). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470986_HBe_P-C Product feature CHAIN KY470986_HBe_P-C of FT:mat_peptide KY470986_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-24). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470987_HBe_P-C Product feature CHAIN KY470987_HBe_P-C of FT:mat_peptide KY470987_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-28). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470988_HBe_P-C Product feature CHAIN KY470988_HBe_P-C of FT:mat_peptide KY470988_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470990_HBe_P-C Product feature CHAIN KY470990_HBe_P-C of FT:mat_peptide KY470990_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-7). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY470991_HBe_P-C Product feature CHAIN KY470991_HBe_P-C of FT:mat_peptide KY470991_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XDH-8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY629631_HBe_P-C Product feature CHAIN KY629631_HBe_P-C of FT:mat_peptide KY629631_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TYM03015). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY629637_HBe_P-C Product feature CHAIN KY629637_HBe_P-C of FT:mat_peptide KY629637_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TYM03049). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY670782_HBe_P-C Product feature CHAIN KY670782_HBe_P-C of FT:mat_peptide KY670782_HBe_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TYM03101). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVR