HBVdb

Dataset for protein HBx of genotype C

[Download (right click)] [Alignment] [Repertoires]

3265 sequence(s)

>gnl|hbvpro|AB014360_HBx_P-C Product feature CHAIN AB014360_HBx_P-C of FT:mat_peptide AB014360_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D01HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQVLPKLLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014361_HBx_P-C Product feature CHAIN AB014361_HBx_P-C of FT:mat_peptide AB014361_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 02D02HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014362_HBx_P-C Product feature CHAIN AB014362_HBx_P-C of FT:mat_peptide AB014362_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 03D03HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014363_HBx_P-C Product feature CHAIN AB014363_HBx_P-C of FT:mat_peptide AB014363_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04D04HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014364_HBx_P-C Product feature CHAIN AB014364_HBx_P-C of FT:mat_peptide AB014364_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 05D05HCC). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014365_HBx_P-C Product feature CHAIN AB014365_HBx_P-C of FT:mat_peptide AB014365_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D06HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDLARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014367_HBx_P-C Product feature CHAIN AB014367_HBx_P-C of FT:mat_peptide AB014367_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08D08HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014368_HBx_P-C Product feature CHAIN AB014368_HBx_P-C of FT:mat_peptide AB014368_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09D09HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014369_HBx_P-C Product feature CHAIN AB014369_HBx_P-C of FT:mat_peptide AB014369_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10D10HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014371_HBx_P-C Product feature CHAIN AB014371_HBx_P-C of FT:mat_peptide AB014371_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 12D12HCC). Complete genome. [Hepadnaviridae] (length=156 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
METTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014372_HBx_P-C Product feature CHAIN AB014372_HBx_P-C of FT:mat_peptide AB014372_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13D13HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014374_HBx_P-C Product feature CHAIN AB014374_HBx_P-C of FT:mat_peptide AB014374_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 15D15HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014376_HBx_P-C Product feature CHAIN AB014376_HBx_P-C of FT:mat_peptide AB014376_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17T02HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014377_HBx_P-C Product feature CHAIN AB014377_HBx_P-C of FT:mat_peptide AB014377_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18T03HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLXKRTLGLSAMSTTDLEAYFKNCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014378_HBx_P-C Product feature CHAIN AB014378_HBx_P-C of FT:mat_peptide AB014378_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19Y01HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014379_HBx_P-C Product feature CHAIN AB014379_HBx_P-C of FT:mat_peptide AB014379_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 20Y02HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014380_HBx_P-C Product feature CHAIN AB014380_HBx_P-C of FT:mat_peptide AB014380_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 21Y03HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014381_HBx_P-C Product feature CHAIN AB014381_HBx_P-C of FT:mat_peptide AB014381_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 22Y04HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014382_HBx_P-C Product feature CHAIN AB014382_HBx_P-C of FT:mat_peptide AB014382_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23Y05HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014383_HBx_P-C Product feature CHAIN AB014383_HBx_P-C of FT:mat_peptide AB014383_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24Y06HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014384_HBx_P-C Product feature CHAIN AB014384_HBx_P-C of FT:mat_peptide AB014384_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 25Y07HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLRLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014385_HBx_P-C Product feature CHAIN AB014385_HBx_P-C of FT:mat_peptide AB014385_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26Y08HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014386_HBx_P-C Product feature CHAIN AB014386_HBx_P-C of FT:mat_peptide AB014386_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 27Y09HCC). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014387_HBx_P-C Product feature CHAIN AB014387_HBx_P-C of FT:mat_peptide AB014387_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28Y10HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGHLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014388_HBx_P-C Product feature CHAIN AB014388_HBx_P-C of FT:mat_peptide AB014388_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29Y11HCC). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVRCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014389_HBx_P-C Product feature CHAIN AB014389_HBx_P-C of FT:mat_peptide AB014389_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30Y12HCC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014390_HBx_P-C Product feature CHAIN AB014390_HBx_P-C of FT:mat_peptide AB014390_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 31Y13HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSTAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014391_HBx_P-C Product feature CHAIN AB014391_HBx_P-C of FT:mat_peptide AB014391_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 32Y14HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGSLPSPPSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014392_HBx_P-C Product feature CHAIN AB014392_HBx_P-C of FT:mat_peptide AB014392_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 33Y15HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014393_HBx_P-C Product feature CHAIN AB014393_HBx_P-C of FT:mat_peptide AB014393_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 34Y16HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPEPCNFFTSA
>gnl|hbvpro|AB014394_HBx_P-C Product feature CHAIN AB014394_HBx_P-C of FT:mat_peptide AB014394_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35Y17HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014395_HBx_P-C Product feature CHAIN AB014395_HBx_P-C of FT:mat_peptide AB014395_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 36Y18HCC). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014396_HBx_P-C Product feature CHAIN AB014396_HBx_P-C of FT:mat_peptide AB014396_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37Y19HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIYVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AB014397_HBx_P-C Product feature CHAIN AB014397_HBx_P-C of FT:mat_peptide AB014397_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38Y20HCC). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQLLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014398_HBx_P-C Product feature CHAIN AB014398_HBx_P-C of FT:mat_peptide AB014398_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 39Y21HCC). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB014399_HBx_P-C Product feature CHAIN AB014399_HBx_P-C of FT:mat_peptide AB014399_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 40Y22HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB026811_HBx_P-C Product feature CHAIN AB026811_HBx_P-C of FT:mat_peptide AB026811_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Feb.). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB026812_HBx_P-C Product feature CHAIN AB026812_HBx_P-C of FT:mat_peptide AB026812_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;98.May). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB026813_HBx_P-C Product feature CHAIN AB026813_HBx_P-C of FT:mat_peptide AB026813_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Sep.). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB026814_HBx_P-C Product feature CHAIN AB026814_HBx_P-C of FT:mat_peptide AB026814_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Donor 3;98.May). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB026815_HBx_P-C Product feature CHAIN AB026815_HBx_P-C of FT:mat_peptide AB026815_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 2:full). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB031262_HBx_P-C Product feature CHAIN AB031262_HBx_P-C of FT:mat_peptide AB031262_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV VietA-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033550_HBx_P-C Product feature CHAIN AB033550_HBx_P-C of FT:mat_peptide AB033550_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NDR260). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033551_HBx_P-C Product feature CHAIN AB033551_HBx_P-C of FT:mat_peptide AB033551_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK300). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033552_HBx_P-C Product feature CHAIN AB033552_HBx_P-C of FT:mat_peptide AB033552_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK494). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033553_HBx_P-C Product feature CHAIN AB033553_HBx_P-C of FT:mat_peptide AB033553_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK619). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB033556_HBx_P-C Product feature CHAIN AB033556_HBx_P-C of FT:mat_peptide AB033556_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AK66). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB042282_HBx_P-C Product feature CHAIN AB042282_HBx_P-C of FT:mat_peptide AB042282_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB042283_HBx_P-C Product feature CHAIN AB042283_HBx_P-C of FT:mat_peptide AB042283_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB042284_HBx_P-C Product feature CHAIN AB042284_HBx_P-C of FT:mat_peptide AB042284_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB042285_HBx_P-C Product feature CHAIN AB042285_HBx_P-C of FT:mat_peptide AB042285_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKEWEELGEETRLKVFVLGGCRHKLVCSPAPRNFFTSA
>gnl|hbvpro|AB049610_HBx_P-C Product feature CHAIN AB049610_HBx_P-C of FT:mat_peptide AB049610_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV AN29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPADHGAHLSVRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEENRLKVFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AB050018_HBx_P-C Product feature CHAIN AB050018_HBx_P-C of FT:mat_peptide AB050018_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB074047_HBx_P-C Product feature CHAIN AB074047_HBx_P-C of FT:mat_peptide AB074047_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPFGTLPSPSSSAVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB074755_HBx_P-C Product feature CHAIN AB074755_HBx_P-C of FT:mat_peptide AB074755_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB074756_HBx_P-C Product feature CHAIN AB074756_HBx_P-C of FT:mat_peptide AB074756_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB104892_HBx_P-C Product feature CHAIN AB104892_HBx_P-C of FT:mat_peptide AB104892_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVIGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB105173_HBx_P-C Product feature CHAIN AB105173_HBx_P-C of FT:mat_peptide AB105173_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB105174_HBx_P-C Product feature CHAIN AB105174_HBx_P-C of FT:mat_peptide AB105174_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB106895_HBx_P-C Product feature CHAIN AB106895_HBx_P-C of FT:mat_peptide AB106895_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pHB4-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKFVCSPAPCNFFTSA
>gnl|hbvpro|AB111112_HBx_P-C Product feature CHAIN AB111112_HBx_P-C of FT:mat_peptide AB111112_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111113_HBx_P-C Product feature CHAIN AB111113_HBx_P-C of FT:mat_peptide AB111113_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCAFRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFQDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111114_HBx_P-C Product feature CHAIN AB111114_HBx_P-C of FT:mat_peptide AB111114_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111115_HBx_P-C Product feature CHAIN AB111115_HBx_P-C of FT:mat_peptide AB111115_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111116_HBx_P-C Product feature CHAIN AB111116_HBx_P-C of FT:mat_peptide AB111116_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111117_HBx_P-C Product feature CHAIN AB111117_HBx_P-C of FT:mat_peptide AB111117_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111118_HBx_P-C Product feature CHAIN AB111118_HBx_P-C of FT:mat_peptide AB111118_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111119_HBx_P-C Product feature CHAIN AB111119_HBx_P-C of FT:mat_peptide AB111119_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111120_HBx_P-C Product feature CHAIN AB111120_HBx_P-C of FT:mat_peptide AB111120_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111121_HBx_P-C Product feature CHAIN AB111121_HBx_P-C of FT:mat_peptide AB111121_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111122_HBx_P-C Product feature CHAIN AB111122_HBx_P-C of FT:mat_peptide AB111122_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111123_HBx_P-C Product feature CHAIN AB111123_HBx_P-C of FT:mat_peptide AB111123_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111124_HBx_P-C Product feature CHAIN AB111124_HBx_P-C of FT:mat_peptide AB111124_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111125_HBx_P-C Product feature CHAIN AB111125_HBx_P-C of FT:mat_peptide AB111125_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB111946_HBx_P-C Product feature CHAIN AB111946_HBx_P-C of FT:mat_peptide AB111946_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLCLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB112063_HBx_P-C Product feature CHAIN AB112063_HBx_P-C of FT:mat_peptide AB112063_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGAFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDRVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB112065_HBx_P-C Product feature CHAIN AB112065_HBx_P-C of FT:mat_peptide AB112065_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT140). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPCSSAVPADHGVHLSLRGLPVCAFSSAGPCALRFTTARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB112066_HBx_P-C Product feature CHAIN AB112066_HBx_P-C of FT:mat_peptide AB112066_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY624). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGIPVCACSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMILVLRGCRHKLACSPTPCNFFTSA
>gnl|hbvpro|AB112348_HBx_P-C Product feature CHAIN AB112348_HBx_P-C of FT:mat_peptide AB112348_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY656). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLGAHHDLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB112408_HBx_P-C Product feature CHAIN AB112408_HBx_P-C of FT:mat_peptide AB112408_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY683). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLNSS
>gnl|hbvpro|AB112471_HBx_P-C Product feature CHAIN AB112471_HBx_P-C of FT:mat_peptide AB112471_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH123). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB112472_HBx_P-C Product feature CHAIN AB112472_HBx_P-C of FT:mat_peptide AB112472_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH124). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPGALRYTSARGME
TTVNARQVLPKALHKRTLGLSAMSTTDLEAYFKDCVFKDWEEMGEETRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB113875_HBx_P-C Product feature CHAIN AB113875_HBx_P-C of FT:mat_peptide AB113875_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB113876_HBx_P-C Product feature CHAIN AB113876_HBx_P-C of FT:mat_peptide AB113876_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB113877_HBx_P-C Product feature CHAIN AB113877_HBx_P-C of FT:mat_peptide AB113877_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB113878_HBx_P-C Product feature CHAIN AB113878_HBx_P-C of FT:mat_peptide AB113878_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCYFFTFA
>gnl|hbvpro|AB113879_HBx_P-C Product feature CHAIN AB113879_HBx_P-C of FT:mat_peptide AB113879_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSAAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB115417_HBx_P-C Product feature CHAIN AB115417_HBx_P-C of FT:mat_peptide AB115417_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-O47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPTRDVLCLRPVGAESRGRPVSRPFGPLSSPSWSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFLNSA
>gnl|hbvpro|AB115418_HBx_P-C Product feature CHAIN AB115418_HBx_P-C of FT:mat_peptide AB115418_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-O55). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELRKEIRLKIFVLGGCRHKLYCSQAPCNFFPSA
>gnl|hbvpro|AB117758_HBx_P-C Product feature CHAIN AB117758_HBx_P-C of FT:mat_peptide AB117758_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CB10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRMMVFVLGGCTHTLVCSPAPCNFFTSA
>gnl|hbvpro|AB176642_HBx_P-C Product feature CHAIN AB176642_HBx_P-C of FT:mat_peptide AB176642_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-115). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSXSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB182589_HBx_P-C Product feature CHAIN AB182589_HBx_P-C of FT:mat_peptide AB182589_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CH:Mat-Ko). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195930_HBx_P-C Product feature CHAIN AB195930_HBx_P-C of FT:mat_peptide AB195930_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCYFFTSA
>gnl|hbvpro|AB195931_HBx_P-C Product feature CHAIN AB195931_HBx_P-C of FT:mat_peptide AB195931_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAVPADHGAHLSLRGLPICAFSSAGPCALRFTSVRRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCYFFTSA
>gnl|hbvpro|AB195932_HBx_P-C Product feature CHAIN AB195932_HBx_P-C of FT:mat_peptide AB195932_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAVPADHGAHLSLRGLPICAFSSAGPCALRFTSVRRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCYFFTSA
>gnl|hbvpro|AB195936_HBx_P-C Product feature CHAIN AB195936_HBx_P-C of FT:mat_peptide AB195936_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195937_HBx_P-C Product feature CHAIN AB195937_HBx_P-C of FT:mat_peptide AB195937_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195938_HBx_P-C Product feature CHAIN AB195938_HBx_P-C of FT:mat_peptide AB195938_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195942_HBx_P-C Product feature CHAIN AB195942_HBx_P-C of FT:mat_peptide AB195942_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195943_HBx_P-C Product feature CHAIN AB195943_HBx_P-C of FT:mat_peptide AB195943_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195944_HBx_P-C Product feature CHAIN AB195944_HBx_P-C of FT:mat_peptide AB195944_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195945_HBx_P-C Product feature CHAIN AB195945_HBx_P-C of FT:mat_peptide AB195945_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|AB195946_HBx_P-C Product feature CHAIN AB195946_HBx_P-C of FT:mat_peptide AB195946_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPGPCNFFTSA
>gnl|hbvpro|AB195947_HBx_P-C Product feature CHAIN AB195947_HBx_P-C of FT:mat_peptide AB195947_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195948_HBx_P-C Product feature CHAIN AB195948_HBx_P-C of FT:mat_peptide AB195948_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195949_HBx_P-C Product feature CHAIN AB195949_HBx_P-C of FT:mat_peptide AB195949_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARSME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195952_HBx_P-C Product feature CHAIN AB195952_HBx_P-C of FT:mat_peptide AB195952_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSCSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195953_HBx_P-C Product feature CHAIN AB195953_HBx_P-C of FT:mat_peptide AB195953_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSCSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB195954_HBx_P-C Product feature CHAIN AB195954_HBx_P-C of FT:mat_peptide AB195954_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSCSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB198076_HBx_P-C Product feature CHAIN AB198076_HBx_P-C of FT:mat_peptide AB198076_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVAGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB198077_HBx_P-C Product feature CHAIN AB198077_HBx_P-C of FT:mat_peptide AB198077_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB198078_HBx_P-C Product feature CHAIN AB198078_HBx_P-C of FT:mat_peptide AB198078_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB198079_HBx_P-C Product feature CHAIN AB198079_HBx_P-C of FT:mat_peptide AB198079_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB198080_HBx_P-C Product feature CHAIN AB198080_HBx_P-C of FT:mat_peptide AB198080_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|AB198081_HBx_P-C Product feature CHAIN AB198081_HBx_P-C of FT:mat_peptide AB198081_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB198082_HBx_P-C Product feature CHAIN AB198082_HBx_P-C of FT:mat_peptide AB198082_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB198083_HBx_P-C Product feature CHAIN AB198083_HBx_P-C of FT:mat_peptide AB198083_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB202071_HBx_P-C Product feature CHAIN AB202071_HBx_P-C of FT:mat_peptide AB202071_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB202072_HBx_P-C Product feature CHAIN AB202072_HBx_P-C of FT:mat_peptide AB202072_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205123_HBx_P-C Product feature CHAIN AB205123_HBx_P-C of FT:mat_peptide AB205123_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CN578-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGAIPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205124_HBx_P-C Product feature CHAIN AB205124_HBx_P-C of FT:mat_peptide AB205124_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TJ3-1-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB205125_HBx_P-C Product feature CHAIN AB205125_HBx_P-C of FT:mat_peptide AB205125_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VH34-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB222714_HBx_P-C Product feature CHAIN AB222714_HBx_P-C of FT:mat_peptide AB222714_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB222715_HBx_P-C Product feature CHAIN AB222715_HBx_P-C of FT:mat_peptide AB222715_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7M). Complete genome. [Hepadnaviridae] (length=154 residues).
HAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB241110_HBx_P-C Product feature CHAIN AB241110_HBx_P-C of FT:mat_peptide AB241110_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC03). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AB241111_HBx_P-C Product feature CHAIN AB241111_HBx_P-C of FT:mat_peptide AB241111_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AB241112_HBx_P-C Product feature CHAIN AB241112_HBx_P-C of FT:mat_peptide AB241112_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhHCC15). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AB241113_HBx_P-C Product feature CHAIN AB241113_HBx_P-C of FT:mat_peptide AB241113_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhHCC13). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AB246344_HBx_P-C Product feature CHAIN AB246344_HBx_P-C of FT:mat_peptide AB246344_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246345_HBx_P-C Product feature CHAIN AB246345_HBx_P-C of FT:mat_peptide AB246345_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB246346_HBx_P-C Product feature CHAIN AB246346_HBx_P-C of FT:mat_peptide AB246346_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB247916_HBx_P-C Product feature CHAIN AB247916_HBx_P-C of FT:mat_peptide AB247916_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDILCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB250109_HBx_P-C Product feature CHAIN AB250109_HBx_P-C of FT:mat_peptide AB250109_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IH030213). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB288026_HBx_P-C Product feature CHAIN AB288026_HBx_P-C of FT:mat_peptide AB288026_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGNLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB298720_HBx_P-C Product feature CHAIN AB298720_HBx_P-C of FT:mat_peptide AB298720_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1S). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB298721_HBx_P-C Product feature CHAIN AB298721_HBx_P-C of FT:mat_peptide AB298721_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1C). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB299858_HBx_P-C Product feature CHAIN AB299858_HBx_P-C of FT:mat_peptide AB299858_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300359_HBx_P-C Product feature CHAIN AB300359_HBx_P-C of FT:mat_peptide AB300359_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300360_HBx_P-C Product feature CHAIN AB300360_HBx_P-C of FT:mat_peptide AB300360_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300361_HBx_P-C Product feature CHAIN AB300361_HBx_P-C of FT:mat_peptide AB300361_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300362_HBx_P-C Product feature CHAIN AB300362_HBx_P-C of FT:mat_peptide AB300362_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESSGRPVSGPLGPLPSPTSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300363_HBx_P-C Product feature CHAIN AB300363_HBx_P-C of FT:mat_peptide AB300363_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300365_HBx_P-C Product feature CHAIN AB300365_HBx_P-C of FT:mat_peptide AB300365_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300368_HBx_P-C Product feature CHAIN AB300368_HBx_P-C of FT:mat_peptide AB300368_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300372_HBx_P-C Product feature CHAIN AB300372_HBx_P-C of FT:mat_peptide AB300372_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient14). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHGAHLSLRGLFVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB300373_HBx_P-C Product feature CHAIN AB300373_HBx_P-C of FT:mat_peptide AB300373_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient15). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB362932_HBx_P-C Product feature CHAIN AB362932_HBx_P-C of FT:mat_peptide AB362932_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB365451_HBx_P-C Product feature CHAIN AB365451_HBx_P-C of FT:mat_peptide AB365451_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL196). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367392_HBx_P-C Product feature CHAIN AB367392_HBx_P-C of FT:mat_peptide AB367392_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367394_HBx_P-C Product feature CHAIN AB367394_HBx_P-C of FT:mat_peptide AB367394_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 3/Adefovir-treated Pt. 8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367395_HBx_P-C Product feature CHAIN AB367395_HBx_P-C of FT:mat_peptide AB367395_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367396_HBx_P-C Product feature CHAIN AB367396_HBx_P-C of FT:mat_peptide AB367396_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367397_HBx_P-C Product feature CHAIN AB367397_HBx_P-C of FT:mat_peptide AB367397_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367398_HBx_P-C Product feature CHAIN AB367398_HBx_P-C of FT:mat_peptide AB367398_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 7/Adefovir-treated Pt. 20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367399_HBx_P-C Product feature CHAIN AB367399_HBx_P-C of FT:mat_peptide AB367399_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 8/Adefovir-treated Pt. 29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSCSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367401_HBx_P-C Product feature CHAIN AB367401_HBx_P-C of FT:mat_peptide AB367401_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 10/Adefovir-treated Pt. 9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367402_HBx_P-C Product feature CHAIN AB367402_HBx_P-C of FT:mat_peptide AB367402_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367403_HBx_P-C Product feature CHAIN AB367403_HBx_P-C of FT:mat_peptide AB367403_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 12/Adefovir-treated Pt. 17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367404_HBx_P-C Product feature CHAIN AB367404_HBx_P-C of FT:mat_peptide AB367404_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 13/Adefovir-treated Pt. 22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367405_HBx_P-C Product feature CHAIN AB367405_HBx_P-C of FT:mat_peptide AB367405_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 14/Adefovir-treated Pt. 25). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367406_HBx_P-C Product feature CHAIN AB367406_HBx_P-C of FT:mat_peptide AB367406_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 15/Adefovir-treated Pt. 7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEDTRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367407_HBx_P-C Product feature CHAIN AB367407_HBx_P-C of FT:mat_peptide AB367407_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 16/Adefovir-treated Pt. 11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367408_HBx_P-C Product feature CHAIN AB367408_HBx_P-C of FT:mat_peptide AB367408_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 17/Adefovir-treated Pt. 14). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367409_HBx_P-C Product feature CHAIN AB367409_HBx_P-C of FT:mat_peptide AB367409_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 18). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPAGDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFNDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367410_HBx_P-C Product feature CHAIN AB367410_HBx_P-C of FT:mat_peptide AB367410_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 19/Adefovir-treated Pt. 19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGANLSLRGLPVCALSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367411_HBx_P-C Product feature CHAIN AB367411_HBx_P-C of FT:mat_peptide AB367411_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367412_HBx_P-C Product feature CHAIN AB367412_HBx_P-C of FT:mat_peptide AB367412_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AB367413_HBx_P-C Product feature CHAIN AB367413_HBx_P-C of FT:mat_peptide AB367413_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 22/Adefovir-treated Pt. 4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367414_HBx_P-C Product feature CHAIN AB367414_HBx_P-C of FT:mat_peptide AB367414_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 23/Adefovir-treated Pt. 3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367416_HBx_P-C Product feature CHAIN AB367416_HBx_P-C of FT:mat_peptide AB367416_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367417_HBx_P-C Product feature CHAIN AB367417_HBx_P-C of FT:mat_peptide AB367417_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367418_HBx_P-C Product feature CHAIN AB367418_HBx_P-C of FT:mat_peptide AB367418_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 27/Adefovir-treated Pt. 21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367420_HBx_P-C Product feature CHAIN AB367420_HBx_P-C of FT:mat_peptide AB367420_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367421_HBx_P-C Product feature CHAIN AB367421_HBx_P-C of FT:mat_peptide AB367421_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 30). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367422_HBx_P-C Product feature CHAIN AB367422_HBx_P-C of FT:mat_peptide AB367422_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 31/Adefovir-treated Pt. 12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367423_HBx_P-C Product feature CHAIN AB367423_HBx_P-C of FT:mat_peptide AB367423_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 32/Adefovir-treated Pt. 28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367424_HBx_P-C Product feature CHAIN AB367424_HBx_P-C of FT:mat_peptide AB367424_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367425_HBx_P-C Product feature CHAIN AB367425_HBx_P-C of FT:mat_peptide AB367425_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 34/Adefovir-treated Pt. 15). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367426_HBx_P-C Product feature CHAIN AB367426_HBx_P-C of FT:mat_peptide AB367426_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 35). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVRAESRGRPVSGSFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367427_HBx_P-C Product feature CHAIN AB367427_HBx_P-C of FT:mat_peptide AB367427_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 36/Adefovir-treated Pt. 18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVVCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367428_HBx_P-C Product feature CHAIN AB367428_HBx_P-C of FT:mat_peptide AB367428_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 37/Adefovir-treated Pt. 10). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGVESRGRPVSGPFGTLPSPSSPAVPADHGAHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAHKVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367429_HBx_P-C Product feature CHAIN AB367429_HBx_P-C of FT:mat_peptide AB367429_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 38). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367430_HBx_P-C Product feature CHAIN AB367430_HBx_P-C of FT:mat_peptide AB367430_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 39/Adefovir-treated Pt. 5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367431_HBx_P-C Product feature CHAIN AB367431_HBx_P-C of FT:mat_peptide AB367431_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367432_HBx_P-C Product feature CHAIN AB367432_HBx_P-C of FT:mat_peptide AB367432_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367433_HBx_P-C Product feature CHAIN AB367433_HBx_P-C of FT:mat_peptide AB367433_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 42/Adefovir-treated Pt. 27). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367434_HBx_P-C Product feature CHAIN AB367434_HBx_P-C of FT:mat_peptide AB367434_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 43/Adefovir-treated Pt. 26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367435_HBx_P-C Product feature CHAIN AB367435_HBx_P-C of FT:mat_peptide AB367435_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 44/Adefovir-treated Pt. 23). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367801_HBx_P-C Product feature CHAIN AB367801_HBx_P-C of FT:mat_peptide AB367801_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 30). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVRAESRGRPVSGSFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367802_HBx_P-C Product feature CHAIN AB367802_HBx_P-C of FT:mat_peptide AB367802_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 16). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYYKDCLFKDWEELGEELRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367803_HBx_P-C Product feature CHAIN AB367803_HBx_P-C of FT:mat_peptide AB367803_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB367804_HBx_P-C Product feature CHAIN AB367804_HBx_P-C of FT:mat_peptide AB367804_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB368297_HBx_P-C Product feature CHAIN AB368297_HBx_P-C of FT:mat_peptide AB368297_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISRPFGPLSSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB426467_HBx_P-C Product feature CHAIN AB426467_HBx_P-C of FT:mat_peptide AB426467_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471848_HBx_P-C Product feature CHAIN AB471848_HBx_P-C of FT:mat_peptide AB471848_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471849_HBx_P-C Product feature CHAIN AB471849_HBx_P-C of FT:mat_peptide AB471849_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471850_HBx_P-C Product feature CHAIN AB471850_HBx_P-C of FT:mat_peptide AB471850_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471851_HBx_P-C Product feature CHAIN AB471851_HBx_P-C of FT:mat_peptide AB471851_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2NK-F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471852_HBx_P-C Product feature CHAIN AB471852_HBx_P-C of FT:mat_peptide AB471852_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB471853_HBx_P-C Product feature CHAIN AB471853_HBx_P-C of FT:mat_peptide AB471853_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB485808_HBx_P-C Product feature CHAIN AB485808_HBx_P-C of FT:mat_peptide AB485808_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-IT). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB485809_HBx_P-C Product feature CHAIN AB485809_HBx_P-C of FT:mat_peptide AB485809_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FEP1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB485810_HBx_P-C Product feature CHAIN AB485810_HBx_P-C of FT:mat_peptide AB485810_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FEP2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493839_HBx_P-C Product feature CHAIN AB493839_HBx_P-C of FT:mat_peptide AB493839_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPVAGPLGGLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEEYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB493844_HBx_P-C Product feature CHAIN AB493844_HBx_P-C of FT:mat_peptide AB493844_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 43UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYGAHLSLRGLPVCAFSSADPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB640730_HBx_P-C Product feature CHAIN AB640730_HBx_P-C of FT:mat_peptide AB640730_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ehime-EPCH-HBV-C1-HN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB642095_HBx_P-C Product feature CHAIN AB642095_HBx_P-C of FT:mat_peptide AB642095_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2000-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB642097_HBx_P-C Product feature CHAIN AB642097_HBx_P-C of FT:mat_peptide AB642097_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2003-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|AB642099_HBx_P-C Product feature CHAIN AB642099_HBx_P-C of FT:mat_peptide AB642099_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2005-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB642100_HBx_P-C Product feature CHAIN AB642100_HBx_P-C of FT:mat_peptide AB642100_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2006-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNARQVLPKVLHKKTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670237_HBx_P-C Product feature CHAIN AB670237_HBx_P-C of FT:mat_peptide AB670237_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670238_HBx_P-C Product feature CHAIN AB670238_HBx_P-C of FT:mat_peptide AB670238_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670239_HBx_P-C Product feature CHAIN AB670239_HBx_P-C of FT:mat_peptide AB670239_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670240_HBx_P-C Product feature CHAIN AB670240_HBx_P-C of FT:mat_peptide AB670240_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670241_HBx_P-C Product feature CHAIN AB670241_HBx_P-C of FT:mat_peptide AB670241_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670242_HBx_P-C Product feature CHAIN AB670242_HBx_P-C of FT:mat_peptide AB670242_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSXGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670243_HBx_P-C Product feature CHAIN AB670243_HBx_P-C of FT:mat_peptide AB670243_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670246_HBx_P-C Product feature CHAIN AB670246_HBx_P-C of FT:mat_peptide AB670246_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.10). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
XTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670247_HBx_P-C Product feature CHAIN AB670247_HBx_P-C of FT:mat_peptide AB670247_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670249_HBx_P-C Product feature CHAIN AB670249_HBx_P-C of FT:mat_peptide AB670249_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKEWEELGEEIRLKIYVIGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670252_HBx_P-C Product feature CHAIN AB670252_HBx_P-C of FT:mat_peptide AB670252_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670253_HBx_P-C Product feature CHAIN AB670253_HBx_P-C of FT:mat_peptide AB670253_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670254_HBx_P-C Product feature CHAIN AB670254_HBx_P-C of FT:mat_peptide AB670254_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.18). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670255_HBx_P-C Product feature CHAIN AB670255_HBx_P-C of FT:mat_peptide AB670255_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.19). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670256_HBx_P-C Product feature CHAIN AB670256_HBx_P-C of FT:mat_peptide AB670256_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSXGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670258_HBx_P-C Product feature CHAIN AB670258_HBx_P-C of FT:mat_peptide AB670258_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670259_HBx_P-C Product feature CHAIN AB670259_HBx_P-C of FT:mat_peptide AB670259_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFEHLPSPSASALPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670260_HBx_P-C Product feature CHAIN AB670260_HBx_P-C of FT:mat_peptide AB670260_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670261_HBx_P-C Product feature CHAIN AB670261_HBx_P-C of FT:mat_peptide AB670261_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSSMSTTDLEAYFKDCLFKNWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670262_HBx_P-C Product feature CHAIN AB670262_HBx_P-C of FT:mat_peptide AB670262_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670263_HBx_P-C Product feature CHAIN AB670263_HBx_P-C of FT:mat_peptide AB670263_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLXIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670264_HBx_P-C Product feature CHAIN AB670264_HBx_P-C of FT:mat_peptide AB670264_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670265_HBx_P-C Product feature CHAIN AB670265_HBx_P-C of FT:mat_peptide AB670265_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPPSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLYKRTLGLSAMSTIDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670266_HBx_P-C Product feature CHAIN AB670266_HBx_P-C of FT:mat_peptide AB670266_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLYKRTLGLSAMSTTYLEAYFKDCLFKDWEELGEEIRLMIFVIGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670267_HBx_P-C Product feature CHAIN AB670267_HBx_P-C of FT:mat_peptide AB670267_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670268_HBx_P-C Product feature CHAIN AB670268_HBx_P-C of FT:mat_peptide AB670268_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.32). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVXPKVLYKRTLGLSAMSTTDXEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670269_HBx_P-C Product feature CHAIN AB670269_HBx_P-C of FT:mat_peptide AB670269_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRFKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670270_HBx_P-C Product feature CHAIN AB670270_HBx_P-C of FT:mat_peptide AB670270_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670272_HBx_P-C Product feature CHAIN AB670272_HBx_P-C of FT:mat_peptide AB670272_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670273_HBx_P-C Product feature CHAIN AB670273_HBx_P-C of FT:mat_peptide AB670273_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AB670274_HBx_P-C Product feature CHAIN AB670274_HBx_P-C of FT:mat_peptide AB670274_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670276_HBx_P-C Product feature CHAIN AB670276_HBx_P-C of FT:mat_peptide AB670276_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670277_HBx_P-C Product feature CHAIN AB670277_HBx_P-C of FT:mat_peptide AB670277_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670278_HBx_P-C Product feature CHAIN AB670278_HBx_P-C of FT:mat_peptide AB670278_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGDESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670279_HBx_P-C Product feature CHAIN AB670279_HBx_P-C of FT:mat_peptide AB670279_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPSRDVICLRPVGAESRGRPVSGPFGPLXSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670281_HBx_P-C Product feature CHAIN AB670281_HBx_P-C of FT:mat_peptide AB670281_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLXKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670282_HBx_P-C Product feature CHAIN AB670282_HBx_P-C of FT:mat_peptide AB670282_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670283_HBx_P-C Product feature CHAIN AB670283_HBx_P-C of FT:mat_peptide AB670283_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670287_HBx_P-C Product feature CHAIN AB670287_HBx_P-C of FT:mat_peptide AB670287_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSASTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670288_HBx_P-C Product feature CHAIN AB670288_HBx_P-C of FT:mat_peptide AB670288_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.15). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670289_HBx_P-C Product feature CHAIN AB670289_HBx_P-C of FT:mat_peptide AB670289_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670290_HBx_P-C Product feature CHAIN AB670290_HBx_P-C of FT:mat_peptide AB670290_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670291_HBx_P-C Product feature CHAIN AB670291_HBx_P-C of FT:mat_peptide AB670291_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670292_HBx_P-C Product feature CHAIN AB670292_HBx_P-C of FT:mat_peptide AB670292_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TPVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670294_HBx_P-C Product feature CHAIN AB670294_HBx_P-C of FT:mat_peptide AB670294_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.21). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSASTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670295_HBx_P-C Product feature CHAIN AB670295_HBx_P-C of FT:mat_peptide AB670295_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670297_HBx_P-C Product feature CHAIN AB670297_HBx_P-C of FT:mat_peptide AB670297_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670298_HBx_P-C Product feature CHAIN AB670298_HBx_P-C of FT:mat_peptide AB670298_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSQTPFNFFTSA
>gnl|hbvpro|AB670300_HBx_P-C Product feature CHAIN AB670300_HBx_P-C of FT:mat_peptide AB670300_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670301_HBx_P-C Product feature CHAIN AB670301_HBx_P-C of FT:mat_peptide AB670301_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTYLEAYFKDCLFKDWEELGEETRLMIFVIGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670302_HBx_P-C Product feature CHAIN AB670302_HBx_P-C of FT:mat_peptide AB670302_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670304_HBx_P-C Product feature CHAIN AB670304_HBx_P-C of FT:mat_peptide AB670304_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.31). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCIRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670305_HBx_P-C Product feature CHAIN AB670305_HBx_P-C of FT:mat_peptide AB670305_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPXSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670306_HBx_P-C Product feature CHAIN AB670306_HBx_P-C of FT:mat_peptide AB670306_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670307_HBx_P-C Product feature CHAIN AB670307_HBx_P-C of FT:mat_peptide AB670307_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.34). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670308_HBx_P-C Product feature CHAIN AB670308_HBx_P-C of FT:mat_peptide AB670308_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.35). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIPLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670309_HBx_P-C Product feature CHAIN AB670309_HBx_P-C of FT:mat_peptide AB670309_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.36). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670310_HBx_P-C Product feature CHAIN AB670310_HBx_P-C of FT:mat_peptide AB670310_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB670311_HBx_P-C Product feature CHAIN AB670311_HBx_P-C of FT:mat_peptide AB670311_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSAAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB675674_HBx_P-C Product feature CHAIN AB675674_HBx_P-C of FT:mat_peptide AB675674_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB675675_HBx_P-C Product feature CHAIN AB675675_HBx_P-C of FT:mat_peptide AB675675_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB675677_HBx_P-C Product feature CHAIN AB675677_HBx_P-C of FT:mat_peptide AB675677_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSPAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB697490_HBx_P-C Product feature CHAIN AB697490_HBx_P-C of FT:mat_peptide AB697490_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB697494_HBx_P-C Product feature CHAIN AB697494_HBx_P-C of FT:mat_peptide AB697494_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No9). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHKVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB697500_HBx_P-C Product feature CHAIN AB697500_HBx_P-C of FT:mat_peptide AB697500_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB697502_HBx_P-C Product feature CHAIN AB697502_HBx_P-C of FT:mat_peptide AB697502_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSVRRME
TTVNAHQVLPKVLYKRTLGLXAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|AB697510_HBx_P-C Product feature CHAIN AB697510_HBx_P-C of FT:mat_peptide AB697510_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPFNFFTSA
>gnl|hbvpro|AB900099_HBx_P-C Product feature CHAIN AB900099_HBx_P-C of FT:mat_peptide AB900099_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESCRRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900109_HBx_P-C Product feature CHAIN AB900109_HBx_P-C of FT:mat_peptide AB900109_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGHLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900113_HBx_P-C Product feature CHAIN AB900113_HBx_P-C of FT:mat_peptide AB900113_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHTRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB900115_HBx_P-C Product feature CHAIN AB900115_HBx_P-C of FT:mat_peptide AB900115_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGDESRGRPVAGPFGPLSSPSSAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVRSPVPCNFFTSA
>gnl|hbvpro|AB900116_HBx_P-C Product feature CHAIN AB900116_HBx_P-C of FT:mat_peptide AB900116_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB931170_HBx_P-C Product feature CHAIN AB931170_HBx_P-C of FT:mat_peptide AB931170_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2P_HB11-0921). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB931171_HBx_P-C Product feature CHAIN AB931171_HBx_P-C of FT:mat_peptide AB931171_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2S_HB11-0922). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB971714_HBx_P-C Product feature CHAIN AB971714_HBx_P-C of FT:mat_peptide AB971714_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AB971715_HBx_P-C Product feature CHAIN AB971715_HBx_P-C of FT:mat_peptide AB971715_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF068756_HBx_P-C Product feature CHAIN AF068756_HBx_P-C of FT:mat_peptide AF068756_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPFGAESRGRPISGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF182802_HBx_P-C Product feature CHAIN AF182802_HBx_P-C of FT:mat_peptide AF182802_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFGLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF182803_HBx_P-C Product feature CHAIN AF182803_HBx_P-C of FT:mat_peptide AF182803_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMWCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLTAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF182804_HBx_P-C Product feature CHAIN AF182804_HBx_P-C of FT:mat_peptide AF182804_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFRDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF182805_HBx_P-C Product feature CHAIN AF182805_HBx_P-C of FT:mat_peptide AF182805_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223954_HBx_P-C Product feature CHAIN AF223954_HBx_P-C of FT:mat_peptide AF223954_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223955_HBx_P-C Product feature CHAIN AF223955_HBx_P-C of FT:mat_peptide AF223955_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223956_HBx_P-C Product feature CHAIN AF223956_HBx_P-C of FT:mat_peptide AF223956_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223957_HBx_P-C Product feature CHAIN AF223957_HBx_P-C of FT:mat_peptide AF223957_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223958_HBx_P-C Product feature CHAIN AF223958_HBx_P-C of FT:mat_peptide AF223958_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSMTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223959_HBx_P-C Product feature CHAIN AF223959_HBx_P-C of FT:mat_peptide AF223959_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223960_HBx_P-C Product feature CHAIN AF223960_HBx_P-C of FT:mat_peptide AF223960_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF223961_HBx_P-C Product feature CHAIN AF223961_HBx_P-C of FT:mat_peptide AF223961_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF241410_HBx_P-C Product feature CHAIN AF241410_HBx_P-C of FT:mat_peptide AF241410_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3270). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANQVLPKVLHKRTLGLSALSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AF241411_HBx_P-C Product feature CHAIN AF241411_HBx_P-C of FT:mat_peptide AF241411_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8290). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AF286594_HBx_P-C Product feature CHAIN AF286594_HBx_P-C of FT:mat_peptide AF286594_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEKIRLKVFGLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF324347_HBx_P-C Product feature CHAIN AF324347_HBx_P-C of FT:mat_peptide AF324347_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF325199_HBx_P-C Product feature CHAIN AF325199_HBx_P-C of FT:mat_peptide AF325199_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF325700_HBx_P-C Product feature CHAIN AF325700_HBx_P-C of FT:mat_peptide AF325700_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF325701_HBx_P-C Product feature CHAIN AF325701_HBx_P-C of FT:mat_peptide AF325701_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFALGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF326585_HBx_P-C Product feature CHAIN AF326585_HBx_P-C of FT:mat_peptide AF326585_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVIVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF326586_HBx_P-C Product feature CHAIN AF326586_HBx_P-C of FT:mat_peptide AF326586_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF326587_HBx_P-C Product feature CHAIN AF326587_HBx_P-C of FT:mat_peptide AF326587_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVLKDWEELGEEIRLKVIVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF355779_HBx_P-C Product feature CHAIN AF355779_HBx_P-C of FT:mat_peptide AF355779_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF355785_HBx_P-C Product feature CHAIN AF355785_HBx_P-C of FT:mat_peptide AF355785_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCSFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF363961_HBx_P-C Product feature CHAIN AF363961_HBx_P-C of FT:mat_peptide AF363961_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF384364_HBx_P-C Product feature CHAIN AF384364_HBx_P-C of FT:mat_peptide AF384364_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-3). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF384365_HBx_P-C Product feature CHAIN AF384365_HBx_P-C of FT:mat_peptide AF384365_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-4). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVDAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF384366_HBx_P-C Product feature CHAIN AF384366_HBx_P-C of FT:mat_peptide AF384366_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-5). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF384367_HBx_P-C Product feature CHAIN AF384367_HBx_P-C of FT:mat_peptide AF384367_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XC-86-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF384371_HBx_P-C Product feature CHAIN AF384371_HBx_P-C of FT:mat_peptide AF384371_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF384372_HBx_P-C Product feature CHAIN AF384372_HBx_P-C of FT:mat_peptide AF384372_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-A6). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGGEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF411410_HBx_P-C Product feature CHAIN AF411410_HBx_P-C of FT:mat_peptide AF411410_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLYKRTLGLPAMSTTDLEAYFKGCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF411412_HBx_P-C Product feature CHAIN AF411412_HBx_P-C of FT:mat_peptide AF411412_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTFPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF458664_HBx_P-C Product feature CHAIN AF458664_HBx_P-C of FT:mat_peptide AF458664_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF458665_HBx_P-C Product feature CHAIN AF458665_HBx_P-C of FT:mat_peptide AF458665_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C733). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF461357_HBx_P-C Product feature CHAIN AF461357_HBx_P-C of FT:mat_peptide AF461357_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF461358_HBx_P-C Product feature CHAIN AF461358_HBx_P-C of FT:mat_peptide AF461358_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH8). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEESGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF461359_HBx_P-C Product feature CHAIN AF461359_HBx_P-C of FT:mat_peptide AF461359_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate c16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEESGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF461363_HBx_P-C Product feature CHAIN AF461363_HBx_P-C of FT:mat_peptide AF461363_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF473543_HBx_P-C Product feature CHAIN AF473543_HBx_P-C of FT:mat_peptide AF473543_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2e). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGKEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AF533983_HBx_P-C Product feature CHAIN AF533983_HBx_P-C of FT:mat_peptide AF533983_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AJ748098_HBx_P-C Product feature CHAIN AJ748098_HBx_P-C of FT:mat_peptide AJ748098_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient Z1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011097_HBx_P-C Product feature CHAIN AP011097_HBx_P-C of FT:mat_peptide AP011097_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011098_HBx_P-C Product feature CHAIN AP011098_HBx_P-C of FT:mat_peptide AP011098_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011099_HBx_P-C Product feature CHAIN AP011099_HBx_P-C of FT:mat_peptide AP011099_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AP011100_HBx_P-C Product feature CHAIN AP011100_HBx_P-C of FT:mat_peptide AP011100_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AP011101_HBx_P-C Product feature CHAIN AP011101_HBx_P-C of FT:mat_peptide AP011101_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPVSGALGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|AP011106_HBx_P-C Product feature CHAIN AP011106_HBx_P-C of FT:mat_peptide AP011106_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AP011107_HBx_P-C Product feature CHAIN AP011107_HBx_P-C of FT:mat_peptide AP011107_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|AY028298_HBx_P-C Product feature CHAIN AY028298_HBx_P-C of FT:mat_peptide AY028298_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate X845-6). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY028299_HBx_P-C Product feature CHAIN AY028299_HBx_P-C of FT:mat_peptide AY028299_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate X845-5). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY028303_HBx_P-C Product feature CHAIN AY028303_HBx_P-C of FT:mat_peptide AY028303_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate XX16-3). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRTFGALPSPSVSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY028593_HBx_P-C Product feature CHAIN AY028593_HBx_P-C of FT:mat_peptide AY028593_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate X30-7). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSPSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLRLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY028597_HBx_P-C Product feature CHAIN AY028597_HBx_P-C of FT:mat_peptide AY028597_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate X30-9). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY057947_HBx_P-C Product feature CHAIN AY057947_HBx_P-C of FT:mat_peptide AY057947_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet705). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNTRQVLPKVLHKRTLALSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVCVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY066028_HBx_P-C Product feature CHAIN AY066028_HBx_P-C of FT:mat_peptide AY066028_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPAHHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167090_HBx_P-C Product feature CHAIN AY167090_HBx_P-C of FT:mat_peptide AY167090_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIMLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167092_HBx_P-C Product feature CHAIN AY167092_HBx_P-C of FT:mat_peptide AY167092_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Id). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167096_HBx_P-C Product feature CHAIN AY167096_HBx_P-C of FT:mat_peptide AY167096_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IIIa). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY167099_HBx_P-C Product feature CHAIN AY167099_HBx_P-C of FT:mat_peptide AY167099_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IVb). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCTHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206376_HBx_P-C Product feature CHAIN AY206376_HBx_P-C of FT:mat_peptide AY206376_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206378_HBx_P-C Product feature CHAIN AY206378_HBx_P-C of FT:mat_peptide AY206378_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206379_HBx_P-C Product feature CHAIN AY206379_HBx_P-C of FT:mat_peptide AY206379_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206381_HBx_P-C Product feature CHAIN AY206381_HBx_P-C of FT:mat_peptide AY206381_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206382_HBx_P-C Product feature CHAIN AY206382_HBx_P-C of FT:mat_peptide AY206382_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206384_HBx_P-C Product feature CHAIN AY206384_HBx_P-C of FT:mat_peptide AY206384_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206385_HBx_P-C Product feature CHAIN AY206385_HBx_P-C of FT:mat_peptide AY206385_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206386_HBx_P-C Product feature CHAIN AY206386_HBx_P-C of FT:mat_peptide AY206386_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206388_HBx_P-C Product feature CHAIN AY206388_HBx_P-C of FT:mat_peptide AY206388_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAAGVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206389_HBx_P-C Product feature CHAIN AY206389_HBx_P-C of FT:mat_peptide AY206389_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY206392_HBx_P-C Product feature CHAIN AY206392_HBx_P-C of FT:mat_peptide AY206392_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220699_HBx_P-C Product feature CHAIN AY220699_HBx_P-C of FT:mat_peptide AY220699_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|AY220700_HBx_P-C Product feature CHAIN AY220700_HBx_P-C of FT:mat_peptide AY220700_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220701_HBx_P-C Product feature CHAIN AY220701_HBx_P-C of FT:mat_peptide AY220701_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY220702_HBx_P-C Product feature CHAIN AY220702_HBx_P-C of FT:mat_peptide AY220702_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY247031_HBx_P-C Product feature CHAIN AY247031_HBx_P-C of FT:mat_peptide AY247031_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSTAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY247032_HBx_P-C Product feature CHAIN AY247032_HBx_P-C of FT:mat_peptide AY247032_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB95). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY251132_HBx_P-C Product feature CHAIN AY251132_HBx_P-C of FT:mat_peptide AY251132_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 470). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY251134_HBx_P-C Product feature CHAIN AY251134_HBx_P-C of FT:mat_peptide AY251134_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 473). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY251135_HBx_P-C Product feature CHAIN AY251135_HBx_P-C of FT:mat_peptide AY251135_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 474). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAAMLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY251137_HBx_P-C Product feature CHAIN AY251137_HBx_P-C of FT:mat_peptide AY251137_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 477). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY251140_HBx_P-C Product feature CHAIN AY251140_HBx_P-C of FT:mat_peptide AY251140_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 480). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY251141_HBx_P-C Product feature CHAIN AY251141_HBx_P-C of FT:mat_peptide AY251141_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 482). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY251142_HBx_P-C Product feature CHAIN AY251142_HBx_P-C of FT:mat_peptide AY251142_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate mutant 483). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY306136_HBx_P-C Product feature CHAIN AY306136_HBx_P-C of FT:mat_peptide AY306136_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRLTSVRRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY308741_HBx_P-C Product feature CHAIN AY308741_HBx_P-C of FT:mat_peptide AY308741_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY311588_HBx_P-C Product feature CHAIN AY311588_HBx_P-C of FT:mat_peptide AY311588_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC-isolate 11). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY596108_HBx_P-C Product feature CHAIN AY596108_HBx_P-C of FT:mat_peptide AY596108_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY641558_HBx_P-C Product feature CHAIN AY641558_HBx_P-C of FT:mat_peptide AY641558_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY641559_HBx_P-C Product feature CHAIN AY641559_HBx_P-C of FT:mat_peptide AY641559_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHPVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY641560_HBx_P-C Product feature CHAIN AY641560_HBx_P-C of FT:mat_peptide AY641560_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He100). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY641561_HBx_P-C Product feature CHAIN AY641561_HBx_P-C of FT:mat_peptide AY641561_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY641562_HBx_P-C Product feature CHAIN AY641562_HBx_P-C of FT:mat_peptide AY641562_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY641563_HBx_P-C Product feature CHAIN AY641563_HBx_P-C of FT:mat_peptide AY641563_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|AY862869_HBx_P-C Product feature CHAIN AY862869_HBx_P-C of FT:mat_peptide AY862869_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H8). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLSKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D00630_HBx_P-C Product feature CHAIN D00630_HBx_P-C of FT:mat_peptide D00630_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGARLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D12980_HBx_P-C Product feature CHAIN D12980_HBx_P-C of FT:mat_peptide D12980_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D23681_HBx_P-C Product feature CHAIN D23681_HBx_P-C of FT:mat_peptide D23681_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C4-HBVST2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D23682_HBx_P-C Product feature CHAIN D23682_HBx_P-C of FT:mat_peptide D23682_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B5-HBVKO1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|D23683_HBx_P-C Product feature CHAIN D23683_HBx_P-C of FT:mat_peptide D23683_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C5-HBVKO2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPIPGSFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|D23684_HBx_P-C Product feature CHAIN D23684_HBx_P-C of FT:mat_peptide D23684_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C6-TKB588). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFRSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D28880_HBx_P-C Product feature CHAIN D28880_HBx_P-C of FT:mat_peptide D28880_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Plasma 1992-085-9434). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGQPVSGPFGTLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D50517_HBx_P-C Product feature CHAIN D50517_HBx_P-C of FT:mat_peptide D50517_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D50518_HBx_P-C Product feature CHAIN D50518_HBx_P-C of FT:mat_peptide D50518_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D50519_HBx_P-C Product feature CHAIN D50519_HBx_P-C of FT:mat_peptide D50519_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|D50520_HBx_P-C Product feature CHAIN D50520_HBx_P-C of FT:mat_peptide D50520_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089756_HBx_P-C Product feature CHAIN DQ089756_HBx_P-C of FT:mat_peptide DQ089756_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK75). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089757_HBx_P-C Product feature CHAIN DQ089757_HBx_P-C of FT:mat_peptide DQ089757_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2342). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089758_HBx_P-C Product feature CHAIN DQ089758_HBx_P-C of FT:mat_peptide DQ089758_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1733). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSTMSMTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089759_HBx_P-C Product feature CHAIN DQ089759_HBx_P-C of FT:mat_peptide DQ089759_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1512). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCSYKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089760_HBx_P-C Product feature CHAIN DQ089760_HBx_P-C of FT:mat_peptide DQ089760_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK454). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089761_HBx_P-C Product feature CHAIN DQ089761_HBx_P-C of FT:mat_peptide DQ089761_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK515). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCPLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089762_HBx_P-C Product feature CHAIN DQ089762_HBx_P-C of FT:mat_peptide DQ089762_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1644). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPXDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089763_HBx_P-C Product feature CHAIN DQ089763_HBx_P-C of FT:mat_peptide DQ089763_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1048). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQQVLPKVLHKRTLGLSAMSMTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089764_HBx_P-C Product feature CHAIN DQ089764_HBx_P-C of FT:mat_peptide DQ089764_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK967). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089765_HBx_P-C Product feature CHAIN DQ089765_HBx_P-C of FT:mat_peptide DQ089765_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK428). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089766_HBx_P-C Product feature CHAIN DQ089766_HBx_P-C of FT:mat_peptide DQ089766_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK553). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEELRLKTFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089767_HBx_P-C Product feature CHAIN DQ089767_HBx_P-C of FT:mat_peptide DQ089767_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1663). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVSADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089768_HBx_P-C Product feature CHAIN DQ089768_HBx_P-C of FT:mat_peptide DQ089768_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1814). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPEPCNFFTSA
>gnl|hbvpro|DQ089769_HBx_P-C Product feature CHAIN DQ089769_HBx_P-C of FT:mat_peptide DQ089769_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK430). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089770_HBx_P-C Product feature CHAIN DQ089770_HBx_P-C of FT:mat_peptide DQ089770_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1272). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089771_HBx_P-C Product feature CHAIN DQ089771_HBx_P-C of FT:mat_peptide DQ089771_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1629). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVRQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089772_HBx_P-C Product feature CHAIN DQ089772_HBx_P-C of FT:mat_peptide DQ089772_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK910). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089773_HBx_P-C Product feature CHAIN DQ089773_HBx_P-C of FT:mat_peptide DQ089773_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1193). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089775_HBx_P-C Product feature CHAIN DQ089775_HBx_P-C of FT:mat_peptide DQ089775_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK290). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089776_HBx_P-C Product feature CHAIN DQ089776_HBx_P-C of FT:mat_peptide DQ089776_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK884). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089777_HBx_P-C Product feature CHAIN DQ089777_HBx_P-C of FT:mat_peptide DQ089777_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1159). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVRAESRGRPVSGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRLE
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089778_HBx_P-C Product feature CHAIN DQ089778_HBx_P-C of FT:mat_peptide DQ089778_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1442). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGDDKRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089779_HBx_P-C Product feature CHAIN DQ089779_HBx_P-C of FT:mat_peptide DQ089779_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK554). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLXLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089780_HBx_P-C Product feature CHAIN DQ089780_HBx_P-C of FT:mat_peptide DQ089780_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK947). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089781_HBx_P-C Product feature CHAIN DQ089781_HBx_P-C of FT:mat_peptide DQ089781_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1476). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089782_HBx_P-C Product feature CHAIN DQ089782_HBx_P-C of FT:mat_peptide DQ089782_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2032). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089783_HBx_P-C Product feature CHAIN DQ089783_HBx_P-C of FT:mat_peptide DQ089783_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1402). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089784_HBx_P-C Product feature CHAIN DQ089784_HBx_P-C of FT:mat_peptide DQ089784_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1285). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089785_HBx_P-C Product feature CHAIN DQ089785_HBx_P-C of FT:mat_peptide DQ089785_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1386). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPQVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089786_HBx_P-C Product feature CHAIN DQ089786_HBx_P-C of FT:mat_peptide DQ089786_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2074). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089787_HBx_P-C Product feature CHAIN DQ089787_HBx_P-C of FT:mat_peptide DQ089787_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK352). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLVLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089788_HBx_P-C Product feature CHAIN DQ089788_HBx_P-C of FT:mat_peptide DQ089788_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK820). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089789_HBx_P-C Product feature CHAIN DQ089789_HBx_P-C of FT:mat_peptide DQ089789_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK926). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLXIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089790_HBx_P-C Product feature CHAIN DQ089790_HBx_P-C of FT:mat_peptide DQ089790_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1248). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDXARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEDLGEEISLMIFVLGDCRHKLFCSPAPCNFFTSA
>gnl|hbvpro|DQ089791_HBx_P-C Product feature CHAIN DQ089791_HBx_P-C of FT:mat_peptide DQ089791_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1205). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089792_HBx_P-C Product feature CHAIN DQ089792_HBx_P-C of FT:mat_peptide DQ089792_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK870). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGSFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089793_HBx_P-C Product feature CHAIN DQ089793_HBx_P-C of FT:mat_peptide DQ089793_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK343). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089794_HBx_P-C Product feature CHAIN DQ089794_HBx_P-C of FT:mat_peptide DQ089794_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1896). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089795_HBx_P-C Product feature CHAIN DQ089795_HBx_P-C of FT:mat_peptide DQ089795_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1465). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089796_HBx_P-C Product feature CHAIN DQ089796_HBx_P-C of FT:mat_peptide DQ089796_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK751). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089797_HBx_P-C Product feature CHAIN DQ089797_HBx_P-C of FT:mat_peptide DQ089797_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1169). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRALGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089799_HBx_P-C Product feature CHAIN DQ089799_HBx_P-C of FT:mat_peptide DQ089799_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK734). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089800_HBx_P-C Product feature CHAIN DQ089800_HBx_P-C of FT:mat_peptide DQ089800_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK741). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVDTESCGRPLTGPLGTLPSPSSSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089801_HBx_P-C Product feature CHAIN DQ089801_HBx_P-C of FT:mat_peptide DQ089801_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2100). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPXPCNFFTSG
>gnl|hbvpro|DQ089802_HBx_P-C Product feature CHAIN DQ089802_HBx_P-C of FT:mat_peptide DQ089802_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1371). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVPRPFGPLSSPSTSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ089803_HBx_P-C Product feature CHAIN DQ089803_HBx_P-C of FT:mat_peptide DQ089803_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK931). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|DQ089804_HBx_P-C Product feature CHAIN DQ089804_HBx_P-C of FT:mat_peptide DQ089804_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK262). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ246215_HBx_P-C Product feature CHAIN DQ246215_HBx_P-C of FT:mat_peptide DQ246215_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTPA
>gnl|hbvpro|DQ315781_HBx_P-C Product feature CHAIN DQ315781_HBx_P-C of FT:mat_peptide DQ315781_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI0398). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ315782_HBx_P-C Product feature CHAIN DQ315782_HBx_P-C of FT:mat_peptide DQ315782_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI0423). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ315783_HBx_P-C Product feature CHAIN DQ315783_HBx_P-C of FT:mat_peptide DQ315783_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI03188). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ361534_HBx_P-C Product feature CHAIN DQ361534_HBx_P-C of FT:mat_peptide DQ361534_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CR-081). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ377160_HBx_P-C Product feature CHAIN DQ377160_HBx_P-C of FT:mat_peptide DQ377160_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT16). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVLADHGAHLSLRGLPVCAFSSAGPRALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ377161_HBx_P-C Product feature CHAIN DQ377161_HBx_P-C of FT:mat_peptide DQ377161_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ377162_HBx_P-C Product feature CHAIN DQ377162_HBx_P-C of FT:mat_peptide DQ377162_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ377163_HBx_P-C Product feature CHAIN DQ377163_HBx_P-C of FT:mat_peptide DQ377163_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ377164_HBx_P-C Product feature CHAIN DQ377164_HBx_P-C of FT:mat_peptide DQ377164_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ377165_HBx_P-C Product feature CHAIN DQ377165_HBx_P-C of FT:mat_peptide DQ377165_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478885_HBx_P-C Product feature CHAIN DQ478885_HBx_P-C of FT:mat_peptide DQ478885_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478899_HBx_P-C Product feature CHAIN DQ478899_HBx_P-C of FT:mat_peptide DQ478899_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478900_HBx_P-C Product feature CHAIN DQ478900_HBx_P-C of FT:mat_peptide DQ478900_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H172). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSMTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ478901_HBx_P-C Product feature CHAIN DQ478901_HBx_P-C of FT:mat_peptide DQ478901_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H155). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ536410_HBx_P-C Product feature CHAIN DQ536410_HBx_P-C of FT:mat_peptide DQ536410_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLVLPKVLHQRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ536411_HBx_P-C Product feature CHAIN DQ536411_HBx_P-C of FT:mat_peptide DQ536411_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLVLPKVLHQRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ536412_HBx_P-C Product feature CHAIN DQ536412_HBx_P-C of FT:mat_peptide DQ536412_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLVLPKVLHQRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ536413_HBx_P-C Product feature CHAIN DQ536413_HBx_P-C of FT:mat_peptide DQ536413_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLVLPKVLHQRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCTFFTSA
>gnl|hbvpro|DQ536414_HBx_P-C Product feature CHAIN DQ536414_HBx_P-C of FT:mat_peptide DQ536414_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHLVLPKVLHQRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCTFFTSA
>gnl|hbvpro|DQ683578_HBx_P-C Product feature CHAIN DQ683578_HBx_P-C of FT:mat_peptide DQ683578_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ788835_HBx_P-C Product feature CHAIN DQ788835_HBx_P-C of FT:mat_peptide DQ788835_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ890381_HBx_P-C Product feature CHAIN DQ890381_HBx_P-C of FT:mat_peptide DQ890381_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPATHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ922649_HBx_P-C Product feature CHAIN DQ922649_HBx_P-C of FT:mat_peptide DQ922649_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|DQ922650_HBx_P-C Product feature CHAIN DQ922650_HBx_P-C of FT:mat_peptide DQ922650_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVRSESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ922651_HBx_P-C Product feature CHAIN DQ922651_HBx_P-C of FT:mat_peptide DQ922651_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGAFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ975272_HBx_P-C Product feature CHAIN DQ975272_HBx_P-C of FT:mat_peptide DQ975272_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MTARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFTSTGPCALRFTSARRME
ATVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ975273_HBx_P-C Product feature CHAIN DQ975273_HBx_P-C of FT:mat_peptide DQ975273_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ975274_HBx_P-C Product feature CHAIN DQ975274_HBx_P-C of FT:mat_peptide DQ975274_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSFAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ980547_HBx_P-C Product feature CHAIN DQ980547_HBx_P-C of FT:mat_peptide DQ980547_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ980549_HBx_P-C Product feature CHAIN DQ980549_HBx_P-C of FT:mat_peptide DQ980549_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVSVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ980550_HBx_P-C Product feature CHAIN DQ980550_HBx_P-C of FT:mat_peptide DQ980550_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ980551_HBx_P-C Product feature CHAIN DQ980551_HBx_P-C of FT:mat_peptide DQ980551_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCYQLDPARDVLCQRPVGAESRGRPVSGPFGALPSPSYSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ986375_HBx_P-C Product feature CHAIN DQ986375_HBx_P-C of FT:mat_peptide DQ986375_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRSVGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ986376_HBx_P-C Product feature CHAIN DQ986376_HBx_P-C of FT:mat_peptide DQ986376_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGNLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993181_HBx_P-C Product feature CHAIN DQ993181_HBx_P-C of FT:mat_peptide DQ993181_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPWNFFTSA
>gnl|hbvpro|DQ993690_HBx_P-C Product feature CHAIN DQ993690_HBx_P-C of FT:mat_peptide DQ993690_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 204-1113-Nature1.1-unSero). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993691_HBx_P-C Product feature CHAIN DQ993691_HBx_P-C of FT:mat_peptide DQ993691_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0803-Nature2.2-unSero). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993692_HBx_P-C Product feature CHAIN DQ993692_HBx_P-C of FT:mat_peptide DQ993692_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0810-Nature2.1-unSero). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ993693_HBx_P-C Product feature CHAIN DQ993693_HBx_P-C of FT:mat_peptide DQ993693_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 232-1125-Nature1.1-unSero). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF137802_HBx_P-C Product feature CHAIN EF137802_HBx_P-C of FT:mat_peptide EF137802_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF137803_HBx_P-C Product feature CHAIN EF137803_HBx_P-C of FT:mat_peptide EF137803_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF197911_HBx_P-C Product feature CHAIN EF197911_HBx_P-C of FT:mat_peptide EF197911_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF384201_HBx_P-C Product feature CHAIN EF384201_HBx_P-C of FT:mat_peptide EF384201_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-02). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLXAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF384205_HBx_P-C Product feature CHAIN EF384205_HBx_P-C of FT:mat_peptide EF384205_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-06). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF394328_HBx_P-C Product feature CHAIN EF394328_HBx_P-C of FT:mat_peptide EF394328_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-8). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF494377_HBx_P-C Product feature CHAIN EF494377_HBx_P-C of FT:mat_peptide EF494377_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW1138). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF494379_HBx_P-C Product feature CHAIN EF494379_HBx_P-C of FT:mat_peptide EF494379_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW8585). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF536065_HBx_P-C Product feature CHAIN EF536065_HBx_P-C of FT:mat_peptide EF536065_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|EF536066_HBx_P-C Product feature CHAIN EF536066_HBx_P-C of FT:mat_peptide EF536066_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPGDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|EF594748_HBx_P-C Product feature CHAIN EF594748_HBx_P-C of FT:mat_peptide EF594748_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01343). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGALPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF594749_HBx_P-C Product feature CHAIN EF594749_HBx_P-C of FT:mat_peptide EF594749_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 02460). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF594750_HBx_P-C Product feature CHAIN EF594750_HBx_P-C of FT:mat_peptide EF594750_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 02461). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF594751_HBx_P-C Product feature CHAIN EF594751_HBx_P-C of FT:mat_peptide EF594751_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04240). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPFGTVPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF594752_HBx_P-C Product feature CHAIN EF594752_HBx_P-C of FT:mat_peptide EF594752_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 02469). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF594753_HBx_P-C Product feature CHAIN EF594753_HBx_P-C of FT:mat_peptide EF594753_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0334). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVFHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF594754_HBx_P-C Product feature CHAIN EF594754_HBx_P-C of FT:mat_peptide EF594754_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0340). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EF594758_HBx_P-C Product feature CHAIN EF594758_HBx_P-C of FT:mat_peptide EF594758_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 03184). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EF594760_HBx_P-C Product feature CHAIN EF594760_HBx_P-C of FT:mat_peptide EF594760_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04703). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EF594763_HBx_P-C Product feature CHAIN EF594763_HBx_P-C of FT:mat_peptide EF594763_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 05147). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EF594764_HBx_P-C Product feature CHAIN EF594764_HBx_P-C of FT:mat_peptide EF594764_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04721). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSTRCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EF594766_HBx_P-C Product feature CHAIN EF594766_HBx_P-C of FT:mat_peptide EF594766_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0319). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAISSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EF594767_HBx_P-C Product feature CHAIN EF594767_HBx_P-C of FT:mat_peptide EF594767_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0329). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MSARLYCQLDSSRDVLCLRPVGAESRGRPLPRPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNALQVLPKVLHKKTLGLSAMSTTDLEAYFKDCVFKDWEELGEETSLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|EF594768_HBx_P-C Product feature CHAIN EF594768_HBx_P-C of FT:mat_peptide EF594768_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04717). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF594769_HBx_P-C Product feature CHAIN EF594769_HBx_P-C of FT:mat_peptide EF594769_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04718). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKFLHKRTLGLSAMSKTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF688062_HBx_P-C Product feature CHAIN EF688062_HBx_P-C of FT:mat_peptide EF688062_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ28-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU305540_HBx_P-C Product feature CHAIN EU305540_HBx_P-C of FT:mat_peptide EU305540_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-123). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRTE
TTVNARQVLPKVLHKRTPGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU305541_HBx_P-C Product feature CHAIN EU305541_HBx_P-C of FT:mat_peptide EU305541_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-190). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU305542_HBx_P-C Product feature CHAIN EU305542_HBx_P-C of FT:mat_peptide EU305542_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-1251). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306671_HBx_P-C Product feature CHAIN EU306671_HBx_P-C of FT:mat_peptide EU306671_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU306672_HBx_P-C Product feature CHAIN EU306672_HBx_P-C of FT:mat_peptide EU306672_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVSPKVLHKRTLGLSATSTTDLEAYFKDCVFTDWEELGEEFRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU306673_HBx_P-C Product feature CHAIN EU306673_HBx_P-C of FT:mat_peptide EU306673_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306676_HBx_P-C Product feature CHAIN EU306676_HBx_P-C of FT:mat_peptide EU306676_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSSF
>gnl|hbvpro|EU306685_HBx_P-C Product feature CHAIN EU306685_HBx_P-C of FT:mat_peptide EU306685_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306687_HBx_P-C Product feature CHAIN EU306687_HBx_P-C of FT:mat_peptide EU306687_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306688_HBx_P-C Product feature CHAIN EU306688_HBx_P-C of FT:mat_peptide EU306688_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306689_HBx_P-C Product feature CHAIN EU306689_HBx_P-C of FT:mat_peptide EU306689_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306690_HBx_P-C Product feature CHAIN EU306690_HBx_P-C of FT:mat_peptide EU306690_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARPCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306691_HBx_P-C Product feature CHAIN EU306691_HBx_P-C of FT:mat_peptide EU306691_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306713_HBx_P-C Product feature CHAIN EU306713_HBx_P-C of FT:mat_peptide EU306713_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSTAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306714_HBx_P-C Product feature CHAIN EU306714_HBx_P-C of FT:mat_peptide EU306714_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306719_HBx_P-C Product feature CHAIN EU306719_HBx_P-C of FT:mat_peptide EU306719_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306720_HBx_P-C Product feature CHAIN EU306720_HBx_P-C of FT:mat_peptide EU306720_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306721_HBx_P-C Product feature CHAIN EU306721_HBx_P-C of FT:mat_peptide EU306721_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306722_HBx_P-C Product feature CHAIN EU306722_HBx_P-C of FT:mat_peptide EU306722_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306724_HBx_P-C Product feature CHAIN EU306724_HBx_P-C of FT:mat_peptide EU306724_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306725_HBx_P-C Product feature CHAIN EU306725_HBx_P-C of FT:mat_peptide EU306725_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLGAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306726_HBx_P-C Product feature CHAIN EU306726_HBx_P-C of FT:mat_peptide EU306726_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306727_HBx_P-C Product feature CHAIN EU306727_HBx_P-C of FT:mat_peptide EU306727_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306728_HBx_P-C Product feature CHAIN EU306728_HBx_P-C of FT:mat_peptide EU306728_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU306729_HBx_P-C Product feature CHAIN EU306729_HBx_P-C of FT:mat_peptide EU306729_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU410079_HBx_P-C Product feature CHAIN EU410079_HBx_P-C of FT:mat_peptide EU410079_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCXFFTSA
>gnl|hbvpro|EU410080_HBx_P-C Product feature CHAIN EU410080_HBx_P-C of FT:mat_peptide EU410080_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|EU410081_HBx_P-C Product feature CHAIN EU410081_HBx_P-C of FT:mat_peptide EU410081_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|EU439005_HBx_P-C Product feature CHAIN EU439005_HBx_P-C of FT:mat_peptide EU439005_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLGAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439009_HBx_P-C Product feature CHAIN EU439009_HBx_P-C of FT:mat_peptide EU439009_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSSRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439010_HBx_P-C Product feature CHAIN EU439010_HBx_P-C of FT:mat_peptide EU439010_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVDAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439011_HBx_P-C Product feature CHAIN EU439011_HBx_P-C of FT:mat_peptide EU439011_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439012_HBx_P-C Product feature CHAIN EU439012_HBx_P-C of FT:mat_peptide EU439012_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439013_HBx_P-C Product feature CHAIN EU439013_HBx_P-C of FT:mat_peptide EU439013_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439014_HBx_P-C Product feature CHAIN EU439014_HBx_P-C of FT:mat_peptide EU439014_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439015_HBx_P-C Product feature CHAIN EU439015_HBx_P-C of FT:mat_peptide EU439015_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCHLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU439016_HBx_P-C Product feature CHAIN EU439016_HBx_P-C of FT:mat_peptide EU439016_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPGNFFTSA
>gnl|hbvpro|EU439025_HBx_P-C Product feature CHAIN EU439025_HBx_P-C of FT:mat_peptide EU439025_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU498227_HBx_P-C Product feature CHAIN EU498227_HBx_P-C of FT:mat_peptide EU498227_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JL). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFRDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU522068_HBx_P-C Product feature CHAIN EU522068_HBx_P-C of FT:mat_peptide EU522068_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5N). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU522069_HBx_P-C Product feature CHAIN EU522069_HBx_P-C of FT:mat_peptide EU522069_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5T). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNIHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU522071_HBx_P-C Product feature CHAIN EU522071_HBx_P-C of FT:mat_peptide EU522071_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 7T). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGHLSSPSVSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTGLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU547559_HBx_P-C Product feature CHAIN EU547559_HBx_P-C of FT:mat_peptide EU547559_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MC02). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAEXSGRPVSGPFGNLPSPSXSAVPADHGTHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|EU547562_HBx_P-C Product feature CHAIN EU547562_HBx_P-C of FT:mat_peptide EU547562_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MC05). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPPSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|EU554535_HBx_P-C Product feature CHAIN EU554535_HBx_P-C of FT:mat_peptide EU554535_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSFAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU554536_HBx_P-C Product feature CHAIN EU554536_HBx_P-C of FT:mat_peptide EU554536_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVSAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU554537_HBx_P-C Product feature CHAIN EU554537_HBx_P-C of FT:mat_peptide EU554537_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU554538_HBx_P-C Product feature CHAIN EU554538_HBx_P-C of FT:mat_peptide EU554538_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU554539_HBx_P-C Product feature CHAIN EU554539_HBx_P-C of FT:mat_peptide EU554539_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU554540_HBx_P-C Product feature CHAIN EU554540_HBx_P-C of FT:mat_peptide EU554540_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S304-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU554541_HBx_P-C Product feature CHAIN EU554541_HBx_P-C of FT:mat_peptide EU554541_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU554542_HBx_P-C Product feature CHAIN EU554542_HBx_P-C of FT:mat_peptide EU554542_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU560438_HBx_P-C Product feature CHAIN EU560438_HBx_P-C of FT:mat_peptide EU560438_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2-B74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCYQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCAFKDWEESGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU560439_HBx_P-C Product feature CHAIN EU560439_HBx_P-C of FT:mat_peptide EU560439_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-B74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU560440_HBx_P-C Product feature CHAIN EU560440_HBx_P-C of FT:mat_peptide EU560440_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-S869). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPPRDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU560441_HBx_P-C Product feature CHAIN EU560441_HBx_P-C of FT:mat_peptide EU560441_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4-S869). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU562215_HBx_P-C Product feature CHAIN EU562215_HBx_P-C of FT:mat_peptide EU562215_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU562216_HBx_P-C Product feature CHAIN EU562216_HBx_P-C of FT:mat_peptide EU562216_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU562217_HBx_P-C Product feature CHAIN EU562217_HBx_P-C of FT:mat_peptide EU562217_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVPEPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU562218_HBx_P-C Product feature CHAIN EU562218_HBx_P-C of FT:mat_peptide EU562218_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU570067_HBx_P-C Product feature CHAIN EU570067_HBx_P-C of FT:mat_peptide EU570067_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18-S541). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRSTSARRME
TTVNTRLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU570068_HBx_P-C Product feature CHAIN EU570068_HBx_P-C of FT:mat_peptide EU570068_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26-S541). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRLE
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU570072_HBx_P-C Product feature CHAIN EU570072_HBx_P-C of FT:mat_peptide EU570072_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-B74). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU570073_HBx_P-C Product feature CHAIN EU570073_HBx_P-C of FT:mat_peptide EU570073_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8-S698). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU570074_HBx_P-C Product feature CHAIN EU570074_HBx_P-C of FT:mat_peptide EU570074_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11-S698). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU579442_HBx_P-C Product feature CHAIN EU579442_HBx_P-C of FT:mat_peptide EU579442_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU579443_HBx_P-C Product feature CHAIN EU579443_HBx_P-C of FT:mat_peptide EU579443_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU589336_HBx_P-C Product feature CHAIN EU589336_HBx_P-C of FT:mat_peptide EU589336_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1175-1). Complete genome. [Hepadnaviridae] (length=153 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPPCNFFTSA
>gnl|hbvpro|EU589340_HBx_P-C Product feature CHAIN EU589340_HBx_P-C of FT:mat_peptide EU589340_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-7). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU589341_HBx_P-C Product feature CHAIN EU589341_HBx_P-C of FT:mat_peptide EU589341_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-10). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSS
>gnl|hbvpro|EU589342_HBx_P-C Product feature CHAIN EU589342_HBx_P-C of FT:mat_peptide EU589342_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-13). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU589345_HBx_P-C Product feature CHAIN EU589345_HBx_P-C of FT:mat_peptide EU589345_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S624-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU670263_HBx_P-C Product feature CHAIN EU670263_HBx_P-C of FT:mat_peptide EU670263_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU717212_HBx_P-C Product feature CHAIN EU717212_HBx_P-C of FT:mat_peptide EU717212_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D26K-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU717214_HBx_P-C Product feature CHAIN EU717214_HBx_P-C of FT:mat_peptide EU717214_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G62K-8). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU717215_HBx_P-C Product feature CHAIN EU717215_HBx_P-C of FT:mat_peptide EU717215_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q67K-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGVESRGRPVSGPSGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU717217_HBx_P-C Product feature CHAIN EU717217_HBx_P-C of FT:mat_peptide EU717217_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q53K-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVSADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU717218_HBx_P-C Product feature CHAIN EU717218_HBx_P-C of FT:mat_peptide EU717218_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 107-3/C8). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU796069_HBx_P-C Product feature CHAIN EU796069_HBx_P-C of FT:mat_peptide EU796069_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871969_HBx_P-C Product feature CHAIN EU871969_HBx_P-C of FT:mat_peptide EU871969_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLTAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871970_HBx_P-C Product feature CHAIN EU871970_HBx_P-C of FT:mat_peptide EU871970_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADRGAHLSLRGLPVCAFSSVGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871971_HBx_P-C Product feature CHAIN EU871971_HBx_P-C of FT:mat_peptide EU871971_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871972_HBx_P-C Product feature CHAIN EU871972_HBx_P-C of FT:mat_peptide EU871972_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871973_HBx_P-C Product feature CHAIN EU871973_HBx_P-C of FT:mat_peptide EU871973_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-99-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871974_HBx_P-C Product feature CHAIN EU871974_HBx_P-C of FT:mat_peptide EU871974_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDREELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871975_HBx_P-C Product feature CHAIN EU871975_HBx_P-C of FT:mat_peptide EU871975_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871976_HBx_P-C Product feature CHAIN EU871976_HBx_P-C of FT:mat_peptide EU871976_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-04-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871977_HBx_P-C Product feature CHAIN EU871977_HBx_P-C of FT:mat_peptide EU871977_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871978_HBx_P-C Product feature CHAIN EU871978_HBx_P-C of FT:mat_peptide EU871978_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871979_HBx_P-C Product feature CHAIN EU871979_HBx_P-C of FT:mat_peptide EU871979_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871980_HBx_P-C Product feature CHAIN EU871980_HBx_P-C of FT:mat_peptide EU871980_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-01-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871982_HBx_P-C Product feature CHAIN EU871982_HBx_P-C of FT:mat_peptide EU871982_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-96-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU871998_HBx_P-C Product feature CHAIN EU871998_HBx_P-C of FT:mat_peptide EU871998_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-00-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU872000_HBx_P-C Product feature CHAIN EU872000_HBx_P-C of FT:mat_peptide EU872000_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU872001_HBx_P-C Product feature CHAIN EU872001_HBx_P-C of FT:mat_peptide EU872001_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU872002_HBx_P-C Product feature CHAIN EU872002_HBx_P-C of FT:mat_peptide EU872002_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU872003_HBx_P-C Product feature CHAIN EU872003_HBx_P-C of FT:mat_peptide EU872003_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTIDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU872004_HBx_P-C Product feature CHAIN EU872004_HBx_P-C of FT:mat_peptide EU872004_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU872005_HBx_P-C Product feature CHAIN EU872005_HBx_P-C of FT:mat_peptide EU872005_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-96-1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU872008_HBx_P-C Product feature CHAIN EU872008_HBx_P-C of FT:mat_peptide EU872008_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252A-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU872012_HBx_P-C Product feature CHAIN EU872012_HBx_P-C of FT:mat_peptide EU872012_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-99-5). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYSKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU872013_HBx_P-C Product feature CHAIN EU872013_HBx_P-C of FT:mat_peptide EU872013_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-99-6). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWGELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU881996_HBx_P-C Product feature CHAIN EU881996_HBx_P-C of FT:mat_peptide EU881996_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU881999_HBx_P-C Product feature CHAIN EU881999_HBx_P-C of FT:mat_peptide EU881999_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient19). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU882000_HBx_P-C Product feature CHAIN EU882000_HBx_P-C of FT:mat_peptide EU882000_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient19). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU882005_HBx_P-C Product feature CHAIN EU882005_HBx_P-C of FT:mat_peptide EU882005_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient22). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFRDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916210_HBx_P-C Product feature CHAIN EU916210_HBx_P-C of FT:mat_peptide EU916210_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2.4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916211_HBx_P-C Product feature CHAIN EU916211_HBx_P-C of FT:mat_peptide EU916211_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916212_HBx_P-C Product feature CHAIN EU916212_HBx_P-C of FT:mat_peptide EU916212_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916213_HBx_P-C Product feature CHAIN EU916213_HBx_P-C of FT:mat_peptide EU916213_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916214_HBx_P-C Product feature CHAIN EU916214_HBx_P-C of FT:mat_peptide EU916214_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.4). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVWCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916215_HBx_P-C Product feature CHAIN EU916215_HBx_P-C of FT:mat_peptide EU916215_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVSAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916216_HBx_P-C Product feature CHAIN EU916216_HBx_P-C of FT:mat_peptide EU916216_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916217_HBx_P-C Product feature CHAIN EU916217_HBx_P-C of FT:mat_peptide EU916217_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916218_HBx_P-C Product feature CHAIN EU916218_HBx_P-C of FT:mat_peptide EU916218_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPISAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916219_HBx_P-C Product feature CHAIN EU916219_HBx_P-C of FT:mat_peptide EU916219_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALCFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIWLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916222_HBx_P-C Product feature CHAIN EU916222_HBx_P-C of FT:mat_peptide EU916222_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916223_HBx_P-C Product feature CHAIN EU916223_HBx_P-C of FT:mat_peptide EU916223_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|EU916224_HBx_P-C Product feature CHAIN EU916224_HBx_P-C of FT:mat_peptide EU916224_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916225_HBx_P-C Product feature CHAIN EU916225_HBx_P-C of FT:mat_peptide EU916225_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHRAHLSLRGLPVCAFSSAGPCALRFTSARRTE
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916226_HBx_P-C Product feature CHAIN EU916226_HBx_P-C of FT:mat_peptide EU916226_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916227_HBx_P-C Product feature CHAIN EU916227_HBx_P-C of FT:mat_peptide EU916227_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVLVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916229_HBx_P-C Product feature CHAIN EU916229_HBx_P-C of FT:mat_peptide EU916229_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPLSGPFGPLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916233_HBx_P-C Product feature CHAIN EU916233_HBx_P-C of FT:mat_peptide EU916233_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKALHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916234_HBx_P-C Product feature CHAIN EU916234_HBx_P-C of FT:mat_peptide EU916234_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916237_HBx_P-C Product feature CHAIN EU916237_HBx_P-C of FT:mat_peptide EU916237_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU916238_HBx_P-C Product feature CHAIN EU916238_HBx_P-C of FT:mat_peptide EU916238_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919164_HBx_P-C Product feature CHAIN EU919164_HBx_P-C of FT:mat_peptide EU919164_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient24). Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919165_HBx_P-C Product feature CHAIN EU919165_HBx_P-C of FT:mat_peptide EU919165_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient24). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919168_HBx_P-C Product feature CHAIN EU919168_HBx_P-C of FT:mat_peptide EU919168_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSADPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU919169_HBx_P-C Product feature CHAIN EU919169_HBx_P-C of FT:mat_peptide EU919169_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPGMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939536_HBx_P-C Product feature CHAIN EU939536_HBx_P-C of FT:mat_peptide EU939536_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVIGGCRHKLVCSPAPWNFFTSA
>gnl|hbvpro|EU939537_HBx_P-C Product feature CHAIN EU939537_HBx_P-C of FT:mat_peptide EU939537_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939538_HBx_P-C Product feature CHAIN EU939538_HBx_P-C of FT:mat_peptide EU939538_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939539_HBx_P-C Product feature CHAIN EU939539_HBx_P-C of FT:mat_peptide EU939539_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEEFGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939540_HBx_P-C Product feature CHAIN EU939540_HBx_P-C of FT:mat_peptide EU939540_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939541_HBx_P-C Product feature CHAIN EU939541_HBx_P-C of FT:mat_peptide EU939541_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPSRDVLCIRPVGAESRGRPVSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSPRRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939542_HBx_P-C Product feature CHAIN EU939542_HBx_P-C of FT:mat_peptide EU939542_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHRALPKVLHKRTLGLPALSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU939543_HBx_P-C Product feature CHAIN EU939543_HBx_P-C of FT:mat_peptide EU939543_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRLCCQMDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939544_HBx_P-C Product feature CHAIN EU939544_HBx_P-C of FT:mat_peptide EU939544_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939545_HBx_P-C Product feature CHAIN EU939545_HBx_P-C of FT:mat_peptide EU939545_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGNLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939546_HBx_P-C Product feature CHAIN EU939546_HBx_P-C of FT:mat_peptide EU939546_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSFFAVPANLGAHLSLRGLPVCALSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939549_HBx_P-C Product feature CHAIN EU939549_HBx_P-C of FT:mat_peptide EU939549_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C49). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939550_HBx_P-C Product feature CHAIN EU939550_HBx_P-C of FT:mat_peptide EU939550_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEGLGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939552_HBx_P-C Product feature CHAIN EU939552_HBx_P-C of FT:mat_peptide EU939552_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939553_HBx_P-C Product feature CHAIN EU939553_HBx_P-C of FT:mat_peptide EU939553_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C60). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTPA
>gnl|hbvpro|EU939554_HBx_P-C Product feature CHAIN EU939554_HBx_P-C of FT:mat_peptide EU939554_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C61). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCYFFTSA
>gnl|hbvpro|EU939555_HBx_P-C Product feature CHAIN EU939555_HBx_P-C of FT:mat_peptide EU939555_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C63). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939556_HBx_P-C Product feature CHAIN EU939556_HBx_P-C of FT:mat_peptide EU939556_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEEELGEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939557_HBx_P-C Product feature CHAIN EU939557_HBx_P-C of FT:mat_peptide EU939557_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C65). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTCARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939558_HBx_P-C Product feature CHAIN EU939558_HBx_P-C of FT:mat_peptide EU939558_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C66). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTIGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939560_HBx_P-C Product feature CHAIN EU939560_HBx_P-C of FT:mat_peptide EU939560_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C69). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMFIVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939561_HBx_P-C Product feature CHAIN EU939561_HBx_P-C of FT:mat_peptide EU939561_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C70). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939562_HBx_P-C Product feature CHAIN EU939562_HBx_P-C of FT:mat_peptide EU939562_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939563_HBx_P-C Product feature CHAIN EU939563_HBx_P-C of FT:mat_peptide EU939563_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939564_HBx_P-C Product feature CHAIN EU939564_HBx_P-C of FT:mat_peptide EU939564_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C77). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEVSGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939566_HBx_P-C Product feature CHAIN EU939566_HBx_P-C of FT:mat_peptide EU939566_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C88). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939567_HBx_P-C Product feature CHAIN EU939567_HBx_P-C of FT:mat_peptide EU939567_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C91). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939568_HBx_P-C Product feature CHAIN EU939568_HBx_P-C of FT:mat_peptide EU939568_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C93). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939569_HBx_P-C Product feature CHAIN EU939569_HBx_P-C of FT:mat_peptide EU939569_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C102). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939570_HBx_P-C Product feature CHAIN EU939570_HBx_P-C of FT:mat_peptide EU939570_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939571_HBx_P-C Product feature CHAIN EU939571_HBx_P-C of FT:mat_peptide EU939571_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939572_HBx_P-C Product feature CHAIN EU939572_HBx_P-C of FT:mat_peptide EU939572_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939573_HBx_P-C Product feature CHAIN EU939573_HBx_P-C of FT:mat_peptide EU939573_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGSFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939574_HBx_P-C Product feature CHAIN EU939574_HBx_P-C of FT:mat_peptide EU939574_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C109). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939576_HBx_P-C Product feature CHAIN EU939576_HBx_P-C of FT:mat_peptide EU939576_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C115). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939578_HBx_P-C Product feature CHAIN EU939578_HBx_P-C of FT:mat_peptide EU939578_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C119). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTVHGENLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939579_HBx_P-C Product feature CHAIN EU939579_HBx_P-C of FT:mat_peptide EU939579_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939580_HBx_P-C Product feature CHAIN EU939580_HBx_P-C of FT:mat_peptide EU939580_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939582_HBx_P-C Product feature CHAIN EU939582_HBx_P-C of FT:mat_peptide EU939582_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939583_HBx_P-C Product feature CHAIN EU939583_HBx_P-C of FT:mat_peptide EU939583_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B31). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939584_HBx_P-C Product feature CHAIN EU939584_HBx_P-C of FT:mat_peptide EU939584_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B107). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSANPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLQAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|EU939585_HBx_P-C Product feature CHAIN EU939585_HBx_P-C of FT:mat_peptide EU939585_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939587_HBx_P-C Product feature CHAIN EU939587_HBx_P-C of FT:mat_peptide EU939587_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939588_HBx_P-C Product feature CHAIN EU939588_HBx_P-C of FT:mat_peptide EU939588_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPVGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939590_HBx_P-C Product feature CHAIN EU939590_HBx_P-C of FT:mat_peptide EU939590_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLATMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939591_HBx_P-C Product feature CHAIN EU939591_HBx_P-C of FT:mat_peptide EU939591_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C131). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLATMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939592_HBx_P-C Product feature CHAIN EU939592_HBx_P-C of FT:mat_peptide EU939592_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C141). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939593_HBx_P-C Product feature CHAIN EU939593_HBx_P-C of FT:mat_peptide EU939593_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C144). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939594_HBx_P-C Product feature CHAIN EU939594_HBx_P-C of FT:mat_peptide EU939594_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C146). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939595_HBx_P-C Product feature CHAIN EU939595_HBx_P-C of FT:mat_peptide EU939595_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C147). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSVSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939596_HBx_P-C Product feature CHAIN EU939596_HBx_P-C of FT:mat_peptide EU939596_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C149). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939597_HBx_P-C Product feature CHAIN EU939597_HBx_P-C of FT:mat_peptide EU939597_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C151). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVLKDWEELGEEIRLMIFVLGGCRHKLVCSPVPCNFFTSA
>gnl|hbvpro|EU939599_HBx_P-C Product feature CHAIN EU939599_HBx_P-C of FT:mat_peptide EU939599_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C172). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939600_HBx_P-C Product feature CHAIN EU939600_HBx_P-C of FT:mat_peptide EU939600_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C176). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939601_HBx_P-C Product feature CHAIN EU939601_HBx_P-C of FT:mat_peptide EU939601_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C177). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939603_HBx_P-C Product feature CHAIN EU939603_HBx_P-C of FT:mat_peptide EU939603_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C183). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939604_HBx_P-C Product feature CHAIN EU939604_HBx_P-C of FT:mat_peptide EU939604_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C192). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939605_HBx_P-C Product feature CHAIN EU939605_HBx_P-C of FT:mat_peptide EU939605_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C200). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939607_HBx_P-C Product feature CHAIN EU939607_HBx_P-C of FT:mat_peptide EU939607_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939609_HBx_P-C Product feature CHAIN EU939609_HBx_P-C of FT:mat_peptide EU939609_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C209). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939610_HBx_P-C Product feature CHAIN EU939610_HBx_P-C of FT:mat_peptide EU939610_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C211). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHQRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939611_HBx_P-C Product feature CHAIN EU939611_HBx_P-C of FT:mat_peptide EU939611_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C212). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939612_HBx_P-C Product feature CHAIN EU939612_HBx_P-C of FT:mat_peptide EU939612_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C213). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939613_HBx_P-C Product feature CHAIN EU939613_HBx_P-C of FT:mat_peptide EU939613_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C214). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939614_HBx_P-C Product feature CHAIN EU939614_HBx_P-C of FT:mat_peptide EU939614_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C217). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939615_HBx_P-C Product feature CHAIN EU939615_HBx_P-C of FT:mat_peptide EU939615_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939616_HBx_P-C Product feature CHAIN EU939616_HBx_P-C of FT:mat_peptide EU939616_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C228). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSXAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939617_HBx_P-C Product feature CHAIN EU939617_HBx_P-C of FT:mat_peptide EU939617_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C229). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939618_HBx_P-C Product feature CHAIN EU939618_HBx_P-C of FT:mat_peptide EU939618_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C230). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939619_HBx_P-C Product feature CHAIN EU939619_HBx_P-C of FT:mat_peptide EU939619_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C233). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTMNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939625_HBx_P-C Product feature CHAIN EU939625_HBx_P-C of FT:mat_peptide EU939625_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C167). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939640_HBx_P-C Product feature CHAIN EU939640_HBx_P-C of FT:mat_peptide EU939640_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C239). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939641_HBx_P-C Product feature CHAIN EU939641_HBx_P-C of FT:mat_peptide EU939641_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D18). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939642_HBx_P-C Product feature CHAIN EU939642_HBx_P-C of FT:mat_peptide EU939642_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D20). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPIGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939643_HBx_P-C Product feature CHAIN EU939643_HBx_P-C of FT:mat_peptide EU939643_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D32). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939644_HBx_P-C Product feature CHAIN EU939644_HBx_P-C of FT:mat_peptide EU939644_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939645_HBx_P-C Product feature CHAIN EU939645_HBx_P-C of FT:mat_peptide EU939645_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D38). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939646_HBx_P-C Product feature CHAIN EU939646_HBx_P-C of FT:mat_peptide EU939646_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D88). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939647_HBx_P-C Product feature CHAIN EU939647_HBx_P-C of FT:mat_peptide EU939647_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939648_HBx_P-C Product feature CHAIN EU939648_HBx_P-C of FT:mat_peptide EU939648_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D96). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939649_HBx_P-C Product feature CHAIN EU939649_HBx_P-C of FT:mat_peptide EU939649_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D98). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939651_HBx_P-C Product feature CHAIN EU939651_HBx_P-C of FT:mat_peptide EU939651_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939652_HBx_P-C Product feature CHAIN EU939652_HBx_P-C of FT:mat_peptide EU939652_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939653_HBx_P-C Product feature CHAIN EU939653_HBx_P-C of FT:mat_peptide EU939653_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGALPSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939654_HBx_P-C Product feature CHAIN EU939654_HBx_P-C of FT:mat_peptide EU939654_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D115). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939655_HBx_P-C Product feature CHAIN EU939655_HBx_P-C of FT:mat_peptide EU939655_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIYVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|EU939656_HBx_P-C Product feature CHAIN EU939656_HBx_P-C of FT:mat_peptide EU939656_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D117). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939657_HBx_P-C Product feature CHAIN EU939657_HBx_P-C of FT:mat_peptide EU939657_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D139). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939658_HBx_P-C Product feature CHAIN EU939658_HBx_P-C of FT:mat_peptide EU939658_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D142). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|EU939659_HBx_P-C Product feature CHAIN EU939659_HBx_P-C of FT:mat_peptide EU939659_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023639_HBx_P-C Product feature CHAIN FJ023639_HBx_P-C of FT:mat_peptide FJ023639_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-0968). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023640_HBx_P-C Product feature CHAIN FJ023640_HBx_P-C of FT:mat_peptide FJ023640_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1206). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023641_HBx_P-C Product feature CHAIN FJ023641_HBx_P-C of FT:mat_peptide FJ023641_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1237). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ023642_HBx_P-C Product feature CHAIN FJ023642_HBx_P-C of FT:mat_peptide FJ023642_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1257). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|FJ023643_HBx_P-C Product feature CHAIN FJ023643_HBx_P-C of FT:mat_peptide FJ023643_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1306). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSTIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023644_HBx_P-C Product feature CHAIN FJ023644_HBx_P-C of FT:mat_peptide FJ023644_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1318). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSTIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023645_HBx_P-C Product feature CHAIN FJ023645_HBx_P-C of FT:mat_peptide FJ023645_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0071). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023646_HBx_P-C Product feature CHAIN FJ023646_HBx_P-C of FT:mat_peptide FJ023646_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0201). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNASQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023647_HBx_P-C Product feature CHAIN FJ023647_HBx_P-C of FT:mat_peptide FJ023647_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0214). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023648_HBx_P-C Product feature CHAIN FJ023648_HBx_P-C of FT:mat_peptide FJ023648_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0273). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023649_HBx_P-C Product feature CHAIN FJ023649_HBx_P-C of FT:mat_peptide FJ023649_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0289). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023650_HBx_P-C Product feature CHAIN FJ023650_HBx_P-C of FT:mat_peptide FJ023650_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0341). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023651_HBx_P-C Product feature CHAIN FJ023651_HBx_P-C of FT:mat_peptide FJ023651_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0391). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVRAESRGRPLSGPFGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ023652_HBx_P-C Product feature CHAIN FJ023652_HBx_P-C of FT:mat_peptide FJ023652_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0648). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023653_HBx_P-C Product feature CHAIN FJ023653_HBx_P-C of FT:mat_peptide FJ023653_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0909). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023654_HBx_P-C Product feature CHAIN FJ023654_HBx_P-C of FT:mat_peptide FJ023654_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1412). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023655_HBx_P-C Product feature CHAIN FJ023655_HBx_P-C of FT:mat_peptide FJ023655_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0754). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023656_HBx_P-C Product feature CHAIN FJ023656_HBx_P-C of FT:mat_peptide FJ023656_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0938). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023657_HBx_P-C Product feature CHAIN FJ023657_HBx_P-C of FT:mat_peptide FJ023657_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0987). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023658_HBx_P-C Product feature CHAIN FJ023658_HBx_P-C of FT:mat_peptide FJ023658_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-1116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVRAESRGRPLSGPFGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ023677_HBx_P-C Product feature CHAIN FJ023677_HBx_P-C of FT:mat_peptide FJ023677_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1/I2_M04-0309). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDILCLRPVGAESSGRPLSGPLGDLPSPSSSAVPAIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHLTLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032331_HBx_P-C Product feature CHAIN FJ032331_HBx_P-C of FT:mat_peptide FJ032331_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S193-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDSLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032332_HBx_P-C Product feature CHAIN FJ032332_HBx_P-C of FT:mat_peptide FJ032332_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032333_HBx_P-C Product feature CHAIN FJ032333_HBx_P-C of FT:mat_peptide FJ032333_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032334_HBx_P-C Product feature CHAIN FJ032334_HBx_P-C of FT:mat_peptide FJ032334_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S445-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032336_HBx_P-C Product feature CHAIN FJ032336_HBx_P-C of FT:mat_peptide FJ032336_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032338_HBx_P-C Product feature CHAIN FJ032338_HBx_P-C of FT:mat_peptide FJ032338_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032339_HBx_P-C Product feature CHAIN FJ032339_HBx_P-C of FT:mat_peptide FJ032339_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032340_HBx_P-C Product feature CHAIN FJ032340_HBx_P-C of FT:mat_peptide FJ032340_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032341_HBx_P-C Product feature CHAIN FJ032341_HBx_P-C of FT:mat_peptide FJ032341_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032345_HBx_P-C Product feature CHAIN FJ032345_HBx_P-C of FT:mat_peptide FJ032345_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032346_HBx_P-C Product feature CHAIN FJ032346_HBx_P-C of FT:mat_peptide FJ032346_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADLGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032347_HBx_P-C Product feature CHAIN FJ032347_HBx_P-C of FT:mat_peptide FJ032347_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032350_HBx_P-C Product feature CHAIN FJ032350_HBx_P-C of FT:mat_peptide FJ032350_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032351_HBx_P-C Product feature CHAIN FJ032351_HBx_P-C of FT:mat_peptide FJ032351_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032355_HBx_P-C Product feature CHAIN FJ032355_HBx_P-C of FT:mat_peptide FJ032355_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032356_HBx_P-C Product feature CHAIN FJ032356_HBx_P-C of FT:mat_peptide FJ032356_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032359_HBx_P-C Product feature CHAIN FJ032359_HBx_P-C of FT:mat_peptide FJ032359_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032360_HBx_P-C Product feature CHAIN FJ032360_HBx_P-C of FT:mat_peptide FJ032360_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGGEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ032361_HBx_P-C Product feature CHAIN FJ032361_HBx_P-C of FT:mat_peptide FJ032361_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ151413_HBx_P-C Product feature CHAIN FJ151413_HBx_P-C of FT:mat_peptide FJ151413_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ349225_HBx_P-C Product feature CHAIN FJ349225_HBx_P-C of FT:mat_peptide FJ349225_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H94). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRVNVFVLGGCPHKLVCLPAPCNFFTSA
>gnl|hbvpro|FJ386574_HBx_P-C Product feature CHAIN FJ386574_HBx_P-C of FT:mat_peptide FJ386574_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1743). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386575_HBx_P-C Product feature CHAIN FJ386575_HBx_P-C of FT:mat_peptide FJ386575_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1745). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPAHHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ386576_HBx_P-C Product feature CHAIN FJ386576_HBx_P-C of FT:mat_peptide FJ386576_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1746). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386577_HBx_P-C Product feature CHAIN FJ386577_HBx_P-C of FT:mat_peptide FJ386577_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1747). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386579_HBx_P-C Product feature CHAIN FJ386579_HBx_P-C of FT:mat_peptide FJ386579_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1762). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386587_HBx_P-C Product feature CHAIN FJ386587_HBx_P-C of FT:mat_peptide FJ386587_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1812). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386588_HBx_P-C Product feature CHAIN FJ386588_HBx_P-C of FT:mat_peptide FJ386588_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1828). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386589_HBx_P-C Product feature CHAIN FJ386589_HBx_P-C of FT:mat_peptide FJ386589_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1830). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVSAEPSGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386591_HBx_P-C Product feature CHAIN FJ386591_HBx_P-C of FT:mat_peptide FJ386591_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1869). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386592_HBx_P-C Product feature CHAIN FJ386592_HBx_P-C of FT:mat_peptide FJ386592_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1870). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386594_HBx_P-C Product feature CHAIN FJ386594_HBx_P-C of FT:mat_peptide FJ386594_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1878). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386595_HBx_P-C Product feature CHAIN FJ386595_HBx_P-C of FT:mat_peptide FJ386595_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1879). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386596_HBx_P-C Product feature CHAIN FJ386596_HBx_P-C of FT:mat_peptide FJ386596_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1887). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386597_HBx_P-C Product feature CHAIN FJ386597_HBx_P-C of FT:mat_peptide FJ386597_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1888). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|FJ386598_HBx_P-C Product feature CHAIN FJ386598_HBx_P-C of FT:mat_peptide FJ386598_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1889). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386601_HBx_P-C Product feature CHAIN FJ386601_HBx_P-C of FT:mat_peptide FJ386601_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1912). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386602_HBx_P-C Product feature CHAIN FJ386602_HBx_P-C of FT:mat_peptide FJ386602_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1914). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386603_HBx_P-C Product feature CHAIN FJ386603_HBx_P-C of FT:mat_peptide FJ386603_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1949). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLCCAPAPCNFFTSA
>gnl|hbvpro|FJ386604_HBx_P-C Product feature CHAIN FJ386604_HBx_P-C of FT:mat_peptide FJ386604_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1950). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386605_HBx_P-C Product feature CHAIN FJ386605_HBx_P-C of FT:mat_peptide FJ386605_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1965). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPPASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386607_HBx_P-C Product feature CHAIN FJ386607_HBx_P-C of FT:mat_peptide FJ386607_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1967). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386609_HBx_P-C Product feature CHAIN FJ386609_HBx_P-C of FT:mat_peptide FJ386609_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386611_HBx_P-C Product feature CHAIN FJ386611_HBx_P-C of FT:mat_peptide FJ386611_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPFCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVLKDWEELGEENRAKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386612_HBx_P-C Product feature CHAIN FJ386612_HBx_P-C of FT:mat_peptide FJ386612_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2019). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386613_HBx_P-C Product feature CHAIN FJ386613_HBx_P-C of FT:mat_peptide FJ386613_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2039). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLLIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386614_HBx_P-C Product feature CHAIN FJ386614_HBx_P-C of FT:mat_peptide FJ386614_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2040). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ386616_HBx_P-C Product feature CHAIN FJ386616_HBx_P-C of FT:mat_peptide FJ386616_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2064). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386617_HBx_P-C Product feature CHAIN FJ386617_HBx_P-C of FT:mat_peptide FJ386617_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2093). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386618_HBx_P-C Product feature CHAIN FJ386618_HBx_P-C of FT:mat_peptide FJ386618_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2111). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEITLILCGLRGCRNKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386619_HBx_P-C Product feature CHAIN FJ386619_HBx_P-C of FT:mat_peptide FJ386619_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2119). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386620_HBx_P-C Product feature CHAIN FJ386620_HBx_P-C of FT:mat_peptide FJ386620_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386621_HBx_P-C Product feature CHAIN FJ386621_HBx_P-C of FT:mat_peptide FJ386621_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2123). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386623_HBx_P-C Product feature CHAIN FJ386623_HBx_P-C of FT:mat_peptide FJ386623_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386624_HBx_P-C Product feature CHAIN FJ386624_HBx_P-C of FT:mat_peptide FJ386624_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2187). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386625_HBx_P-C Product feature CHAIN FJ386625_HBx_P-C of FT:mat_peptide FJ386625_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2190). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386626_HBx_P-C Product feature CHAIN FJ386626_HBx_P-C of FT:mat_peptide FJ386626_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2205). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386627_HBx_P-C Product feature CHAIN FJ386627_HBx_P-C of FT:mat_peptide FJ386627_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2242). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPXDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXVLPKVLXKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386628_HBx_P-C Product feature CHAIN FJ386628_HBx_P-C of FT:mat_peptide FJ386628_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2255). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLPSPSAPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386629_HBx_P-C Product feature CHAIN FJ386629_HBx_P-C of FT:mat_peptide FJ386629_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2286). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386630_HBx_P-C Product feature CHAIN FJ386630_HBx_P-C of FT:mat_peptide FJ386630_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2336). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386631_HBx_P-C Product feature CHAIN FJ386631_HBx_P-C of FT:mat_peptide FJ386631_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2359). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLXKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386632_HBx_P-C Product feature CHAIN FJ386632_HBx_P-C of FT:mat_peptide FJ386632_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2370). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFTDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386637_HBx_P-C Product feature CHAIN FJ386637_HBx_P-C of FT:mat_peptide FJ386637_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2151). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386638_HBx_P-C Product feature CHAIN FJ386638_HBx_P-C of FT:mat_peptide FJ386638_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2015). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSSSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLXCSPAPCNFFTSA
>gnl|hbvpro|FJ386639_HBx_P-C Product feature CHAIN FJ386639_HBx_P-C of FT:mat_peptide FJ386639_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1929). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386640_HBx_P-C Product feature CHAIN FJ386640_HBx_P-C of FT:mat_peptide FJ386640_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2168). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLYNRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386641_HBx_P-C Product feature CHAIN FJ386641_HBx_P-C of FT:mat_peptide FJ386641_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2236). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386644_HBx_P-C Product feature CHAIN FJ386644_HBx_P-C of FT:mat_peptide FJ386644_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S737). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVIGGCRHKLVCSPAPCKFFTFA
>gnl|hbvpro|FJ386645_HBx_P-C Product feature CHAIN FJ386645_HBx_P-C of FT:mat_peptide FJ386645_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S897). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386647_HBx_P-C Product feature CHAIN FJ386647_HBx_P-C of FT:mat_peptide FJ386647_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2400). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386650_HBx_P-C Product feature CHAIN FJ386650_HBx_P-C of FT:mat_peptide FJ386650_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2468). Non-functional genomic sequence. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGDCRHKLVCSPAPCNFFTSAY
>gnl|hbvpro|FJ386651_HBx_P-C Product feature CHAIN FJ386651_HBx_P-C of FT:mat_peptide FJ386651_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2476). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGPESRGRPVPRPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386652_HBx_P-C Product feature CHAIN FJ386652_HBx_P-C of FT:mat_peptide FJ386652_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2518). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386653_HBx_P-C Product feature CHAIN FJ386653_HBx_P-C of FT:mat_peptide FJ386653_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386657_HBx_P-C Product feature CHAIN FJ386657_HBx_P-C of FT:mat_peptide FJ386657_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386659_HBx_P-C Product feature CHAIN FJ386659_HBx_P-C of FT:mat_peptide FJ386659_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S219). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386661_HBx_P-C Product feature CHAIN FJ386661_HBx_P-C of FT:mat_peptide FJ386661_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S251). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386662_HBx_P-C Product feature CHAIN FJ386662_HBx_P-C of FT:mat_peptide FJ386662_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S269). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386663_HBx_P-C Product feature CHAIN FJ386663_HBx_P-C of FT:mat_peptide FJ386663_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S307). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386664_HBx_P-C Product feature CHAIN FJ386664_HBx_P-C of FT:mat_peptide FJ386664_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S310). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPSGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386665_HBx_P-C Product feature CHAIN FJ386665_HBx_P-C of FT:mat_peptide FJ386665_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386667_HBx_P-C Product feature CHAIN FJ386667_HBx_P-C of FT:mat_peptide FJ386667_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S379). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386670_HBx_P-C Product feature CHAIN FJ386670_HBx_P-C of FT:mat_peptide FJ386670_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S454). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386671_HBx_P-C Product feature CHAIN FJ386671_HBx_P-C of FT:mat_peptide FJ386671_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S586). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386672_HBx_P-C Product feature CHAIN FJ386672_HBx_P-C of FT:mat_peptide FJ386672_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S606). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPFSGPFGPLSSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386673_HBx_P-C Product feature CHAIN FJ386673_HBx_P-C of FT:mat_peptide FJ386673_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S633). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386677_HBx_P-C Product feature CHAIN FJ386677_HBx_P-C of FT:mat_peptide FJ386677_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1104). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYNRTLGLPAMSTTDLXAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386678_HBx_P-C Product feature CHAIN FJ386678_HBx_P-C of FT:mat_peptide FJ386678_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1147). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386679_HBx_P-C Product feature CHAIN FJ386679_HBx_P-C of FT:mat_peptide FJ386679_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1217). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386685_HBx_P-C Product feature CHAIN FJ386685_HBx_P-C of FT:mat_peptide FJ386685_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1568). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ386687_HBx_P-C Product feature CHAIN FJ386687_HBx_P-C of FT:mat_peptide FJ386687_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1600). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLXCSPAPCNFFTSA
>gnl|hbvpro|FJ386689_HBx_P-C Product feature CHAIN FJ386689_HBx_P-C of FT:mat_peptide FJ386689_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1649). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIXVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ518810_HBx_P-C Product feature CHAIN FJ518810_HBx_P-C of FT:mat_peptide FJ518810_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ518813_HBx_P-C Product feature CHAIN FJ518813_HBx_P-C of FT:mat_peptide FJ518813_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562218_HBx_P-C Product feature CHAIN FJ562218_HBx_P-C of FT:mat_peptide FJ562218_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562220_HBx_P-C Product feature CHAIN FJ562220_HBx_P-C of FT:mat_peptide FJ562220_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I12). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSASTVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562221_HBx_P-C Product feature CHAIN FJ562221_HBx_P-C of FT:mat_peptide FJ562221_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562225_HBx_P-C Product feature CHAIN FJ562225_HBx_P-C of FT:mat_peptide FJ562225_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562228_HBx_P-C Product feature CHAIN FJ562228_HBx_P-C of FT:mat_peptide FJ562228_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562232_HBx_P-C Product feature CHAIN FJ562232_HBx_P-C of FT:mat_peptide FJ562232_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562233_HBx_P-C Product feature CHAIN FJ562233_HBx_P-C of FT:mat_peptide FJ562233_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562235_HBx_P-C Product feature CHAIN FJ562235_HBx_P-C of FT:mat_peptide FJ562235_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVVAESRGRPIAGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562238_HBx_P-C Product feature CHAIN FJ562238_HBx_P-C of FT:mat_peptide FJ562238_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562239_HBx_P-C Product feature CHAIN FJ562239_HBx_P-C of FT:mat_peptide FJ562239_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562241_HBx_P-C Product feature CHAIN FJ562241_HBx_P-C of FT:mat_peptide FJ562241_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNDWEELGEEIRLQVFGLSGCRHTLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562242_HBx_P-C Product feature CHAIN FJ562242_HBx_P-C of FT:mat_peptide FJ562242_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I68). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562243_HBx_P-C Product feature CHAIN FJ562243_HBx_P-C of FT:mat_peptide FJ562243_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I71). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562244_HBx_P-C Product feature CHAIN FJ562244_HBx_P-C of FT:mat_peptide FJ562244_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I72). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562245_HBx_P-C Product feature CHAIN FJ562245_HBx_P-C of FT:mat_peptide FJ562245_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I73). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNAWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562248_HBx_P-C Product feature CHAIN FJ562248_HBx_P-C of FT:mat_peptide FJ562248_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562249_HBx_P-C Product feature CHAIN FJ562249_HBx_P-C of FT:mat_peptide FJ562249_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562250_HBx_P-C Product feature CHAIN FJ562250_HBx_P-C of FT:mat_peptide FJ562250_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSPSSSAVPTDDGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562251_HBx_P-C Product feature CHAIN FJ562251_HBx_P-C of FT:mat_peptide FJ562251_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562252_HBx_P-C Product feature CHAIN FJ562252_HBx_P-C of FT:mat_peptide FJ562252_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562255_HBx_P-C Product feature CHAIN FJ562255_HBx_P-C of FT:mat_peptide FJ562255_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562256_HBx_P-C Product feature CHAIN FJ562256_HBx_P-C of FT:mat_peptide FJ562256_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I95). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562258_HBx_P-C Product feature CHAIN FJ562258_HBx_P-C of FT:mat_peptide FJ562258_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562261_HBx_P-C Product feature CHAIN FJ562261_HBx_P-C of FT:mat_peptide FJ562261_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I109). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVIGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562264_HBx_P-C Product feature CHAIN FJ562264_HBx_P-C of FT:mat_peptide FJ562264_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYIKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562265_HBx_P-C Product feature CHAIN FJ562265_HBx_P-C of FT:mat_peptide FJ562265_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562266_HBx_P-C Product feature CHAIN FJ562266_HBx_P-C of FT:mat_peptide FJ562266_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I118). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLXAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRQKLVCSPAPCNFFTYA
>gnl|hbvpro|FJ562268_HBx_P-C Product feature CHAIN FJ562268_HBx_P-C of FT:mat_peptide FJ562268_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562269_HBx_P-C Product feature CHAIN FJ562269_HBx_P-C of FT:mat_peptide FJ562269_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562270_HBx_P-C Product feature CHAIN FJ562270_HBx_P-C of FT:mat_peptide FJ562270_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I123). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562272_HBx_P-C Product feature CHAIN FJ562272_HBx_P-C of FT:mat_peptide FJ562272_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I125). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562273_HBx_P-C Product feature CHAIN FJ562273_HBx_P-C of FT:mat_peptide FJ562273_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562274_HBx_P-C Product feature CHAIN FJ562274_HBx_P-C of FT:mat_peptide FJ562274_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I128). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562275_HBx_P-C Product feature CHAIN FJ562275_HBx_P-C of FT:mat_peptide FJ562275_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I129). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCTHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562276_HBx_P-C Product feature CHAIN FJ562276_HBx_P-C of FT:mat_peptide FJ562276_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I130). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562279_HBx_P-C Product feature CHAIN FJ562279_HBx_P-C of FT:mat_peptide FJ562279_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I140). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562280_HBx_P-C Product feature CHAIN FJ562280_HBx_P-C of FT:mat_peptide FJ562280_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I141). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562281_HBx_P-C Product feature CHAIN FJ562281_HBx_P-C of FT:mat_peptide FJ562281_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I143). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562282_HBx_P-C Product feature CHAIN FJ562282_HBx_P-C of FT:mat_peptide FJ562282_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I144). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFSSA
>gnl|hbvpro|FJ562283_HBx_P-C Product feature CHAIN FJ562283_HBx_P-C of FT:mat_peptide FJ562283_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I145). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562284_HBx_P-C Product feature CHAIN FJ562284_HBx_P-C of FT:mat_peptide FJ562284_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I146). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562285_HBx_P-C Product feature CHAIN FJ562285_HBx_P-C of FT:mat_peptide FJ562285_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I147). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562288_HBx_P-C Product feature CHAIN FJ562288_HBx_P-C of FT:mat_peptide FJ562288_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I153). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562290_HBx_P-C Product feature CHAIN FJ562290_HBx_P-C of FT:mat_peptide FJ562290_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I162). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCXFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562291_HBx_P-C Product feature CHAIN FJ562291_HBx_P-C of FT:mat_peptide FJ562291_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I163). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562292_HBx_P-C Product feature CHAIN FJ562292_HBx_P-C of FT:mat_peptide FJ562292_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I164). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562293_HBx_P-C Product feature CHAIN FJ562293_HBx_P-C of FT:mat_peptide FJ562293_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I167). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562295_HBx_P-C Product feature CHAIN FJ562295_HBx_P-C of FT:mat_peptide FJ562295_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I169). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562297_HBx_P-C Product feature CHAIN FJ562297_HBx_P-C of FT:mat_peptide FJ562297_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I172). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562298_HBx_P-C Product feature CHAIN FJ562298_HBx_P-C of FT:mat_peptide FJ562298_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I174). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRTFGPLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562299_HBx_P-C Product feature CHAIN FJ562299_HBx_P-C of FT:mat_peptide FJ562299_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I175). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562300_HBx_P-C Product feature CHAIN FJ562300_HBx_P-C of FT:mat_peptide FJ562300_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I182). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSVSGPFGGLPSPSLSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562301_HBx_P-C Product feature CHAIN FJ562301_HBx_P-C of FT:mat_peptide FJ562301_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I185). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562304_HBx_P-C Product feature CHAIN FJ562304_HBx_P-C of FT:mat_peptide FJ562304_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I190). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562306_HBx_P-C Product feature CHAIN FJ562306_HBx_P-C of FT:mat_peptide FJ562306_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I196). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSDSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562307_HBx_P-C Product feature CHAIN FJ562307_HBx_P-C of FT:mat_peptide FJ562307_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I197). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGPLSSPSASAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562308_HBx_P-C Product feature CHAIN FJ562308_HBx_P-C of FT:mat_peptide FJ562308_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I199). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562310_HBx_P-C Product feature CHAIN FJ562310_HBx_P-C of FT:mat_peptide FJ562310_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I201). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPTDHGAHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562313_HBx_P-C Product feature CHAIN FJ562313_HBx_P-C of FT:mat_peptide FJ562313_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I204). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562315_HBx_P-C Product feature CHAIN FJ562315_HBx_P-C of FT:mat_peptide FJ562315_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I207). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562318_HBx_P-C Product feature CHAIN FJ562318_HBx_P-C of FT:mat_peptide FJ562318_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I211). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562319_HBx_P-C Product feature CHAIN FJ562319_HBx_P-C of FT:mat_peptide FJ562319_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I212). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562320_HBx_P-C Product feature CHAIN FJ562320_HBx_P-C of FT:mat_peptide FJ562320_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I213). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLDCSPAPCNFFTSA
>gnl|hbvpro|FJ562323_HBx_P-C Product feature CHAIN FJ562323_HBx_P-C of FT:mat_peptide FJ562323_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I217). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562324_HBx_P-C Product feature CHAIN FJ562324_HBx_P-C of FT:mat_peptide FJ562324_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I219). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562325_HBx_P-C Product feature CHAIN FJ562325_HBx_P-C of FT:mat_peptide FJ562325_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I223). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSISAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562326_HBx_P-C Product feature CHAIN FJ562326_HBx_P-C of FT:mat_peptide FJ562326_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I227). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562327_HBx_P-C Product feature CHAIN FJ562327_HBx_P-C of FT:mat_peptide FJ562327_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I228). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTPA
>gnl|hbvpro|FJ562329_HBx_P-C Product feature CHAIN FJ562329_HBx_P-C of FT:mat_peptide FJ562329_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I230). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPSNFFTSA
>gnl|hbvpro|FJ562330_HBx_P-C Product feature CHAIN FJ562330_HBx_P-C of FT:mat_peptide FJ562330_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I231). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562331_HBx_P-C Product feature CHAIN FJ562331_HBx_P-C of FT:mat_peptide FJ562331_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I9). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562332_HBx_P-C Product feature CHAIN FJ562332_HBx_P-C of FT:mat_peptide FJ562332_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFLTSA
>gnl|hbvpro|FJ562333_HBx_P-C Product feature CHAIN FJ562333_HBx_P-C of FT:mat_peptide FJ562333_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I78). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562334_HBx_P-C Product feature CHAIN FJ562334_HBx_P-C of FT:mat_peptide FJ562334_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562335_HBx_P-C Product feature CHAIN FJ562335_HBx_P-C of FT:mat_peptide FJ562335_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPAIHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562337_HBx_P-C Product feature CHAIN FJ562337_HBx_P-C of FT:mat_peptide FJ562337_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I173). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLXCSPAPCNFFTSA
>gnl|hbvpro|FJ562339_HBx_P-C Product feature CHAIN FJ562339_HBx_P-C of FT:mat_peptide FJ562339_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I205). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ562340_HBx_P-C Product feature CHAIN FJ562340_HBx_P-C of FT:mat_peptide FJ562340_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I220). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ751770_HBx_P-C Product feature CHAIN FJ751770_HBx_P-C of FT:mat_peptide FJ751770_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787437_HBx_P-C Product feature CHAIN FJ787437_HBx_P-C of FT:mat_peptide FJ787437_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S129-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787439_HBx_P-C Product feature CHAIN FJ787439_HBx_P-C of FT:mat_peptide FJ787439_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787441_HBx_P-C Product feature CHAIN FJ787441_HBx_P-C of FT:mat_peptide FJ787441_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDALCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGARLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKGTLGLSAISTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787442_HBx_P-C Product feature CHAIN FJ787442_HBx_P-C of FT:mat_peptide FJ787442_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787443_HBx_P-C Product feature CHAIN FJ787443_HBx_P-C of FT:mat_peptide FJ787443_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787445_HBx_P-C Product feature CHAIN FJ787445_HBx_P-C of FT:mat_peptide FJ787445_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S425-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAEPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787447_HBx_P-C Product feature CHAIN FJ787447_HBx_P-C of FT:mat_peptide FJ787447_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S461-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787448_HBx_P-C Product feature CHAIN FJ787448_HBx_P-C of FT:mat_peptide FJ787448_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S461-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787449_HBx_P-C Product feature CHAIN FJ787449_HBx_P-C of FT:mat_peptide FJ787449_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S567-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787450_HBx_P-C Product feature CHAIN FJ787450_HBx_P-C of FT:mat_peptide FJ787450_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S627-2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787451_HBx_P-C Product feature CHAIN FJ787451_HBx_P-C of FT:mat_peptide FJ787451_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S627-3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEGLGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787452_HBx_P-C Product feature CHAIN FJ787452_HBx_P-C of FT:mat_peptide FJ787452_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S955-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787453_HBx_P-C Product feature CHAIN FJ787453_HBx_P-C of FT:mat_peptide FJ787453_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787454_HBx_P-C Product feature CHAIN FJ787454_HBx_P-C of FT:mat_peptide FJ787454_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSFAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNLFTSA
>gnl|hbvpro|FJ787455_HBx_P-C Product feature CHAIN FJ787455_HBx_P-C of FT:mat_peptide FJ787455_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCSRPVGAESRGRPISGPFGALPSPSSSAVPTGHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787456_HBx_P-C Product feature CHAIN FJ787456_HBx_P-C of FT:mat_peptide FJ787456_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHGVYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787457_HBx_P-C Product feature CHAIN FJ787457_HBx_P-C of FT:mat_peptide FJ787457_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787459_HBx_P-C Product feature CHAIN FJ787459_HBx_P-C of FT:mat_peptide FJ787459_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1348-1). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787461_HBx_P-C Product feature CHAIN FJ787461_HBx_P-C of FT:mat_peptide FJ787461_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-2). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787462_HBx_P-C Product feature CHAIN FJ787462_HBx_P-C of FT:mat_peptide FJ787462_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLPAMSTTDPEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787463_HBx_P-C Product feature CHAIN FJ787463_HBx_P-C of FT:mat_peptide FJ787463_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-6). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787464_HBx_P-C Product feature CHAIN FJ787464_HBx_P-C of FT:mat_peptide FJ787464_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|FJ787465_HBx_P-C Product feature CHAIN FJ787465_HBx_P-C of FT:mat_peptide FJ787465_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|FJ787466_HBx_P-C Product feature CHAIN FJ787466_HBx_P-C of FT:mat_peptide FJ787466_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|FJ787467_HBx_P-C Product feature CHAIN FJ787467_HBx_P-C of FT:mat_peptide FJ787467_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|FJ787468_HBx_P-C Product feature CHAIN FJ787468_HBx_P-C of FT:mat_peptide FJ787468_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787469_HBx_P-C Product feature CHAIN FJ787469_HBx_P-C of FT:mat_peptide FJ787469_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787470_HBx_P-C Product feature CHAIN FJ787470_HBx_P-C of FT:mat_peptide FJ787470_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLGPARDVLYLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787471_HBx_P-C Product feature CHAIN FJ787471_HBx_P-C of FT:mat_peptide FJ787471_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787474_HBx_P-C Product feature CHAIN FJ787474_HBx_P-C of FT:mat_peptide FJ787474_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1732-6). Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787479_HBx_P-C Product feature CHAIN FJ787479_HBx_P-C of FT:mat_peptide FJ787479_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787481_HBx_P-C Product feature CHAIN FJ787481_HBx_P-C of FT:mat_peptide FJ787481_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-2). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787482_HBx_P-C Product feature CHAIN FJ787482_HBx_P-C of FT:mat_peptide FJ787482_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1158-7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787483_HBx_P-C Product feature CHAIN FJ787483_HBx_P-C of FT:mat_peptide FJ787483_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1158-8). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVMPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787484_HBx_P-C Product feature CHAIN FJ787484_HBx_P-C of FT:mat_peptide FJ787484_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1348-3). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787485_HBx_P-C Product feature CHAIN FJ787485_HBx_P-C of FT:mat_peptide FJ787485_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1656-8). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSATSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787486_HBx_P-C Product feature CHAIN FJ787486_HBx_P-C of FT:mat_peptide FJ787486_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2235-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787487_HBx_P-C Product feature CHAIN FJ787487_HBx_P-C of FT:mat_peptide FJ787487_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate DMY-1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787488_HBx_P-C Product feature CHAIN FJ787488_HBx_P-C of FT:mat_peptide FJ787488_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate DMY-5). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787489_HBx_P-C Product feature CHAIN FJ787489_HBx_P-C of FT:mat_peptide FJ787489_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate DMY-6). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ787490_HBx_P-C Product feature CHAIN FJ787490_HBx_P-C of FT:mat_peptide FJ787490_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LHZ-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
IATRVCCQLDPARDVLCLRPVGAESRRQSVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIKLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ876190_HBx_P-C Product feature CHAIN FJ876190_HBx_P-C of FT:mat_peptide FJ876190_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCCMX5). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876191_HBx_P-C Product feature CHAIN FJ876191_HBx_P-C of FT:mat_peptide FJ876191_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCCMX9). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEASFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876192_HBx_P-C Product feature CHAIN FJ876192_HBx_P-C of FT:mat_peptide FJ876192_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCCMX17). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEASFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876202_HBx_P-C Product feature CHAIN FJ876202_HBx_P-C of FT:mat_peptide FJ876202_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCCNX2). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSVVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876203_HBx_P-C Product feature CHAIN FJ876203_HBx_P-C of FT:mat_peptide FJ876203_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCCNX13). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876204_HBx_P-C Product feature CHAIN FJ876204_HBx_P-C of FT:mat_peptide FJ876204_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCCNX21). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876205_HBx_P-C Product feature CHAIN FJ876205_HBx_P-C of FT:mat_peptide FJ876205_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCCNX36). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSVVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876206_HBx_P-C Product feature CHAIN FJ876206_HBx_P-C of FT:mat_peptide FJ876206_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCCNX79). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876229_HBx_P-C Product feature CHAIN FJ876229_HBx_P-C of FT:mat_peptide FJ876229_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LCMX19). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEASFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876230_HBx_P-C Product feature CHAIN FJ876230_HBx_P-C of FT:mat_peptide FJ876230_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LCMX26). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876238_HBx_P-C Product feature CHAIN FJ876238_HBx_P-C of FT:mat_peptide FJ876238_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LCNX13). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876239_HBx_P-C Product feature CHAIN FJ876239_HBx_P-C of FT:mat_peptide FJ876239_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LCNX29). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876246_HBx_P-C Product feature CHAIN FJ876246_HBx_P-C of FT:mat_peptide FJ876246_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHMX58). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEASFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876251_HBx_P-C Product feature CHAIN FJ876251_HBx_P-C of FT:mat_peptide FJ876251_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHNX59). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEDDRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ876252_HBx_P-C Product feature CHAIN FJ876252_HBx_P-C of FT:mat_peptide FJ876252_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHNX87). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|FJ899761_HBx_P-C Product feature CHAIN FJ899761_HBx_P-C of FT:mat_peptide FJ899761_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899763_HBx_P-C Product feature CHAIN FJ899763_HBx_P-C of FT:mat_peptide FJ899763_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899764_HBx_P-C Product feature CHAIN FJ899764_HBx_P-C of FT:mat_peptide FJ899764_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGLPVCAFPSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899765_HBx_P-C Product feature CHAIN FJ899765_HBx_P-C of FT:mat_peptide FJ899765_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGLPVCAFSSAGPYALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899767_HBx_P-C Product feature CHAIN FJ899767_HBx_P-C of FT:mat_peptide FJ899767_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHRALPKVLHKRTLGLPALSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ899768_HBx_P-C Product feature CHAIN FJ899768_HBx_P-C of FT:mat_peptide FJ899768_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C56-7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899769_HBx_P-C Product feature CHAIN FJ899769_HBx_P-C of FT:mat_peptide FJ899769_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899771_HBx_P-C Product feature CHAIN FJ899771_HBx_P-C of FT:mat_peptide FJ899771_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899772_HBx_P-C Product feature CHAIN FJ899772_HBx_P-C of FT:mat_peptide FJ899772_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C113-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899773_HBx_P-C Product feature CHAIN FJ899773_HBx_P-C of FT:mat_peptide FJ899773_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C113-6). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGVESRGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899774_HBx_P-C Product feature CHAIN FJ899774_HBx_P-C of FT:mat_peptide FJ899774_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899775_HBx_P-C Product feature CHAIN FJ899775_HBx_P-C of FT:mat_peptide FJ899775_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899776_HBx_P-C Product feature CHAIN FJ899776_HBx_P-C of FT:mat_peptide FJ899776_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C122-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899777_HBx_P-C Product feature CHAIN FJ899777_HBx_P-C of FT:mat_peptide FJ899777_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLATMSTTDLEAYFIDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899778_HBx_P-C Product feature CHAIN FJ899778_HBx_P-C of FT:mat_peptide FJ899778_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPVGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPRALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899783_HBx_P-C Product feature CHAIN FJ899783_HBx_P-C of FT:mat_peptide FJ899783_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899788_HBx_P-C Product feature CHAIN FJ899788_HBx_P-C of FT:mat_peptide FJ899788_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVFCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899789_HBx_P-C Product feature CHAIN FJ899789_HBx_P-C of FT:mat_peptide FJ899789_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRSVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899793_HBx_P-C Product feature CHAIN FJ899793_HBx_P-C of FT:mat_peptide FJ899793_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C122-2). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNVHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899794_HBx_P-C Product feature CHAIN FJ899794_HBx_P-C of FT:mat_peptide FJ899794_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C122-3). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNVHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ899795_HBx_P-C Product feature CHAIN FJ899795_HBx_P-C of FT:mat_peptide FJ899795_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C122-9). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|FJ904423_HBx_P-C Product feature CHAIN FJ904423_HBx_P-C of FT:mat_peptide FJ904423_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate A78). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVRQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ184326_HBx_P-C Product feature CHAIN GQ184326_HBx_P-C of FT:mat_peptide GQ184326_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZADGM501). Complete genome. [Hepadnaviridae] (length=153 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ222210_HBx_P-C Product feature CHAIN GQ222210_HBx_P-C of FT:mat_peptide GQ222210_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZADGM601). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ222211_HBx_P-C Product feature CHAIN GQ222211_HBx_P-C of FT:mat_peptide GQ222211_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZADGM602). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ222212_HBx_P-C Product feature CHAIN GQ222212_HBx_P-C of FT:mat_peptide GQ222212_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZADGM502). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ227692_HBx_P-C Product feature CHAIN GQ227692_HBx_P-C of FT:mat_peptide GQ227692_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ227693_HBx_P-C Product feature CHAIN GQ227693_HBx_P-C of FT:mat_peptide GQ227693_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ227694_HBx_P-C Product feature CHAIN GQ227694_HBx_P-C of FT:mat_peptide GQ227694_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ227695_HBx_P-C Product feature CHAIN GQ227695_HBx_P-C of FT:mat_peptide GQ227695_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ227696_HBx_P-C Product feature CHAIN GQ227696_HBx_P-C of FT:mat_peptide GQ227696_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ227697_HBx_P-C Product feature CHAIN GQ227697_HBx_P-C of FT:mat_peptide GQ227697_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ259588_HBx_P-C Product feature CHAIN GQ259588_HBx_P-C of FT:mat_peptide GQ259588_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358153_HBx_P-C Product feature CHAIN GQ358153_HBx_P-C of FT:mat_peptide GQ358153_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIHB006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358154_HBx_P-C Product feature CHAIN GQ358154_HBx_P-C of FT:mat_peptide GQ358154_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SLK126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSSSAIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358157_HBx_P-C Product feature CHAIN GQ358157_HBx_P-C of FT:mat_peptide GQ358157_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M007). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRSVSGPLGVVPSPSPSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ358158_HBx_C-C Product feature CHAIN GQ358158_HBx_C-C of FT:mat_peptide GQ358158_HBx_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M154). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSRSLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ372968_HBx_P-C Product feature CHAIN GQ372968_HBx_P-C of FT:mat_peptide GQ372968_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6380-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377514_HBx_P-C Product feature CHAIN GQ377514_HBx_P-C of FT:mat_peptide GQ377514_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J8). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377515_HBx_P-C Product feature CHAIN GQ377515_HBx_P-C of FT:mat_peptide GQ377515_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377517_HBx_P-C Product feature CHAIN GQ377517_HBx_P-C of FT:mat_peptide GQ377517_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377518_HBx_P-C Product feature CHAIN GQ377518_HBx_P-C of FT:mat_peptide GQ377518_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTXDLEAYFKDCVFKDWEELGEETRLMIFVLGGYRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377521_HBx_P-C Product feature CHAIN GQ377521_HBx_P-C of FT:mat_peptide GQ377521_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLATMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377523_HBx_P-C Product feature CHAIN GQ377523_HBx_P-C of FT:mat_peptide GQ377523_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377524_HBx_P-C Product feature CHAIN GQ377524_HBx_P-C of FT:mat_peptide GQ377524_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377526_HBx_P-C Product feature CHAIN GQ377526_HBx_P-C of FT:mat_peptide GQ377526_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGDETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377527_HBx_P-C Product feature CHAIN GQ377527_HBx_P-C of FT:mat_peptide GQ377527_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPSGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377528_HBx_P-C Product feature CHAIN GQ377528_HBx_P-C of FT:mat_peptide GQ377528_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377529_HBx_P-C Product feature CHAIN GQ377529_HBx_P-C of FT:mat_peptide GQ377529_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGAIPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377530_HBx_P-C Product feature CHAIN GQ377530_HBx_P-C of FT:mat_peptide GQ377530_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J35). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377531_HBx_P-C Product feature CHAIN GQ377531_HBx_P-C of FT:mat_peptide GQ377531_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J36). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377533_HBx_P-C Product feature CHAIN GQ377533_HBx_P-C of FT:mat_peptide GQ377533_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377535_HBx_P-C Product feature CHAIN GQ377535_HBx_P-C of FT:mat_peptide GQ377535_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J45). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377536_HBx_P-C Product feature CHAIN GQ377536_HBx_P-C of FT:mat_peptide GQ377536_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTHLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377538_HBx_P-C Product feature CHAIN GQ377538_HBx_P-C of FT:mat_peptide GQ377538_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377541_HBx_P-C Product feature CHAIN GQ377541_HBx_P-C of FT:mat_peptide GQ377541_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J58). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCKHKLVCTPAPCNFFTSA
>gnl|hbvpro|GQ377543_HBx_P-C Product feature CHAIN GQ377543_HBx_P-C of FT:mat_peptide GQ377543_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J63). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377545_HBx_P-C Product feature CHAIN GQ377545_HBx_P-C of FT:mat_peptide GQ377545_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377546_HBx_P-C Product feature CHAIN GQ377546_HBx_P-C of FT:mat_peptide GQ377546_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J77). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377551_HBx_P-C Product feature CHAIN GQ377551_HBx_P-C of FT:mat_peptide GQ377551_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377552_HBx_P-C Product feature CHAIN GQ377552_HBx_P-C of FT:mat_peptide GQ377552_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVSSPAPSNFFTSA
>gnl|hbvpro|GQ377553_HBx_P-C Product feature CHAIN GQ377553_HBx_P-C of FT:mat_peptide GQ377553_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377554_HBx_P-C Product feature CHAIN GQ377554_HBx_P-C of FT:mat_peptide GQ377554_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377555_HBx_P-C Product feature CHAIN GQ377555_HBx_P-C of FT:mat_peptide GQ377555_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377557_HBx_P-C Product feature CHAIN GQ377557_HBx_P-C of FT:mat_peptide GQ377557_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J88). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRMX
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377559_HBx_P-C Product feature CHAIN GQ377559_HBx_P-C of FT:mat_peptide GQ377559_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPRNFFTSA
>gnl|hbvpro|GQ377562_HBx_P-C Product feature CHAIN GQ377562_HBx_P-C of FT:mat_peptide GQ377562_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377563_HBx_P-C Product feature CHAIN GQ377563_HBx_P-C of FT:mat_peptide GQ377563_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J98). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSLSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|GQ377570_HBx_P-C Product feature CHAIN GQ377570_HBx_P-C of FT:mat_peptide GQ377570_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J110). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377571_HBx_P-C Product feature CHAIN GQ377571_HBx_P-C of FT:mat_peptide GQ377571_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J112). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377572_HBx_P-C Product feature CHAIN GQ377572_HBx_P-C of FT:mat_peptide GQ377572_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377574_HBx_P-C Product feature CHAIN GQ377574_HBx_P-C of FT:mat_peptide GQ377574_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J115). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRQKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377575_HBx_P-C Product feature CHAIN GQ377575_HBx_P-C of FT:mat_peptide GQ377575_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAXHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLXAMSTTDLEAYFKDCLFTDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377576_HBx_P-C Product feature CHAIN GQ377576_HBx_P-C of FT:mat_peptide GQ377576_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J117). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRPKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377578_HBx_P-C Product feature CHAIN GQ377578_HBx_P-C of FT:mat_peptide GQ377578_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J125). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377579_HBx_P-C Product feature CHAIN GQ377579_HBx_P-C of FT:mat_peptide GQ377579_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVAGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGSCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377580_HBx_P-C Product feature CHAIN GQ377580_HBx_P-C of FT:mat_peptide GQ377580_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSAAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377583_HBx_P-C Product feature CHAIN GQ377583_HBx_P-C of FT:mat_peptide GQ377583_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J132). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377584_HBx_P-C Product feature CHAIN GQ377584_HBx_P-C of FT:mat_peptide GQ377584_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J133). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377585_HBx_P-C Product feature CHAIN GQ377585_HBx_P-C of FT:mat_peptide GQ377585_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J134). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377586_HBx_P-C Product feature CHAIN GQ377586_HBx_P-C of FT:mat_peptide GQ377586_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J135). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377591_HBx_P-C Product feature CHAIN GQ377591_HBx_P-C of FT:mat_peptide GQ377591_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J148). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377599_HBx_P-C Product feature CHAIN GQ377599_HBx_P-C of FT:mat_peptide GQ377599_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J160). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ377600_HBx_P-C Product feature CHAIN GQ377600_HBx_P-C of FT:mat_peptide GQ377600_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J161). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377603_HBx_P-C Product feature CHAIN GQ377603_HBx_P-C of FT:mat_peptide GQ377603_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J166). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPABHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377605_HBx_P-C Product feature CHAIN GQ377605_HBx_P-C of FT:mat_peptide GQ377605_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J169). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377608_HBx_P-C Product feature CHAIN GQ377608_HBx_P-C of FT:mat_peptide GQ377608_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J174). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELEEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377609_HBx_P-C Product feature CHAIN GQ377609_HBx_P-C of FT:mat_peptide GQ377609_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J176). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|GQ377616_HBx_P-C Product feature CHAIN GQ377616_HBx_P-C of FT:mat_peptide GQ377616_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J192). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|GQ377617_HBx_P-C Product feature CHAIN GQ377617_HBx_P-C of FT:mat_peptide GQ377617_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J193). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIMLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377618_HBx_P-C Product feature CHAIN GQ377618_HBx_P-C of FT:mat_peptide GQ377618_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J194). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSASTSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377619_HBx_P-C Product feature CHAIN GQ377619_HBx_P-C of FT:mat_peptide GQ377619_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J195). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377620_HBx_P-C Product feature CHAIN GQ377620_HBx_P-C of FT:mat_peptide GQ377620_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J197). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTIGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377621_HBx_P-C Product feature CHAIN GQ377621_HBx_P-C of FT:mat_peptide GQ377621_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J206). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLTGLTTNDSGAHIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377623_HBx_P-C Product feature CHAIN GQ377623_HBx_P-C of FT:mat_peptide GQ377623_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J208). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARNVLCLRPVDAESRGRSVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377624_HBx_P-C Product feature CHAIN GQ377624_HBx_P-C of FT:mat_peptide GQ377624_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J221). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCKHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377628_HBx_P-C Product feature CHAIN GQ377628_HBx_P-C of FT:mat_peptide GQ377628_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J232). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377632_HBx_P-C Product feature CHAIN GQ377632_HBx_P-C of FT:mat_peptide GQ377632_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J240). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377636_HBx_P-C Product feature CHAIN GQ377636_HBx_P-C of FT:mat_peptide GQ377636_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J248). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLXNRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ377637_HBx_P-C Product feature CHAIN GQ377637_HBx_P-C of FT:mat_peptide GQ377637_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J249). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475305_HBx_P-C Product feature CHAIN GQ475305_HBx_P-C of FT:mat_peptide GQ475305_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR1CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475306_HBx_P-C Product feature CHAIN GQ475306_HBx_P-C of FT:mat_peptide GQ475306_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR2CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475307_HBx_P-C Product feature CHAIN GQ475307_HBx_P-C of FT:mat_peptide GQ475307_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR3CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475308_HBx_P-C Product feature CHAIN GQ475308_HBx_P-C of FT:mat_peptide GQ475308_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR4CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475309_HBx_P-C Product feature CHAIN GQ475309_HBx_P-C of FT:mat_peptide GQ475309_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR5CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475310_HBx_P-C Product feature CHAIN GQ475310_HBx_P-C of FT:mat_peptide GQ475310_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR6CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475311_HBx_P-C Product feature CHAIN GQ475311_HBx_P-C of FT:mat_peptide GQ475311_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR7CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475312_HBx_P-C Product feature CHAIN GQ475312_HBx_P-C of FT:mat_peptide GQ475312_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR8CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475313_HBx_P-C Product feature CHAIN GQ475313_HBx_P-C of FT:mat_peptide GQ475313_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR9CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475314_HBx_P-C Product feature CHAIN GQ475314_HBx_P-C of FT:mat_peptide GQ475314_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR10CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475315_HBx_P-C Product feature CHAIN GQ475315_HBx_P-C of FT:mat_peptide GQ475315_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR11CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475316_HBx_P-C Product feature CHAIN GQ475316_HBx_P-C of FT:mat_peptide GQ475316_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR12CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475317_HBx_P-C Product feature CHAIN GQ475317_HBx_P-C of FT:mat_peptide GQ475317_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR13CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESCRRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHPVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475318_HBx_P-C Product feature CHAIN GQ475318_HBx_P-C of FT:mat_peptide GQ475318_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR14CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSAAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475319_HBx_P-C Product feature CHAIN GQ475319_HBx_P-C of FT:mat_peptide GQ475319_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR15CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475320_HBx_P-C Product feature CHAIN GQ475320_HBx_P-C of FT:mat_peptide GQ475320_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR16CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475321_HBx_P-C Product feature CHAIN GQ475321_HBx_P-C of FT:mat_peptide GQ475321_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR17CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475322_HBx_P-C Product feature CHAIN GQ475322_HBx_P-C of FT:mat_peptide GQ475322_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR18LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPAVHGENLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475324_HBx_P-C Product feature CHAIN GQ475324_HBx_P-C of FT:mat_peptide GQ475324_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR20LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475325_HBx_P-C Product feature CHAIN GQ475325_HBx_P-C of FT:mat_peptide GQ475325_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR21LC). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475326_HBx_P-C Product feature CHAIN GQ475326_HBx_P-C of FT:mat_peptide GQ475326_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR22LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475327_HBx_P-C Product feature CHAIN GQ475327_HBx_P-C of FT:mat_peptide GQ475327_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR23LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475328_HBx_P-C Product feature CHAIN GQ475328_HBx_P-C of FT:mat_peptide GQ475328_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR24LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475329_HBx_P-C Product feature CHAIN GQ475329_HBx_P-C of FT:mat_peptide GQ475329_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR25LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475330_HBx_P-C Product feature CHAIN GQ475330_HBx_P-C of FT:mat_peptide GQ475330_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR26LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475331_HBx_P-C Product feature CHAIN GQ475331_HBx_P-C of FT:mat_peptide GQ475331_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR27LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475332_HBx_P-C Product feature CHAIN GQ475332_HBx_P-C of FT:mat_peptide GQ475332_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR28LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475333_HBx_P-C Product feature CHAIN GQ475333_HBx_P-C of FT:mat_peptide GQ475333_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR29LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475334_HBx_P-C Product feature CHAIN GQ475334_HBx_P-C of FT:mat_peptide GQ475334_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR30LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475336_HBx_P-C Product feature CHAIN GQ475336_HBx_P-C of FT:mat_peptide GQ475336_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR32LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475337_HBx_P-C Product feature CHAIN GQ475337_HBx_P-C of FT:mat_peptide GQ475337_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR33LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475338_HBx_P-C Product feature CHAIN GQ475338_HBx_P-C of FT:mat_peptide GQ475338_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR34LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLESYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475339_HBx_P-C Product feature CHAIN GQ475339_HBx_P-C of FT:mat_peptide GQ475339_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR35HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSFSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475341_HBx_P-C Product feature CHAIN GQ475341_HBx_P-C of FT:mat_peptide GQ475341_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR37HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475342_HBx_P-C Product feature CHAIN GQ475342_HBx_P-C of FT:mat_peptide GQ475342_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR38HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475343_HBx_P-C Product feature CHAIN GQ475343_HBx_P-C of FT:mat_peptide GQ475343_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR39HCC). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475344_HBx_P-C Product feature CHAIN GQ475344_HBx_P-C of FT:mat_peptide GQ475344_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR40HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475345_HBx_P-C Product feature CHAIN GQ475345_HBx_P-C of FT:mat_peptide GQ475345_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR41HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475346_HBx_P-C Product feature CHAIN GQ475346_HBx_P-C of FT:mat_peptide GQ475346_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR42HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475347_HBx_P-C Product feature CHAIN GQ475347_HBx_P-C of FT:mat_peptide GQ475347_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR43HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475348_HBx_P-C Product feature CHAIN GQ475348_HBx_P-C of FT:mat_peptide GQ475348_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR44HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475349_HBx_P-C Product feature CHAIN GQ475349_HBx_P-C of FT:mat_peptide GQ475349_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR45HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475350_HBx_P-C Product feature CHAIN GQ475350_HBx_P-C of FT:mat_peptide GQ475350_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR46HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSTAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475351_HBx_P-C Product feature CHAIN GQ475351_HBx_P-C of FT:mat_peptide GQ475351_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR47HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475352_HBx_P-C Product feature CHAIN GQ475352_HBx_P-C of FT:mat_peptide GQ475352_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR48HCC). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475353_HBx_P-C Product feature CHAIN GQ475353_HBx_P-C of FT:mat_peptide GQ475353_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR49HCC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475354_HBx_P-C Product feature CHAIN GQ475354_HBx_P-C of FT:mat_peptide GQ475354_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR50HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475355_HBx_P-C Product feature CHAIN GQ475355_HBx_P-C of FT:mat_peptide GQ475355_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR51HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPXRDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475356_HBx_P-C Product feature CHAIN GQ475356_HBx_P-C of FT:mat_peptide GQ475356_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR52HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEXGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ475357_HBx_P-C Product feature CHAIN GQ475357_HBx_P-C of FT:mat_peptide GQ475357_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR53HCC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855521_HBx_P-C Product feature CHAIN GQ855521_HBx_P-C of FT:mat_peptide GQ855521_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 3). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855523_HBx_P-C Product feature CHAIN GQ855523_HBx_P-C of FT:mat_peptide GQ855523_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 37). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855525_HBx_P-C Product feature CHAIN GQ855525_HBx_P-C of FT:mat_peptide GQ855525_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 96). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855528_HBx_P-C Product feature CHAIN GQ855528_HBx_P-C of FT:mat_peptide GQ855528_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 140). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSFAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855530_HBx_P-C Product feature CHAIN GQ855530_HBx_P-C of FT:mat_peptide GQ855530_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 204). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855531_HBx_P-C Product feature CHAIN GQ855531_HBx_P-C of FT:mat_peptide GQ855531_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 205). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855533_HBx_P-C Product feature CHAIN GQ855533_HBx_P-C of FT:mat_peptide GQ855533_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 230). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSMTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855534_HBx_P-C Product feature CHAIN GQ855534_HBx_P-C of FT:mat_peptide GQ855534_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 266). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQGLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855537_HBx_P-C Product feature CHAIN GQ855537_HBx_P-C of FT:mat_peptide GQ855537_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 350). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSVMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855541_HBx_P-C Product feature CHAIN GQ855541_HBx_P-C of FT:mat_peptide GQ855541_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 385). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855543_HBx_P-C Product feature CHAIN GQ855543_HBx_P-C of FT:mat_peptide GQ855543_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 416). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPLDAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855544_HBx_P-C Product feature CHAIN GQ855544_HBx_P-C of FT:mat_peptide GQ855544_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 423). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ855548_HBx_P-C Product feature CHAIN GQ855548_HBx_P-C of FT:mat_peptide GQ855548_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 512). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ872210_HBx_P-C Product feature CHAIN GQ872210_HBx_P-C of FT:mat_peptide GQ872210_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ872211_HBx_P-C Product feature CHAIN GQ872211_HBx_P-C of FT:mat_peptide GQ872211_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924604_HBx_P-C Product feature CHAIN GQ924604_HBx_P-C of FT:mat_peptide GQ924604_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924609_HBx_P-C Product feature CHAIN GQ924609_HBx_P-C of FT:mat_peptide GQ924609_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSALSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924612_HBx_P-C Product feature CHAIN GQ924612_HBx_P-C of FT:mat_peptide GQ924612_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924613_HBx_P-C Product feature CHAIN GQ924613_HBx_P-C of FT:mat_peptide GQ924613_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924615_HBx_P-C Product feature CHAIN GQ924615_HBx_P-C of FT:mat_peptide GQ924615_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVCQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924616_HBx_P-C Product feature CHAIN GQ924616_HBx_P-C of FT:mat_peptide GQ924616_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924619_HBx_P-C Product feature CHAIN GQ924619_HBx_P-C of FT:mat_peptide GQ924619_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M37). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924620_HBx_C-C Product feature CHAIN GQ924620_HBx_C-C of FT:mat_peptide GQ924620_HBx_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANLVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|GQ924622_HBx_P-C Product feature CHAIN GQ924622_HBx_P-C of FT:mat_peptide GQ924622_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ924623_HBx_P-C Product feature CHAIN GQ924623_HBx_P-C of FT:mat_peptide GQ924623_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M41). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAFPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924629_HBx_P-C Product feature CHAIN GQ924629_HBx_P-C of FT:mat_peptide GQ924629_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924633_HBx_P-C Product feature CHAIN GQ924633_HBx_P-C of FT:mat_peptide GQ924633_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924636_HBx_P-C Product feature CHAIN GQ924636_HBx_P-C of FT:mat_peptide GQ924636_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M68). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924642_HBx_P-C Product feature CHAIN GQ924642_HBx_P-C of FT:mat_peptide GQ924642_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M77). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVRAESRGRPISGPFGTLPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHRLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924643_HBx_P-C Product feature CHAIN GQ924643_HBx_P-C of FT:mat_peptide GQ924643_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M78). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924649_HBx_P-C Product feature CHAIN GQ924649_HBx_P-C of FT:mat_peptide GQ924649_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924650_HBx_P-C Product feature CHAIN GQ924650_HBx_P-C of FT:mat_peptide GQ924650_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M87). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPCNFFTSA
>gnl|hbvpro|GQ924655_HBx_P-C Product feature CHAIN GQ924655_HBx_P-C of FT:mat_peptide GQ924655_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GQ924658_HBx_P-C Product feature CHAIN GQ924658_HBx_P-C of FT:mat_peptide GQ924658_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M95). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU357845_HBx_P-C Product feature CHAIN GU357845_HBx_P-C of FT:mat_peptide GU357845_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y1021). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTIGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU434374_HBx_P-C Product feature CHAIN GU434374_HBx_P-C of FT:mat_peptide GU434374_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 214-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU563561_HBx_P-C Product feature CHAIN GU563561_HBx_P-C of FT:mat_peptide GU563561_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BV-153). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|GU721029_HBx_P-C Product feature CHAIN GU721029_HBx_P-C of FT:mat_peptide GU721029_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CMCL107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011465_HBx_P-C Product feature CHAIN HM011465_HBx_P-C of FT:mat_peptide HM011465_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011468_HBx_P-C Product feature CHAIN HM011468_HBx_P-C of FT:mat_peptide HM011468_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011472_HBx_P-C Product feature CHAIN HM011472_HBx_P-C of FT:mat_peptide HM011472_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011479_HBx_P-C Product feature CHAIN HM011479_HBx_P-C of FT:mat_peptide HM011479_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEXRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011481_HBx_P-C Product feature CHAIN HM011481_HBx_P-C of FT:mat_peptide HM011481_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011486_HBx_P-C Product feature CHAIN HM011486_HBx_P-C of FT:mat_peptide HM011486_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011488_HBx_P-C Product feature CHAIN HM011488_HBx_P-C of FT:mat_peptide HM011488_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011489_HBx_P-C Product feature CHAIN HM011489_HBx_P-C of FT:mat_peptide HM011489_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPAHHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011491_HBx_P-C Product feature CHAIN HM011491_HBx_P-C of FT:mat_peptide HM011491_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNACQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011493_HBx_P-C Product feature CHAIN HM011493_HBx_P-C of FT:mat_peptide HM011493_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGDESCGRPVPGPFGNLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011495_HBx_P-C Product feature CHAIN HM011495_HBx_P-C of FT:mat_peptide HM011495_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHGTHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011497_HBx_P-C Product feature CHAIN HM011497_HBx_P-C of FT:mat_peptide HM011497_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPQVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011500_HBx_P-C Product feature CHAIN HM011500_HBx_P-C of FT:mat_peptide HM011500_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM011502_HBx_P-C Product feature CHAIN HM011502_HBx_P-C of FT:mat_peptide HM011502_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750131_HBx_P-C Product feature CHAIN HM750131_HBx_P-C of FT:mat_peptide HM750131_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRRRPISGPFGSLPSPPSSALPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSALSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750132_HBx_P-C Product feature CHAIN HM750132_HBx_P-C of FT:mat_peptide HM750132_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750134_HBx_P-C Product feature CHAIN HM750134_HBx_P-C of FT:mat_peptide HM750134_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750135_HBx_P-C Product feature CHAIN HM750135_HBx_P-C of FT:mat_peptide HM750135_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750136_HBx_P-C Product feature CHAIN HM750136_HBx_P-C of FT:mat_peptide HM750136_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSDC-53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLSGAFGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750137_HBx_P-C Product feature CHAIN HM750137_HBx_P-C of FT:mat_peptide HM750137_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750138_HBx_P-C Product feature CHAIN HM750138_HBx_P-C of FT:mat_peptide HM750138_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-100). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750139_HBx_P-C Product feature CHAIN HM750139_HBx_P-C of FT:mat_peptide HM750139_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750140_HBx_P-C Product feature CHAIN HM750140_HBx_P-C of FT:mat_peptide HM750140_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMPTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HM750141_HBx_P-C Product feature CHAIN HM750141_HBx_P-C of FT:mat_peptide HM750141_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-115). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ622095_HBx_P-C Product feature CHAIN HQ622095_HBx_P-C of FT:mat_peptide HQ622095_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPVGSLSSPSTAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ638218_HBx_P-C Product feature CHAIN HQ638218_HBx_P-C of FT:mat_peptide HQ638218_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate A64-1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700456_HBx_P-C Product feature CHAIN HQ700456_HBx_P-C of FT:mat_peptide HQ700456_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_HA121_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPATHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700457_HBx_P-C Product feature CHAIN HQ700457_HBx_P-C of FT:mat_peptide HQ700457_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_HA71_1997). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPSRDVLCLRPVGAESRGRPVAGPLGXLXSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700475_HBx_P-C Product feature CHAIN HQ700475_HBx_P-C of FT:mat_peptide HQ700475_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_PA58_1984). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPAXHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXDWEELGEEIRLKVIVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700476_HBx_P-C Product feature CHAIN HQ700476_HBx_P-C of FT:mat_peptide HQ700476_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_PA58_1999). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700490_HBx_P-C Product feature CHAIN HQ700490_HBx_P-C of FT:mat_peptide HQ700490_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_WH23_1993). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEELRLKLFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700495_HBx_P-C Product feature CHAIN HQ700495_HBx_P-C of FT:mat_peptide HQ700495_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155PF_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSALSTTDLEAYFKDCVFKDWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700496_HBx_P-C Product feature CHAIN HQ700496_HBx_P-C of FT:mat_peptide HQ700496_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155C_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSALSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700502_HBx_P-C Product feature CHAIN HQ700502_HBx_P-C of FT:mat_peptide HQ700502_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Is_1991). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700504_HBx_P-C Product feature CHAIN HQ700504_HBx_P-C of FT:mat_peptide HQ700504_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Ve_1992). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700506_HBx_P-C Product feature CHAIN HQ700506_HBx_P-C of FT:mat_peptide HQ700506_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NC_TA32_2003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGALPSPPSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700516_HBx_P-C Product feature CHAIN HQ700516_HBx_P-C of FT:mat_peptide HQ700516_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_D029_2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLQKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700517_HBx_P-C Product feature CHAIN HQ700517_HBx_P-C of FT:mat_peptide HQ700517_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_D058A_2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTVPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700522_HBx_P-C Product feature CHAIN HQ700522_HBx_P-C of FT:mat_peptide HQ700522_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_H086A_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVSAESGGRSVSGPPGDLPSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLTAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700529_HBx_P-C Product feature CHAIN HQ700529_HBx_P-C of FT:mat_peptide HQ700529_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_W083A_2004). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPISGPLGDLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700543_HBx_P-C Product feature CHAIN HQ700543_HBx_P-C of FT:mat_peptide HQ700543_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_P124A_2005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVSAESGGRSVSGPPGDLPSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLTAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700555_HBx_P-C Product feature CHAIN HQ700555_HBx_P-C of FT:mat_peptide HQ700555_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD4171_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHGAHLSLRGLPVCAFSSAXPCALRXTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700556_HBx_P-C Product feature CHAIN HQ700556_HBx_P-C of FT:mat_peptide HQ700556_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BA4986_2002). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSFAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700558_HBx_P-C Product feature CHAIN HQ700558_HBx_P-C of FT:mat_peptide HQ700558_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5375_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700559_HBx_P-C Product feature CHAIN HQ700559_HBx_P-C of FT:mat_peptide HQ700559_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5561_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700561_HBx_P-C Product feature CHAIN HQ700561_HBx_P-C of FT:mat_peptide HQ700561_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BF7376_2002). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700562_HBx_P-C Product feature CHAIN HQ700562_HBx_P-C of FT:mat_peptide HQ700562_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tomga_BH5413_2002). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVXAHMVLPKVLHKRTLGLSAMSTTXLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700563_HBx_P-C Product feature CHAIN HQ700563_HBx_P-C of FT:mat_peptide HQ700563_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BL9389_2002). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGGLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700564_HBx_P-C Product feature CHAIN HQ700564_HBx_P-C of FT:mat_peptide HQ700564_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BQ3589_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700565_HBx_P-C Product feature CHAIN HQ700565_HBx_P-C of FT:mat_peptide HQ700565_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BR6895_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700566_HBx_P-C Product feature CHAIN HQ700566_HBx_P-C of FT:mat_peptide HQ700566_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_JN1142_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGTLPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700567_HBx_P-C Product feature CHAIN HQ700567_HBx_P-C of FT:mat_peptide HQ700567_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To268_2006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700568_HBx_P-C Product feature CHAIN HQ700568_HBx_P-C of FT:mat_peptide HQ700568_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To281_2006). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSSMSXTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700569_HBx_P-C Product feature CHAIN HQ700569_HBx_P-C of FT:mat_peptide HQ700569_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To347_2006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPFAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700570_HBx_P-C Product feature CHAIN HQ700570_HBx_P-C of FT:mat_peptide HQ700570_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To356_2006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHGAHLSLRSLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700571_HBx_P-C Product feature CHAIN HQ700571_HBx_P-C of FT:mat_peptide HQ700571_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To391_2006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPISGPLGDLPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700572_HBx_P-C Product feature CHAIN HQ700572_HBx_P-C of FT:mat_peptide HQ700572_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To422_2007). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCXLRFTSARRME
TTVNAHMXLPKVLHKRTLGLSXMSTXDLEAYFKDCVFKDWEELGEEXRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700573_HBx_P-C Product feature CHAIN HQ700573_HBx_P-C of FT:mat_peptide HQ700573_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To426_2007). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700574_HBx_P-C Product feature CHAIN HQ700574_HBx_P-C of FT:mat_peptide HQ700574_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To400_2006). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEELGEEIRLKVLFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700575_HBx_P-C Product feature CHAIN HQ700575_HBx_P-C of FT:mat_peptide HQ700575_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To244_2006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLSSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGXEXRLMXXVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700576_HBx_P-C Product feature CHAIN HQ700576_HBx_P-C of FT:mat_peptide HQ700576_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To250_2006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDXPSPSXSAVPANHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEELRLXXFVLGGCRHKLVCSPXPCNFFTSA
>gnl|hbvpro|HQ700577_HBx_P-C Product feature CHAIN HQ700577_HBx_P-C of FT:mat_peptide HQ700577_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To293_2006). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLXSPSXXAVPANHGAHLSLRXLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWXELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|HQ700578_HBx_P-C Product feature CHAIN HQ700578_HBx_P-C of FT:mat_peptide HQ700578_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To16_2004). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGTLPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF436920_HBx_P-C Product feature CHAIN JF436920_HBx_P-C of FT:mat_peptide JF436920_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SZ6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828905_HBx_P-C Product feature CHAIN JF828905_HBx_P-C of FT:mat_peptide JF828905_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-1). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYIKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828906_HBx_P-C Product feature CHAIN JF828906_HBx_P-C of FT:mat_peptide JF828906_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828907_HBx_P-C Product feature CHAIN JF828907_HBx_P-C of FT:mat_peptide JF828907_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828908_HBx_P-C Product feature CHAIN JF828908_HBx_P-C of FT:mat_peptide JF828908_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828910_HBx_P-C Product feature CHAIN JF828910_HBx_P-C of FT:mat_peptide JF828910_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-8). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828911_HBx_P-C Product feature CHAIN JF828911_HBx_P-C of FT:mat_peptide JF828911_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-9). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828912_HBx_P-C Product feature CHAIN JF828912_HBx_P-C of FT:mat_peptide JF828912_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES69-11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828913_HBx_P-C Product feature CHAIN JF828913_HBx_P-C of FT:mat_peptide JF828913_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828915_HBx_P-C Product feature CHAIN JF828915_HBx_P-C of FT:mat_peptide JF828915_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JF828916_HBx_P-C Product feature CHAIN JF828916_HBx_P-C of FT:mat_peptide JF828916_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828917_HBx_P-C Product feature CHAIN JF828917_HBx_P-C of FT:mat_peptide JF828917_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JF828918_HBx_P-C Product feature CHAIN JF828918_HBx_P-C of FT:mat_peptide JF828918_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828919_HBx_P-C Product feature CHAIN JF828919_HBx_P-C of FT:mat_peptide JF828919_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828920_HBx_P-C Product feature CHAIN JF828920_HBx_P-C of FT:mat_peptide JF828920_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-14). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828921_HBx_P-C Product feature CHAIN JF828921_HBx_P-C of FT:mat_peptide JF828921_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSGSFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828922_HBx_P-C Product feature CHAIN JF828922_HBx_P-C of FT:mat_peptide JF828922_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828923_HBx_P-C Product feature CHAIN JF828923_HBx_P-C of FT:mat_peptide JF828923_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828924_HBx_P-C Product feature CHAIN JF828924_HBx_P-C of FT:mat_peptide JF828924_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828925_HBx_P-C Product feature CHAIN JF828925_HBx_P-C of FT:mat_peptide JF828925_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGTESCGRPLSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNALQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828926_HBx_P-C Product feature CHAIN JF828926_HBx_P-C of FT:mat_peptide JF828926_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828928_HBx_P-C Product feature CHAIN JF828928_HBx_P-C of FT:mat_peptide JF828928_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828929_HBx_P-C Product feature CHAIN JF828929_HBx_P-C of FT:mat_peptide JF828929_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828930_HBx_P-C Product feature CHAIN JF828930_HBx_P-C of FT:mat_peptide JF828930_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828931_HBx_P-C Product feature CHAIN JF828931_HBx_P-C of FT:mat_peptide JF828931_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-15). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF828937_HBx_P-C Product feature CHAIN JF828937_HBx_P-C of FT:mat_peptide JF828937_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES72-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JF899336_HBx_P-C Product feature CHAIN JF899336_HBx_P-C of FT:mat_peptide JF899336_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10B3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN104432_HBx_P-C Product feature CHAIN JN104432_HBx_P-C of FT:mat_peptide JN104432_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLRGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN104433_HBx_P-C Product feature CHAIN JN104433_HBx_P-C of FT:mat_peptide JN104433_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN104434_HBx_P-C Product feature CHAIN JN104434_HBx_P-C of FT:mat_peptide JN104434_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAAWVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHRAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN104435_HBx_P-C Product feature CHAIN JN104435_HBx_P-C of FT:mat_peptide JN104435_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGKEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN104437_HBx_P-C Product feature CHAIN JN104437_HBx_P-C of FT:mat_peptide JN104437_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN104440_HBx_P-C Product feature CHAIN JN104440_HBx_P-C of FT:mat_peptide JN104440_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
VAARLCCKLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSSSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAYQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN315779_HBx_P-C Product feature CHAIN JN315779_HBx_P-C of FT:mat_peptide JN315779_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN400087_HBx_P-C Product feature CHAIN JN400087_HBx_P-C of FT:mat_peptide JN400087_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-75-Mother). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN400088_HBx_P-C Product feature CHAIN JN400088_HBx_P-C of FT:mat_peptide JN400088_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Baby). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN400089_HBx_P-C Product feature CHAIN JN400089_HBx_P-C of FT:mat_peptide JN400089_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Mother). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKLLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418493_HBx_P-C Product feature CHAIN JN418493_HBx_P-C of FT:mat_peptide JN418493_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N6). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418494_HBx_P-C Product feature CHAIN JN418494_HBx_P-C of FT:mat_peptide JN418494_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N10). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418495_HBx_P-C Product feature CHAIN JN418495_HBx_P-C of FT:mat_peptide JN418495_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N11). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN418496_HBx_P-C Product feature CHAIN JN418496_HBx_P-C of FT:mat_peptide JN418496_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N13). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418497_HBx_P-C Product feature CHAIN JN418497_HBx_P-C of FT:mat_peptide JN418497_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N16). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEENRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418498_HBx_P-C Product feature CHAIN JN418498_HBx_P-C of FT:mat_peptide JN418498_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N19). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGSRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418500_HBx_P-C Product feature CHAIN JN418500_HBx_P-C of FT:mat_peptide JN418500_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N32). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418501_HBx_P-C Product feature CHAIN JN418501_HBx_P-C of FT:mat_peptide JN418501_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N34). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418503_HBx_P-C Product feature CHAIN JN418503_HBx_P-C of FT:mat_peptide JN418503_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N38). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418504_HBx_P-C Product feature CHAIN JN418504_HBx_P-C of FT:mat_peptide JN418504_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N41). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDHEAYFKDSLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418505_HBx_P-C Product feature CHAIN JN418505_HBx_P-C of FT:mat_peptide JN418505_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N42). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418506_HBx_P-C Product feature CHAIN JN418506_HBx_P-C of FT:mat_peptide JN418506_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N44). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418507_HBx_P-C Product feature CHAIN JN418507_HBx_P-C of FT:mat_peptide JN418507_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N47). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418508_HBx_P-C Product feature CHAIN JN418508_HBx_P-C of FT:mat_peptide JN418508_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N48). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPVGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418509_HBx_P-C Product feature CHAIN JN418509_HBx_P-C of FT:mat_peptide JN418509_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N50). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGDCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418510_HBx_P-C Product feature CHAIN JN418510_HBx_P-C of FT:mat_peptide JN418510_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N57). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418511_HBx_P-C Product feature CHAIN JN418511_HBx_P-C of FT:mat_peptide JN418511_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N61). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418512_HBx_P-C Product feature CHAIN JN418512_HBx_P-C of FT:mat_peptide JN418512_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N64). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418513_HBx_P-C Product feature CHAIN JN418513_HBx_P-C of FT:mat_peptide JN418513_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N67). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418514_HBx_P-C Product feature CHAIN JN418514_HBx_P-C of FT:mat_peptide JN418514_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N72). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418515_HBx_P-C Product feature CHAIN JN418515_HBx_P-C of FT:mat_peptide JN418515_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N79). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVTGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418518_HBx_P-C Product feature CHAIN JN418518_HBx_P-C of FT:mat_peptide JN418518_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N87). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHNKTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418519_HBx_P-C Product feature CHAIN JN418519_HBx_P-C of FT:mat_peptide JN418519_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N89). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418521_HBx_P-C Product feature CHAIN JN418521_HBx_P-C of FT:mat_peptide JN418521_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N91). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418523_HBx_P-C Product feature CHAIN JN418523_HBx_P-C of FT:mat_peptide JN418523_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N96). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418524_HBx_P-C Product feature CHAIN JN418524_HBx_P-C of FT:mat_peptide JN418524_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N97). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418525_HBx_P-C Product feature CHAIN JN418525_HBx_P-C of FT:mat_peptide JN418525_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N98). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPVGPIPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418526_HBx_P-C Product feature CHAIN JN418526_HBx_P-C of FT:mat_peptide JN418526_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N102). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418527_HBx_P-C Product feature CHAIN JN418527_HBx_P-C of FT:mat_peptide JN418527_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N103). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN418528_HBx_P-C Product feature CHAIN JN418528_HBx_P-C of FT:mat_peptide JN418528_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NT1). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418530_HBx_P-C Product feature CHAIN JN418530_HBx_P-C of FT:mat_peptide JN418530_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T9). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGTESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPASCNFFTSA
>gnl|hbvpro|JN418532_HBx_P-C Product feature CHAIN JN418532_HBx_P-C of FT:mat_peptide JN418532_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T28). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418533_HBx_P-C Product feature CHAIN JN418533_HBx_P-C of FT:mat_peptide JN418533_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T29). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418534_HBx_P-C Product feature CHAIN JN418534_HBx_P-C of FT:mat_peptide JN418534_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T33). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418535_HBx_P-C Product feature CHAIN JN418535_HBx_P-C of FT:mat_peptide JN418535_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T41). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418536_HBx_P-C Product feature CHAIN JN418536_HBx_P-C of FT:mat_peptide JN418536_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T42). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418538_HBx_P-C Product feature CHAIN JN418538_HBx_P-C of FT:mat_peptide JN418538_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T54). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418539_HBx_P-C Product feature CHAIN JN418539_HBx_P-C of FT:mat_peptide JN418539_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T55). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHGAHLSLRGLPVCALSPAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418540_HBx_P-C Product feature CHAIN JN418540_HBx_P-C of FT:mat_peptide JN418540_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T59). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTSDLEAYFKDCLFKDWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418541_HBx_P-C Product feature CHAIN JN418541_HBx_P-C of FT:mat_peptide JN418541_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T60). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418542_HBx_P-C Product feature CHAIN JN418542_HBx_P-C of FT:mat_peptide JN418542_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T61). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418543_HBx_P-C Product feature CHAIN JN418543_HBx_P-C of FT:mat_peptide JN418543_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T62). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418544_HBx_P-C Product feature CHAIN JN418544_HBx_P-C of FT:mat_peptide JN418544_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T63). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418546_HBx_P-C Product feature CHAIN JN418546_HBx_P-C of FT:mat_peptide JN418546_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T68). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418550_HBx_P-C Product feature CHAIN JN418550_HBx_P-C of FT:mat_peptide JN418550_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T77). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418552_HBx_P-C Product feature CHAIN JN418552_HBx_P-C of FT:mat_peptide JN418552_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T80). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418553_HBx_P-C Product feature CHAIN JN418553_HBx_P-C of FT:mat_peptide JN418553_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T81). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418554_HBx_P-C Product feature CHAIN JN418554_HBx_P-C of FT:mat_peptide JN418554_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T91). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JN418555_HBx_P-C Product feature CHAIN JN418555_HBx_P-C of FT:mat_peptide JN418555_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T92). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JN418556_HBx_P-C Product feature CHAIN JN418556_HBx_P-C of FT:mat_peptide JN418556_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T93). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418558_HBx_P-C Product feature CHAIN JN418558_HBx_P-C of FT:mat_peptide JN418558_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T104). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418560_HBx_P-C Product feature CHAIN JN418560_HBx_P-C of FT:mat_peptide JN418560_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T128). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418561_HBx_P-C Product feature CHAIN JN418561_HBx_P-C of FT:mat_peptide JN418561_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T129). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418564_HBx_P-C Product feature CHAIN JN418564_HBx_P-C of FT:mat_peptide JN418564_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T138). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN418565_HBx_P-C Product feature CHAIN JN418565_HBx_P-C of FT:mat_peptide JN418565_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T140). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JN418567_HBx_P-C Product feature CHAIN JN418567_HBx_P-C of FT:mat_peptide JN418567_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T159). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN574721_HBx_P-C Product feature CHAIN JN574721_HBx_P-C of FT:mat_peptide JN574721_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FPX1). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|JN574724_HBx_P-C Product feature CHAIN JN574724_HBx_P-C of FT:mat_peptide JN574724_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FPX5). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827414_HBx_P-C Product feature CHAIN JN827414_HBx_P-C of FT:mat_peptide JN827414_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0015). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|JN827415_HBx_P-C Product feature CHAIN JN827415_HBx_P-C of FT:mat_peptide JN827415_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0032). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|JN827416_HBx_P-C Product feature CHAIN JN827416_HBx_P-C of FT:mat_peptide JN827416_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0294). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827417_HBx_P-C Product feature CHAIN JN827417_HBx_P-C of FT:mat_peptide JN827417_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0300). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827418_HBx_P-C Product feature CHAIN JN827418_HBx_P-C of FT:mat_peptide JN827418_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0904). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827420_HBx_P-C Product feature CHAIN JN827420_HBx_P-C of FT:mat_peptide JN827420_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4681). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827421_HBx_P-C Product feature CHAIN JN827421_HBx_P-C of FT:mat_peptide JN827421_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5205). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827422_HBx_P-C Product feature CHAIN JN827422_HBx_P-C of FT:mat_peptide JN827422_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5494). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827423_HBx_P-C Product feature CHAIN JN827423_HBx_P-C of FT:mat_peptide JN827423_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6359). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827424_HBx_P-C Product feature CHAIN JN827424_HBx_P-C of FT:mat_peptide JN827424_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2566). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN827425_HBx_P-C Product feature CHAIN JN827425_HBx_P-C of FT:mat_peptide JN827425_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3765). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027317_HBx_P-C Product feature CHAIN JQ027317_HBx_P-C of FT:mat_peptide JQ027317_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPXSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNACQVLPKVLXKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEXRLMIXVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027318_HBx_P-C Product feature CHAIN JQ027318_HBx_P-C of FT:mat_peptide JQ027318_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027319_HBx_P-C Product feature CHAIN JQ027319_HBx_P-C of FT:mat_peptide JQ027319_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVIGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027320_HBx_P-C Product feature CHAIN JQ027320_HBx_P-C of FT:mat_peptide JQ027320_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPXSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGXRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027321_HBx_P-C Product feature CHAIN JQ027321_HBx_P-C of FT:mat_peptide JQ027321_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027322_HBx_P-C Product feature CHAIN JQ027322_HBx_P-C of FT:mat_peptide JQ027322_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARXCCQLDTARDVLCLRPVGAESRGRPVAGPSGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027323_HBx_P-C Product feature CHAIN JQ027323_HBx_P-C of FT:mat_peptide JQ027323_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVRGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027324_HBx_P-C Product feature CHAIN JQ027324_HBx_P-C of FT:mat_peptide JQ027324_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027332_HBx_P-C Product feature CHAIN JQ027332_HBx_P-C of FT:mat_peptide JQ027332_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTXARHMA
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLIIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ027333_HBx_P-C Product feature CHAIN JQ027333_HBx_P-C of FT:mat_peptide JQ027333_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040127_HBx_P-C Product feature CHAIN JQ040127_HBx_P-C of FT:mat_peptide JQ040127_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFXSA
>gnl|hbvpro|JQ040129_HBx_P-C Product feature CHAIN JQ040129_HBx_P-C of FT:mat_peptide JQ040129_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 88). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLMIFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040131_HBx_P-C Product feature CHAIN JQ040131_HBx_P-C of FT:mat_peptide JQ040131_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 125). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ040132_HBx_P-C Product feature CHAIN JQ040132_HBx_P-C of FT:mat_peptide JQ040132_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 144). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040133_HBx_P-C Product feature CHAIN JQ040133_HBx_P-C of FT:mat_peptide JQ040133_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 160). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPSGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040135_HBx_P-C Product feature CHAIN JQ040135_HBx_P-C of FT:mat_peptide JQ040135_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 213). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040139_HBx_P-C Product feature CHAIN JQ040139_HBx_P-C of FT:mat_peptide JQ040139_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 256). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040141_HBx_P-C Product feature CHAIN JQ040141_HBx_P-C of FT:mat_peptide JQ040141_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 260). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFXDWEEFGEEIRLMXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040143_HBx_P-C Product feature CHAIN JQ040143_HBx_P-C of FT:mat_peptide JQ040143_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 264). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040144_HBx_P-C Product feature CHAIN JQ040144_HBx_P-C of FT:mat_peptide JQ040144_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 272). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSXAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ040145_HBx_P-C Product feature CHAIN JQ040145_HBx_P-C of FT:mat_peptide JQ040145_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 277). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLXKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040149_HBx_P-C Product feature CHAIN JQ040149_HBx_P-C of FT:mat_peptide JQ040149_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLXSPSSSXVPADHGXHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLXIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040151_HBx_P-C Product feature CHAIN JQ040151_HBx_P-C of FT:mat_peptide JQ040151_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSXVPADHGXHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040152_HBx_P-C Product feature CHAIN JQ040152_HBx_P-C of FT:mat_peptide JQ040152_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G172). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESGGRPVSGPFGSLPSASSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRIKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040154_HBx_P-C Product feature CHAIN JQ040154_HBx_P-C of FT:mat_peptide JQ040154_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G181). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040156_HBx_P-C Product feature CHAIN JQ040156_HBx_P-C of FT:mat_peptide JQ040156_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G186). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040158_HBx_P-C Product feature CHAIN JQ040158_HBx_P-C of FT:mat_peptide JQ040158_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G192). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040161_HBx_P-C Product feature CHAIN JQ040161_HBx_P-C of FT:mat_peptide JQ040161_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G213). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040162_HBx_P-C Product feature CHAIN JQ040162_HBx_P-C of FT:mat_peptide JQ040162_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G216). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLSLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040163_HBx_P-C Product feature CHAIN JQ040163_HBx_P-C of FT:mat_peptide JQ040163_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G217). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLXVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ040164_HBx_P-C Product feature CHAIN JQ040164_HBx_P-C of FT:mat_peptide JQ040164_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G221). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040165_HBx_P-C Product feature CHAIN JQ040165_HBx_P-C of FT:mat_peptide JQ040165_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G222). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGXEIRLMIFVLGGCRHKLVCTPAPCKFFTSA
>gnl|hbvpro|JQ040166_HBx_P-C Product feature CHAIN JQ040166_HBx_P-C of FT:mat_peptide JQ040166_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G223). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLMIFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040167_HBx_P-C Product feature CHAIN JQ040167_HBx_P-C of FT:mat_peptide JQ040167_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G225). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ040168_HBx_P-C Product feature CHAIN JQ040168_HBx_P-C of FT:mat_peptide JQ040168_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G233). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEXRLKIYVLGGCRHKLVCSPAPCXFFTSA
>gnl|hbvpro|JQ040172_HBx_P-C Product feature CHAIN JQ040172_HBx_P-C of FT:mat_peptide JQ040172_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G243). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCXHKLVCSPAPCKFFTSA
>gnl|hbvpro|JQ341855_HBx_P-C Product feature CHAIN JQ341855_HBx_P-C of FT:mat_peptide JQ341855_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno04). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341857_HBx_P-C Product feature CHAIN JQ341857_HBx_P-C of FT:mat_peptide JQ341857_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno06). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341859_HBx_P-C Product feature CHAIN JQ341859_HBx_P-C of FT:mat_peptide JQ341859_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno12). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341860_HBx_P-C Product feature CHAIN JQ341860_HBx_P-C of FT:mat_peptide JQ341860_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno13). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341863_HBx_P-C Product feature CHAIN JQ341863_HBx_P-C of FT:mat_peptide JQ341863_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno17). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341865_HBx_P-C Product feature CHAIN JQ341865_HBx_P-C of FT:mat_peptide JQ341865_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno19). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVXSPAPCNFFTSA
>gnl|hbvpro|JQ341868_HBx_P-C Product feature CHAIN JQ341868_HBx_P-C of FT:mat_peptide JQ341868_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno22). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLXKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341870_HBx_P-C Product feature CHAIN JQ341870_HBx_P-C of FT:mat_peptide JQ341870_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno25). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLXAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341872_HBx_P-C Product feature CHAIN JQ341872_HBx_P-C of FT:mat_peptide JQ341872_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno27). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341875_HBx_P-C Product feature CHAIN JQ341875_HBx_P-C of FT:mat_peptide JQ341875_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno30). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMXYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341877_HBx_P-C Product feature CHAIN JQ341877_HBx_P-C of FT:mat_peptide JQ341877_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno32). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341878_HBx_P-C Product feature CHAIN JQ341878_HBx_P-C of FT:mat_peptide JQ341878_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno33). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLXSPSXSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLXAMSTTDLEAYFKDCVFKDWEELGEEHRLLIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341879_HBx_P-C Product feature CHAIN JQ341879_HBx_P-C of FT:mat_peptide JQ341879_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno34). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341883_HBx_P-C Product feature CHAIN JQ341883_HBx_P-C of FT:mat_peptide JQ341883_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno38). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHQRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341885_HBx_P-C Product feature CHAIN JQ341885_HBx_P-C of FT:mat_peptide JQ341885_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno40). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341886_HBx_P-C Product feature CHAIN JQ341886_HBx_P-C of FT:mat_peptide JQ341886_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno41). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARLVLPKVLHKRTLGLXAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341887_HBx_P-C Product feature CHAIN JQ341887_HBx_P-C of FT:mat_peptide JQ341887_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno42). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARPVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFRDWEELGEETRLMXYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341888_HBx_P-C Product feature CHAIN JQ341888_HBx_P-C of FT:mat_peptide JQ341888_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno43). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341889_HBx_P-C Product feature CHAIN JQ341889_HBx_P-C of FT:mat_peptide JQ341889_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno44). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQQXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEYRLMXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341890_HBx_P-C Product feature CHAIN JQ341890_HBx_P-C of FT:mat_peptide JQ341890_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno45). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341891_HBx_P-C Product feature CHAIN JQ341891_HBx_P-C of FT:mat_peptide JQ341891_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno46). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAXQXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341892_HBx_P-C Product feature CHAIN JQ341892_HBx_P-C of FT:mat_peptide JQ341892_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno47). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341893_HBx_P-C Product feature CHAIN JQ341893_HBx_P-C of FT:mat_peptide JQ341893_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno48). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGXLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341895_HBx_P-C Product feature CHAIN JQ341895_HBx_P-C of FT:mat_peptide JQ341895_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno50). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341896_HBx_P-C Product feature CHAIN JQ341896_HBx_P-C of FT:mat_peptide JQ341896_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno52). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLXKRTLGLXAMSTTDLEAYFKDCVFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341897_HBx_P-C Product feature CHAIN JQ341897_HBx_P-C of FT:mat_peptide JQ341897_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno53). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341898_HBx_P-C Product feature CHAIN JQ341898_HBx_P-C of FT:mat_peptide JQ341898_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno54). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341899_HBx_P-C Product feature CHAIN JQ341899_HBx_P-C of FT:mat_peptide JQ341899_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno55). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPVGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSSMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341900_HBx_P-C Product feature CHAIN JQ341900_HBx_P-C of FT:mat_peptide JQ341900_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno56). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341902_HBx_P-C Product feature CHAIN JQ341902_HBx_P-C of FT:mat_peptide JQ341902_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno60). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ341903_HBx_P-C Product feature CHAIN JQ341903_HBx_P-C of FT:mat_peptide JQ341903_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno61). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ429078_HBx_P-C Product feature CHAIN JQ429078_HBx_P-C of FT:mat_peptide JQ429078_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08.40.117). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ518364_HBx_P-C Product feature CHAIN JQ518364_HBx_P-C of FT:mat_peptide JQ518364_HBx_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ688403_HBx_P-C Product feature CHAIN JQ688403_HBx_P-C of FT:mat_peptide JQ688403_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ688404_HBx_P-C Product feature CHAIN JQ688404_HBx_P-C of FT:mat_peptide JQ688404_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ707707_HBx_P-C Product feature CHAIN JQ707707_HBx_P-C of FT:mat_peptide JQ707707_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_10). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707708_HBx_P-C Product feature CHAIN JQ707708_HBx_P-C of FT:mat_peptide JQ707708_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_12). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKNWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707710_HBx_P-C Product feature CHAIN JQ707710_HBx_P-C of FT:mat_peptide JQ707710_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707711_HBx_P-C Product feature CHAIN JQ707711_HBx_P-C of FT:mat_peptide JQ707711_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_15). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCKLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707712_HBx_P-C Product feature CHAIN JQ707712_HBx_P-C of FT:mat_peptide JQ707712_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_16). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707713_HBx_P-C Product feature CHAIN JQ707713_HBx_P-C of FT:mat_peptide JQ707713_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_19-5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707715_HBx_P-C Product feature CHAIN JQ707715_HBx_P-C of FT:mat_peptide JQ707715_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_22). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEACFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707716_HBx_P-C Product feature CHAIN JQ707716_HBx_P-C of FT:mat_peptide JQ707716_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_23). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707717_HBx_P-C Product feature CHAIN JQ707717_HBx_P-C of FT:mat_peptide JQ707717_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_25). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707718_HBx_P-C Product feature CHAIN JQ707718_HBx_P-C of FT:mat_peptide JQ707718_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_28). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707719_HBx_P-C Product feature CHAIN JQ707719_HBx_P-C of FT:mat_peptide JQ707719_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_29). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707720_HBx_P-C Product feature CHAIN JQ707720_HBx_P-C of FT:mat_peptide JQ707720_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_32-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707721_HBx_P-C Product feature CHAIN JQ707721_HBx_P-C of FT:mat_peptide JQ707721_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_33). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707722_HBx_P-C Product feature CHAIN JQ707722_HBx_P-C of FT:mat_peptide JQ707722_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_34). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707723_HBx_P-C Product feature CHAIN JQ707723_HBx_P-C of FT:mat_peptide JQ707723_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_35). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707724_HBx_P-C Product feature CHAIN JQ707724_HBx_P-C of FT:mat_peptide JQ707724_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_38). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707725_HBx_P-C Product feature CHAIN JQ707725_HBx_P-C of FT:mat_peptide JQ707725_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_39). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707726_HBx_P-C Product feature CHAIN JQ707726_HBx_P-C of FT:mat_peptide JQ707726_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_4). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707727_HBx_P-C Product feature CHAIN JQ707727_HBx_P-C of FT:mat_peptide JQ707727_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_40). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707728_HBx_P-C Product feature CHAIN JQ707728_HBx_P-C of FT:mat_peptide JQ707728_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_41). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707729_HBx_P-C Product feature CHAIN JQ707729_HBx_P-C of FT:mat_peptide JQ707729_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_42). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707730_HBx_P-C Product feature CHAIN JQ707730_HBx_P-C of FT:mat_peptide JQ707730_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_47). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707731_HBx_P-C Product feature CHAIN JQ707731_HBx_P-C of FT:mat_peptide JQ707731_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707732_HBx_P-C Product feature CHAIN JQ707732_HBx_P-C of FT:mat_peptide JQ707732_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707733_HBx_P-C Product feature CHAIN JQ707733_HBx_P-C of FT:mat_peptide JQ707733_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S20_8). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707768_HBx_P-C Product feature CHAIN JQ707768_HBx_P-C of FT:mat_peptide JQ707768_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_10A-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707769_HBx_P-C Product feature CHAIN JQ707769_HBx_P-C of FT:mat_peptide JQ707769_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_13A). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707770_HBx_P-C Product feature CHAIN JQ707770_HBx_P-C of FT:mat_peptide JQ707770_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_14B). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707771_HBx_P-C Product feature CHAIN JQ707771_HBx_P-C of FT:mat_peptide JQ707771_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_20B). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707772_HBx_P-C Product feature CHAIN JQ707772_HBx_P-C of FT:mat_peptide JQ707772_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_26A). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707773_HBx_P-C Product feature CHAIN JQ707773_HBx_P-C of FT:mat_peptide JQ707773_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_27A). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707774_HBx_P-C Product feature CHAIN JQ707774_HBx_P-C of FT:mat_peptide JQ707774_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S50_C4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ801470_HBx_P-C Product feature CHAIN JQ801470_HBx_P-C of FT:mat_peptide JQ801470_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801472_HBx_P-C Product feature CHAIN JQ801472_HBx_P-C of FT:mat_peptide JQ801472_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801473_HBx_P-C Product feature CHAIN JQ801473_HBx_P-C of FT:mat_peptide JQ801473_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVKGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801475_HBx_P-C Product feature CHAIN JQ801475_HBx_P-C of FT:mat_peptide JQ801475_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801478_HBx_P-C Product feature CHAIN JQ801478_HBx_P-C of FT:mat_peptide JQ801478_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS21). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801480_HBx_P-C Product feature CHAIN JQ801480_HBx_P-C of FT:mat_peptide JQ801480_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS24). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801481_HBx_P-C Product feature CHAIN JQ801481_HBx_P-C of FT:mat_peptide JQ801481_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801482_HBx_P-C Product feature CHAIN JQ801482_HBx_P-C of FT:mat_peptide JQ801482_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGACALRFTSARLME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801483_HBx_P-C Product feature CHAIN JQ801483_HBx_P-C of FT:mat_peptide JQ801483_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS28). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801486_HBx_P-C Product feature CHAIN JQ801486_HBx_P-C of FT:mat_peptide JQ801486_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801488_HBx_P-C Product feature CHAIN JQ801488_HBx_P-C of FT:mat_peptide JQ801488_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801489_HBx_P-C Product feature CHAIN JQ801489_HBx_P-C of FT:mat_peptide JQ801489_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS36). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801490_HBx_P-C Product feature CHAIN JQ801490_HBx_P-C of FT:mat_peptide JQ801490_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801491_HBx_P-C Product feature CHAIN JQ801491_HBx_P-C of FT:mat_peptide JQ801491_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPIGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801493_HBx_P-C Product feature CHAIN JQ801493_HBx_P-C of FT:mat_peptide JQ801493_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPTASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801495_HBx_P-C Product feature CHAIN JQ801495_HBx_P-C of FT:mat_peptide JQ801495_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801496_HBx_P-C Product feature CHAIN JQ801496_HBx_P-C of FT:mat_peptide JQ801496_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801497_HBx_P-C Product feature CHAIN JQ801497_HBx_P-C of FT:mat_peptide JQ801497_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801498_HBx_P-C Product feature CHAIN JQ801498_HBx_P-C of FT:mat_peptide JQ801498_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGTLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801499_HBx_P-C Product feature CHAIN JQ801499_HBx_P-C of FT:mat_peptide JQ801499_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801500_HBx_P-C Product feature CHAIN JQ801500_HBx_P-C of FT:mat_peptide JQ801500_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801501_HBx_P-C Product feature CHAIN JQ801501_HBx_P-C of FT:mat_peptide JQ801501_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801502_HBx_P-C Product feature CHAIN JQ801502_HBx_P-C of FT:mat_peptide JQ801502_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801503_HBx_P-C Product feature CHAIN JQ801503_HBx_P-C of FT:mat_peptide JQ801503_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801504_HBx_P-C Product feature CHAIN JQ801504_HBx_P-C of FT:mat_peptide JQ801504_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801505_HBx_P-C Product feature CHAIN JQ801505_HBx_P-C of FT:mat_peptide JQ801505_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRNVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801508_HBx_P-C Product feature CHAIN JQ801508_HBx_P-C of FT:mat_peptide JQ801508_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL16). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801509_HBx_P-C Product feature CHAIN JQ801509_HBx_P-C of FT:mat_peptide JQ801509_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL17). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801510_HBx_P-C Product feature CHAIN JQ801510_HBx_P-C of FT:mat_peptide JQ801510_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL18). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801511_HBx_P-C Product feature CHAIN JQ801511_HBx_P-C of FT:mat_peptide JQ801511_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801513_HBx_P-C Product feature CHAIN JQ801513_HBx_P-C of FT:mat_peptide JQ801513_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSTSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801515_HBx_P-C Product feature CHAIN JQ801515_HBx_P-C of FT:mat_peptide JQ801515_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801517_HBx_P-C Product feature CHAIN JQ801517_HBx_P-C of FT:mat_peptide JQ801517_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL25). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPVSGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801518_HBx_P-C Product feature CHAIN JQ801518_HBx_P-C of FT:mat_peptide JQ801518_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801519_HBx_P-C Product feature CHAIN JQ801519_HBx_P-C of FT:mat_peptide JQ801519_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTIGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801520_HBx_P-C Product feature CHAIN JQ801520_HBx_P-C of FT:mat_peptide JQ801520_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801521_HBx_P-C Product feature CHAIN JQ801521_HBx_P-C of FT:mat_peptide JQ801521_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL29). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801522_HBx_P-C Product feature CHAIN JQ801522_HBx_P-C of FT:mat_peptide JQ801522_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JQ801523_HBx_P-C Product feature CHAIN JQ801523_HBx_P-C of FT:mat_peptide JQ801523_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIGLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026877_HBx_P-C Product feature CHAIN JX026877_HBx_P-C of FT:mat_peptide JX026877_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026878_HBx_P-C Product feature CHAIN JX026878_HBx_P-C of FT:mat_peptide JX026878_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCIRPVGAESRGRPVSGPFGGIPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026880_HBx_P-C Product feature CHAIN JX026880_HBx_P-C of FT:mat_peptide JX026880_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-23). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
IAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026884_HBx_P-C Product feature CHAIN JX026884_HBx_P-C of FT:mat_peptide JX026884_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026885_HBx_P-C Product feature CHAIN JX026885_HBx_P-C of FT:mat_peptide JX026885_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-64). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX026888_HBx_P-C Product feature CHAIN JX026888_HBx_P-C of FT:mat_peptide JX026888_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429903_HBx_P-C Product feature CHAIN JX429903_HBx_P-C of FT:mat_peptide JX429903_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLETLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429904_HBx_P-C Product feature CHAIN JX429904_HBx_P-C of FT:mat_peptide JX429904_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSMTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429905_HBx_P-C Product feature CHAIN JX429905_HBx_P-C of FT:mat_peptide JX429905_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429906_HBx_P-C Product feature CHAIN JX429906_HBx_P-C of FT:mat_peptide JX429906_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEGLGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429907_HBx_P-C Product feature CHAIN JX429907_HBx_P-C of FT:mat_peptide JX429907_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESGGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429909_HBx_P-C Product feature CHAIN JX429909_HBx_P-C of FT:mat_peptide JX429909_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-59). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFPSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429912_HBx_P-C Product feature CHAIN JX429912_HBx_P-C of FT:mat_peptide JX429912_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSSSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX429913_HBx_P-C Product feature CHAIN JX429913_HBx_P-C of FT:mat_peptide JX429913_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429914_HBx_P-C Product feature CHAIN JX429914_HBx_P-C of FT:mat_peptide JX429914_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-13). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSPSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVLKDWEELGEEIRVKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429915_HBx_P-C Product feature CHAIN JX429915_HBx_P-C of FT:mat_peptide JX429915_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429916_HBx_P-C Product feature CHAIN JX429916_HBx_P-C of FT:mat_peptide JX429916_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX429917_HBx_P-C Product feature CHAIN JX429917_HBx_P-C of FT:mat_peptide JX429917_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNYFTSA
>gnl|hbvpro|JX429918_HBx_P-C Product feature CHAIN JX429918_HBx_P-C of FT:mat_peptide JX429918_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSYSAVPTDHGAHLSFRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504534_HBx_P-C Product feature CHAIN JX504534_HBx_P-C of FT:mat_peptide JX504534_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504535_HBx_P-C Product feature CHAIN JX504535_HBx_P-C of FT:mat_peptide JX504535_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504536_HBx_P-C Product feature CHAIN JX504536_HBx_P-C of FT:mat_peptide JX504536_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504537_HBx_P-C Product feature CHAIN JX504537_HBx_P-C of FT:mat_peptide JX504537_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX504539_HBx_P-C Product feature CHAIN JX504539_HBx_P-C of FT:mat_peptide JX504539_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX504541_HBx_P-C Product feature CHAIN JX504541_HBx_P-C of FT:mat_peptide JX504541_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504542_HBx_P-C Product feature CHAIN JX504542_HBx_P-C of FT:mat_peptide JX504542_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHNRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504544_HBx_P-C Product feature CHAIN JX504544_HBx_P-C of FT:mat_peptide JX504544_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX504545_HBx_P-C Product feature CHAIN JX504545_HBx_P-C of FT:mat_peptide JX504545_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRVE
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX504546_HBx_P-C Product feature CHAIN JX504546_HBx_P-C of FT:mat_peptide JX504546_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX507211_HBx_P-C Product feature CHAIN JX507211_HBx_P-C of FT:mat_peptide JX507211_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACLVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAELFFFTSA
>gnl|hbvpro|JX507212_HBx_P-C Product feature CHAIN JX507212_HBx_P-C of FT:mat_peptide JX507212_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX507214_HBx_P-C Product feature CHAIN JX507214_HBx_P-C of FT:mat_peptide JX507214_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 99). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX560519_HBx_P-C Product feature CHAIN JX560519_HBx_P-C of FT:mat_peptide JX560519_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHRAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX560520_HBx_P-C Product feature CHAIN JX560520_HBx_P-C of FT:mat_peptide JX560520_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH139). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|JX661488_HBx_P-C Product feature CHAIN JX661488_HBx_P-C of FT:mat_peptide JX661488_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1212-C5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|JX661489_HBx_P-C Product feature CHAIN JX661489_HBx_P-C of FT:mat_peptide JX661489_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1218-C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661490_HBx_P-C Product feature CHAIN JX661490_HBx_P-C of FT:mat_peptide JX661490_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1217-C8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMILYLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661491_HBx_P-C Product feature CHAIN JX661491_HBx_P-C of FT:mat_peptide JX661491_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1222-C10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRIKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661492_HBx_P-C Product feature CHAIN JX661492_HBx_P-C of FT:mat_peptide JX661492_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1215-C7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661493_HBx_P-C Product feature CHAIN JX661493_HBx_P-C of FT:mat_peptide JX661493_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1226-C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661495_HBx_P-C Product feature CHAIN JX661495_HBx_P-C of FT:mat_peptide JX661495_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1223-C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLKASVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661496_HBx_P-C Product feature CHAIN JX661496_HBx_P-C of FT:mat_peptide JX661496_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1208-C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX661497_HBx_P-C Product feature CHAIN JX661497_HBx_P-C of FT:mat_peptide JX661497_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1228-C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKASVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JX870000_HBx_P-C Product feature CHAIN JX870000_HBx_P-C of FT:mat_peptide JX870000_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 245). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTXLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163865_HBx_P-C Product feature CHAIN KC163865_HBx_P-C of FT:mat_peptide KC163865_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9005). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDTARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163866_HBx_P-C Product feature CHAIN KC163866_HBx_P-C of FT:mat_peptide KC163866_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9061). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVLGPFGTLPSPSSSAVPADHGANLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163867_HBx_P-C Product feature CHAIN KC163867_HBx_P-C of FT:mat_peptide KC163867_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPIGTLPSPSSSAVPTDHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163868_HBx_P-C Product feature CHAIN KC163868_HBx_P-C of FT:mat_peptide KC163868_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9073). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSPESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163869_HBx_P-C Product feature CHAIN KC163869_HBx_P-C of FT:mat_peptide KC163869_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9083). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPRVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163871_HBx_P-C Product feature CHAIN KC163871_HBx_P-C of FT:mat_peptide KC163871_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163872_HBx_P-C Product feature CHAIN KC163872_HBx_P-C of FT:mat_peptide KC163872_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9004). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEDTRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163873_HBx_P-C Product feature CHAIN KC163873_HBx_P-C of FT:mat_peptide KC163873_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9013). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPAAHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLRKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163874_HBx_P-C Product feature CHAIN KC163874_HBx_P-C of FT:mat_peptide KC163874_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9079). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGPSAMSMTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163875_HBx_P-C Product feature CHAIN KC163875_HBx_P-C of FT:mat_peptide KC163875_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9082). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163876_HBx_P-C Product feature CHAIN KC163876_HBx_P-C of FT:mat_peptide KC163876_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9011). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163877_HBx_P-C Product feature CHAIN KC163877_HBx_P-C of FT:mat_peptide KC163877_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9075). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163879_HBx_P-C Product feature CHAIN KC163879_HBx_P-C of FT:mat_peptide KC163879_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9068). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163880_HBx_P-C Product feature CHAIN KC163880_HBx_P-C of FT:mat_peptide KC163880_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9009). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
PTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163881_HBx_P-C Product feature CHAIN KC163881_HBx_P-C of FT:mat_peptide KC163881_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9077). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFRTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163882_HBx_P-C Product feature CHAIN KC163882_HBx_P-C of FT:mat_peptide KC163882_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9071). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163883_HBx_P-C Product feature CHAIN KC163883_HBx_P-C of FT:mat_peptide KC163883_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9008). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRIE
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKNCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163884_HBx_P-C Product feature CHAIN KC163884_HBx_P-C of FT:mat_peptide KC163884_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9058). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163886_HBx_P-C Product feature CHAIN KC163886_HBx_P-C of FT:mat_peptide KC163886_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9007). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTMNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163887_HBx_P-C Product feature CHAIN KC163887_HBx_P-C of FT:mat_peptide KC163887_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9066). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163888_HBx_P-C Product feature CHAIN KC163888_HBx_P-C of FT:mat_peptide KC163888_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9076). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163889_HBx_P-C Product feature CHAIN KC163889_HBx_P-C of FT:mat_peptide KC163889_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9003). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVAGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163890_HBx_P-C Product feature CHAIN KC163890_HBx_P-C of FT:mat_peptide KC163890_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9086). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPPPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163892_HBx_P-C Product feature CHAIN KC163892_HBx_P-C of FT:mat_peptide KC163892_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9006). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163895_HBx_P-C Product feature CHAIN KC163895_HBx_P-C of FT:mat_peptide KC163895_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9017). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCAPRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163896_HBx_P-C Product feature CHAIN KC163896_HBx_P-C of FT:mat_peptide KC163896_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9060). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163897_HBx_P-C Product feature CHAIN KC163897_HBx_P-C of FT:mat_peptide KC163897_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9081). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163898_HBx_P-C Product feature CHAIN KC163898_HBx_P-C of FT:mat_peptide KC163898_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9065). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163899_HBx_P-C Product feature CHAIN KC163899_HBx_P-C of FT:mat_peptide KC163899_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9070). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163900_HBx_P-C Product feature CHAIN KC163900_HBx_P-C of FT:mat_peptide KC163900_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9074). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163901_HBx_P-C Product feature CHAIN KC163901_HBx_P-C of FT:mat_peptide KC163901_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9089). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163904_HBx_P-C Product feature CHAIN KC163904_HBx_P-C of FT:mat_peptide KC163904_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9087). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163906_HBx_P-C Product feature CHAIN KC163906_HBx_P-C of FT:mat_peptide KC163906_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1013). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLELSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163947_HBx_P-C Product feature CHAIN KC163947_HBx_P-C of FT:mat_peptide KC163947_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6041). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLYLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163948_HBx_P-C Product feature CHAIN KC163948_HBx_P-C of FT:mat_peptide KC163948_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5013). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163949_HBx_P-C Product feature CHAIN KC163949_HBx_P-C of FT:mat_peptide KC163949_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYLKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163950_HBx_P-C Product feature CHAIN KC163950_HBx_P-C of FT:mat_peptide KC163950_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6043). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLYLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163952_HBx_P-C Product feature CHAIN KC163952_HBx_P-C of FT:mat_peptide KC163952_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5004). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163953_HBx_P-C Product feature CHAIN KC163953_HBx_P-C of FT:mat_peptide KC163953_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5025). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163954_HBx_P-C Product feature CHAIN KC163954_HBx_P-C of FT:mat_peptide KC163954_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5006). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRRRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163955_HBx_P-C Product feature CHAIN KC163955_HBx_P-C of FT:mat_peptide KC163955_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5016). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163956_HBx_P-C Product feature CHAIN KC163956_HBx_P-C of FT:mat_peptide KC163956_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5031). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSATDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163957_HBx_P-C Product feature CHAIN KC163957_HBx_P-C of FT:mat_peptide KC163957_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7017). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLAAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFISA
>gnl|hbvpro|KC163958_HBx_P-C Product feature CHAIN KC163958_HBx_P-C of FT:mat_peptide KC163958_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5002). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEGLGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163959_HBx_P-C Product feature CHAIN KC163959_HBx_P-C of FT:mat_peptide KC163959_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7031). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163961_HBx_P-C Product feature CHAIN KC163961_HBx_P-C of FT:mat_peptide KC163961_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5039). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTFGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163962_HBx_P-C Product feature CHAIN KC163962_HBx_P-C of FT:mat_peptide KC163962_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5044). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163963_HBx_P-C Product feature CHAIN KC163963_HBx_P-C of FT:mat_peptide KC163963_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5017). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163964_HBx_P-C Product feature CHAIN KC163964_HBx_P-C of FT:mat_peptide KC163964_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5034). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163965_HBx_P-C Product feature CHAIN KC163965_HBx_P-C of FT:mat_peptide KC163965_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5030). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163966_HBx_P-C Product feature CHAIN KC163966_HBx_P-C of FT:mat_peptide KC163966_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5001). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163967_HBx_P-C Product feature CHAIN KC163967_HBx_P-C of FT:mat_peptide KC163967_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5040). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163968_HBx_P-C Product feature CHAIN KC163968_HBx_P-C of FT:mat_peptide KC163968_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5005). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163969_HBx_P-C Product feature CHAIN KC163969_HBx_P-C of FT:mat_peptide KC163969_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5008). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163970_HBx_P-C Product feature CHAIN KC163970_HBx_P-C of FT:mat_peptide KC163970_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5018). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEKLGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163971_HBx_P-C Product feature CHAIN KC163971_HBx_P-C of FT:mat_peptide KC163971_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5020). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFASA
>gnl|hbvpro|KC163972_HBx_P-C Product feature CHAIN KC163972_HBx_P-C of FT:mat_peptide KC163972_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5007). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163973_HBx_P-C Product feature CHAIN KC163973_HBx_P-C of FT:mat_peptide KC163973_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5012). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163974_HBx_P-C Product feature CHAIN KC163974_HBx_P-C of FT:mat_peptide KC163974_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163975_HBx_P-C Product feature CHAIN KC163975_HBx_P-C of FT:mat_peptide KC163975_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5019). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163976_HBx_P-C Product feature CHAIN KC163976_HBx_P-C of FT:mat_peptide KC163976_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5021). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163977_HBx_P-C Product feature CHAIN KC163977_HBx_P-C of FT:mat_peptide KC163977_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5024). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163978_HBx_P-C Product feature CHAIN KC163978_HBx_P-C of FT:mat_peptide KC163978_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5036). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163979_HBx_P-C Product feature CHAIN KC163979_HBx_P-C of FT:mat_peptide KC163979_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5027). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163981_HBx_P-C Product feature CHAIN KC163981_HBx_P-C of FT:mat_peptide KC163981_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8046). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCRMDPARDVLCLRPVGAESRGRPVAGPFGTPSSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163982_HBx_P-C Product feature CHAIN KC163982_HBx_P-C of FT:mat_peptide KC163982_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8055). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163983_HBx_P-C Product feature CHAIN KC163983_HBx_P-C of FT:mat_peptide KC163983_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8069). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPANNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163985_HBx_P-C Product feature CHAIN KC163985_HBx_P-C of FT:mat_peptide KC163985_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8020). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KC163986_HBx_P-C Product feature CHAIN KC163986_HBx_P-C of FT:mat_peptide KC163986_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8071). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163987_HBx_P-C Product feature CHAIN KC163987_HBx_P-C of FT:mat_peptide KC163987_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8066). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPWNFFTSA
>gnl|hbvpro|KC163988_HBx_P-C Product feature CHAIN KC163988_HBx_P-C of FT:mat_peptide KC163988_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8003). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNLFTSA
>gnl|hbvpro|KC163990_HBx_P-C Product feature CHAIN KC163990_HBx_P-C of FT:mat_peptide KC163990_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8016). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163991_HBx_P-C Product feature CHAIN KC163991_HBx_P-C of FT:mat_peptide KC163991_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8027). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163992_HBx_P-C Product feature CHAIN KC163992_HBx_P-C of FT:mat_peptide KC163992_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8045). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163993_HBx_P-C Product feature CHAIN KC163993_HBx_P-C of FT:mat_peptide KC163993_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8047). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGIPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163994_HBx_P-C Product feature CHAIN KC163994_HBx_P-C of FT:mat_peptide KC163994_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8049). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163995_HBx_P-C Product feature CHAIN KC163995_HBx_P-C of FT:mat_peptide KC163995_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8059). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163996_HBx_P-C Product feature CHAIN KC163996_HBx_P-C of FT:mat_peptide KC163996_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8062). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163997_HBx_P-C Product feature CHAIN KC163997_HBx_P-C of FT:mat_peptide KC163997_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8068). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC163998_HBx_P-C Product feature CHAIN KC163998_HBx_P-C of FT:mat_peptide KC163998_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8028). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFFFTSA
>gnl|hbvpro|KC163999_HBx_P-C Product feature CHAIN KC163999_HBx_P-C of FT:mat_peptide KC163999_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8019). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=155 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164000_HBx_P-C Product feature CHAIN KC164000_HBx_P-C of FT:mat_peptide KC164000_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8009). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164003_HBx_P-C Product feature CHAIN KC164003_HBx_P-C of FT:mat_peptide KC164003_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8001). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164004_HBx_P-C Product feature CHAIN KC164004_HBx_P-C of FT:mat_peptide KC164004_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8002). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=155 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFFTSA
>gnl|hbvpro|KC164005_HBx_P-C Product feature CHAIN KC164005_HBx_P-C of FT:mat_peptide KC164005_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8004). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164006_HBx_P-C Product feature CHAIN KC164006_HBx_P-C of FT:mat_peptide KC164006_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8006). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164007_HBx_P-C Product feature CHAIN KC164007_HBx_P-C of FT:mat_peptide KC164007_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8007). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164008_HBx_P-C Product feature CHAIN KC164008_HBx_P-C of FT:mat_peptide KC164008_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8008). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164009_HBx_P-C Product feature CHAIN KC164009_HBx_P-C of FT:mat_peptide KC164009_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8010). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164010_HBx_P-C Product feature CHAIN KC164010_HBx_P-C of FT:mat_peptide KC164010_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8011). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164011_HBx_P-C Product feature CHAIN KC164011_HBx_P-C of FT:mat_peptide KC164011_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8012). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164012_HBx_P-C Product feature CHAIN KC164012_HBx_P-C of FT:mat_peptide KC164012_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8014). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164013_HBx_P-C Product feature CHAIN KC164013_HBx_P-C of FT:mat_peptide KC164013_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8017). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164014_HBx_P-C Product feature CHAIN KC164014_HBx_P-C of FT:mat_peptide KC164014_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8018). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164015_HBx_P-C Product feature CHAIN KC164015_HBx_P-C of FT:mat_peptide KC164015_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8021). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164016_HBx_P-C Product feature CHAIN KC164016_HBx_P-C of FT:mat_peptide KC164016_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8022). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164017_HBx_P-C Product feature CHAIN KC164017_HBx_P-C of FT:mat_peptide KC164017_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8023). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164018_HBx_P-C Product feature CHAIN KC164018_HBx_P-C of FT:mat_peptide KC164018_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8024). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164019_HBx_P-C Product feature CHAIN KC164019_HBx_P-C of FT:mat_peptide KC164019_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8029). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164020_HBx_P-C Product feature CHAIN KC164020_HBx_P-C of FT:mat_peptide KC164020_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8030). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164021_HBx_P-C Product feature CHAIN KC164021_HBx_P-C of FT:mat_peptide KC164021_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8044). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164022_HBx_P-C Product feature CHAIN KC164022_HBx_P-C of FT:mat_peptide KC164022_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8048). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164023_HBx_P-C Product feature CHAIN KC164023_HBx_P-C of FT:mat_peptide KC164023_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8051). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=155 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFFTSA
>gnl|hbvpro|KC164024_HBx_P-C Product feature CHAIN KC164024_HBx_P-C of FT:mat_peptide KC164024_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8052). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164025_HBx_P-C Product feature CHAIN KC164025_HBx_P-C of FT:mat_peptide KC164025_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8053). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164026_HBx_P-C Product feature CHAIN KC164026_HBx_P-C of FT:mat_peptide KC164026_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8057). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164027_HBx_P-C Product feature CHAIN KC164027_HBx_P-C of FT:mat_peptide KC164027_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8060). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164028_HBx_P-C Product feature CHAIN KC164028_HBx_P-C of FT:mat_peptide KC164028_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8061). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164029_HBx_P-C Product feature CHAIN KC164029_HBx_P-C of FT:mat_peptide KC164029_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8063). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164030_HBx_P-C Product feature CHAIN KC164030_HBx_P-C of FT:mat_peptide KC164030_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8067). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164033_HBx_P-C Product feature CHAIN KC164033_HBx_P-C of FT:mat_peptide KC164033_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8070). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164036_HBx_P-C Product feature CHAIN KC164036_HBx_P-C of FT:mat_peptide KC164036_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10020). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHPSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSP
>gnl|hbvpro|KC164037_HBx_P-C Product feature CHAIN KC164037_HBx_P-C of FT:mat_peptide KC164037_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10025). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEGTRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164038_HBx_P-C Product feature CHAIN KC164038_HBx_P-C of FT:mat_peptide KC164038_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7035). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164040_HBx_P-C Product feature CHAIN KC164040_HBx_P-C of FT:mat_peptide KC164040_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10024). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164041_HBx_P-C Product feature CHAIN KC164041_HBx_P-C of FT:mat_peptide KC164041_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10026). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164042_HBx_P-C Product feature CHAIN KC164042_HBx_P-C of FT:mat_peptide KC164042_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10042). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164044_HBx_P-C Product feature CHAIN KC164044_HBx_P-C of FT:mat_peptide KC164044_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10022). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164046_HBx_P-C Product feature CHAIN KC164046_HBx_P-C of FT:mat_peptide KC164046_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10001). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164047_HBx_P-C Product feature CHAIN KC164047_HBx_P-C of FT:mat_peptide KC164047_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10002). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164048_HBx_P-C Product feature CHAIN KC164048_HBx_P-C of FT:mat_peptide KC164048_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10004). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164049_HBx_P-C Product feature CHAIN KC164049_HBx_P-C of FT:mat_peptide KC164049_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10005). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164050_HBx_P-C Product feature CHAIN KC164050_HBx_P-C of FT:mat_peptide KC164050_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10006). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164051_HBx_P-C Product feature CHAIN KC164051_HBx_P-C of FT:mat_peptide KC164051_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10007). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164052_HBx_P-C Product feature CHAIN KC164052_HBx_P-C of FT:mat_peptide KC164052_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10009). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164053_HBx_P-C Product feature CHAIN KC164053_HBx_P-C of FT:mat_peptide KC164053_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10010). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164054_HBx_P-C Product feature CHAIN KC164054_HBx_P-C of FT:mat_peptide KC164054_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10011). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164055_HBx_P-C Product feature CHAIN KC164055_HBx_P-C of FT:mat_peptide KC164055_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10012). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164056_HBx_P-C Product feature CHAIN KC164056_HBx_P-C of FT:mat_peptide KC164056_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10013). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164057_HBx_P-C Product feature CHAIN KC164057_HBx_P-C of FT:mat_peptide KC164057_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164058_HBx_P-C Product feature CHAIN KC164058_HBx_P-C of FT:mat_peptide KC164058_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10016). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164059_HBx_P-C Product feature CHAIN KC164059_HBx_P-C of FT:mat_peptide KC164059_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10017). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164060_HBx_P-C Product feature CHAIN KC164060_HBx_P-C of FT:mat_peptide KC164060_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10018). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164061_HBx_P-C Product feature CHAIN KC164061_HBx_P-C of FT:mat_peptide KC164061_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10019). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164062_HBx_P-C Product feature CHAIN KC164062_HBx_P-C of FT:mat_peptide KC164062_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10023). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164063_HBx_P-C Product feature CHAIN KC164063_HBx_P-C of FT:mat_peptide KC164063_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10027). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164065_HBx_P-C Product feature CHAIN KC164065_HBx_P-C of FT:mat_peptide KC164065_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10031). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164066_HBx_P-C Product feature CHAIN KC164066_HBx_P-C of FT:mat_peptide KC164066_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10032). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164067_HBx_P-C Product feature CHAIN KC164067_HBx_P-C of FT:mat_peptide KC164067_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10033). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164068_HBx_P-C Product feature CHAIN KC164068_HBx_P-C of FT:mat_peptide KC164068_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10034). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164069_HBx_P-C Product feature CHAIN KC164069_HBx_P-C of FT:mat_peptide KC164069_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10035). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164070_HBx_P-C Product feature CHAIN KC164070_HBx_P-C of FT:mat_peptide KC164070_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10036). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164071_HBx_P-C Product feature CHAIN KC164071_HBx_P-C of FT:mat_peptide KC164071_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10039). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164072_HBx_P-C Product feature CHAIN KC164072_HBx_P-C of FT:mat_peptide KC164072_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10040). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164085_HBx_P-C Product feature CHAIN KC164085_HBx_P-C of FT:mat_peptide KC164085_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2021). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSAY
>gnl|hbvpro|KC164086_HBx_P-C Product feature CHAIN KC164086_HBx_P-C of FT:mat_peptide KC164086_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2022). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSTSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164087_HBx_P-C Product feature CHAIN KC164087_HBx_P-C of FT:mat_peptide KC164087_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2024). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164088_HBx_P-C Product feature CHAIN KC164088_HBx_P-C of FT:mat_peptide KC164088_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2002). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164089_HBx_P-C Product feature CHAIN KC164089_HBx_P-C of FT:mat_peptide KC164089_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2043). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKDFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164100_HBx_P-C Product feature CHAIN KC164100_HBx_P-C of FT:mat_peptide KC164100_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2001). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164101_HBx_P-C Product feature CHAIN KC164101_HBx_P-C of FT:mat_peptide KC164101_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2008). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164102_HBx_P-C Product feature CHAIN KC164102_HBx_P-C of FT:mat_peptide KC164102_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2009). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164103_HBx_P-C Product feature CHAIN KC164103_HBx_P-C of FT:mat_peptide KC164103_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2038). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164104_HBx_P-C Product feature CHAIN KC164104_HBx_P-C of FT:mat_peptide KC164104_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2040). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164105_HBx_P-C Product feature CHAIN KC164105_HBx_P-C of FT:mat_peptide KC164105_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2041). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164106_HBx_P-C Product feature CHAIN KC164106_HBx_P-C of FT:mat_peptide KC164106_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2053). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164107_HBx_P-C Product feature CHAIN KC164107_HBx_P-C of FT:mat_peptide KC164107_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164108_HBx_P-C Product feature CHAIN KC164108_HBx_P-C of FT:mat_peptide KC164108_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164109_HBx_P-C Product feature CHAIN KC164109_HBx_P-C of FT:mat_peptide KC164109_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2017). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164110_HBx_P-C Product feature CHAIN KC164110_HBx_P-C of FT:mat_peptide KC164110_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2019). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164111_HBx_P-C Product feature CHAIN KC164111_HBx_P-C of FT:mat_peptide KC164111_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2028). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164112_HBx_P-C Product feature CHAIN KC164112_HBx_P-C of FT:mat_peptide KC164112_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2030). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164113_HBx_P-C Product feature CHAIN KC164113_HBx_P-C of FT:mat_peptide KC164113_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2034). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164114_HBx_P-C Product feature CHAIN KC164114_HBx_P-C of FT:mat_peptide KC164114_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2035). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164115_HBx_P-C Product feature CHAIN KC164115_HBx_P-C of FT:mat_peptide KC164115_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2036). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164116_HBx_P-C Product feature CHAIN KC164116_HBx_P-C of FT:mat_peptide KC164116_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2042). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164117_HBx_P-C Product feature CHAIN KC164117_HBx_P-C of FT:mat_peptide KC164117_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2047). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164118_HBx_P-C Product feature CHAIN KC164118_HBx_P-C of FT:mat_peptide KC164118_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2049). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164120_HBx_P-C Product feature CHAIN KC164120_HBx_P-C of FT:mat_peptide KC164120_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4040). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164121_HBx_P-C Product feature CHAIN KC164121_HBx_P-C of FT:mat_peptide KC164121_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4037). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNASQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164122_HBx_P-C Product feature CHAIN KC164122_HBx_P-C of FT:mat_peptide KC164122_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4033). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMPTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164123_HBx_P-C Product feature CHAIN KC164123_HBx_P-C of FT:mat_peptide KC164123_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4034). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAAGLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164124_HBx_P-C Product feature CHAIN KC164124_HBx_P-C of FT:mat_peptide KC164124_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4036). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164125_HBx_P-C Product feature CHAIN KC164125_HBx_P-C of FT:mat_peptide KC164125_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4038). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCTLRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164126_HBx_P-C Product feature CHAIN KC164126_HBx_P-C of FT:mat_peptide KC164126_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4018). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVRADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164127_HBx_P-C Product feature CHAIN KC164127_HBx_P-C of FT:mat_peptide KC164127_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164128_HBx_P-C Product feature CHAIN KC164128_HBx_P-C of FT:mat_peptide KC164128_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4021). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164129_HBx_P-C Product feature CHAIN KC164129_HBx_P-C of FT:mat_peptide KC164129_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4024). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164130_HBx_P-C Product feature CHAIN KC164130_HBx_P-C of FT:mat_peptide KC164130_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4030). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164131_HBx_P-C Product feature CHAIN KC164131_HBx_P-C of FT:mat_peptide KC164131_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3001). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164132_HBx_P-C Product feature CHAIN KC164132_HBx_P-C of FT:mat_peptide KC164132_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4001). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164133_HBx_P-C Product feature CHAIN KC164133_HBx_P-C of FT:mat_peptide KC164133_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4004). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164134_HBx_P-C Product feature CHAIN KC164134_HBx_P-C of FT:mat_peptide KC164134_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4006). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164135_HBx_P-C Product feature CHAIN KC164135_HBx_P-C of FT:mat_peptide KC164135_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4008). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164136_HBx_P-C Product feature CHAIN KC164136_HBx_P-C of FT:mat_peptide KC164136_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4009). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164137_HBx_P-C Product feature CHAIN KC164137_HBx_P-C of FT:mat_peptide KC164137_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4010). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164138_HBx_P-C Product feature CHAIN KC164138_HBx_P-C of FT:mat_peptide KC164138_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4011). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164139_HBx_P-C Product feature CHAIN KC164139_HBx_P-C of FT:mat_peptide KC164139_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4012). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164140_HBx_P-C Product feature CHAIN KC164140_HBx_P-C of FT:mat_peptide KC164140_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4016). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164141_HBx_P-C Product feature CHAIN KC164141_HBx_P-C of FT:mat_peptide KC164141_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4017). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164142_HBx_P-C Product feature CHAIN KC164142_HBx_P-C of FT:mat_peptide KC164142_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4019). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164143_HBx_P-C Product feature CHAIN KC164143_HBx_P-C of FT:mat_peptide KC164143_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4020). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164144_HBx_P-C Product feature CHAIN KC164144_HBx_P-C of FT:mat_peptide KC164144_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4022). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164145_HBx_P-C Product feature CHAIN KC164145_HBx_P-C of FT:mat_peptide KC164145_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4023). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164146_HBx_P-C Product feature CHAIN KC164146_HBx_P-C of FT:mat_peptide KC164146_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4026). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164147_HBx_P-C Product feature CHAIN KC164147_HBx_P-C of FT:mat_peptide KC164147_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4028). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164148_HBx_P-C Product feature CHAIN KC164148_HBx_P-C of FT:mat_peptide KC164148_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4031). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164149_HBx_P-C Product feature CHAIN KC164149_HBx_P-C of FT:mat_peptide KC164149_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4032). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164150_HBx_P-C Product feature CHAIN KC164150_HBx_P-C of FT:mat_peptide KC164150_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4035). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC164151_HBx_P-C Product feature CHAIN KC164151_HBx_P-C of FT:mat_peptide KC164151_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4013). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC315399_HBx_P-C Product feature CHAIN KC315399_HBx_P-C of FT:mat_peptide KC315399_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0507). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRVE
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774179_HBx_P-C Product feature CHAIN KC774179_HBx_P-C of FT:mat_peptide KC774179_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SX11xa1580). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774180_HBx_P-C Product feature CHAIN KC774180_HBx_P-C of FT:mat_peptide KC774180_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1002). Complete genome. [Hepadnaviridae] (length=154 residues).
MVPRVCGQLDPARDVRCLRPVGPESRGPPVSRPLGPLWSPFSFAVPANRGAHGSLRGLPVCPFSSAGPCALRFTSSRCME
TTVNPHQVLPKVLHKRTQGLSAMSTTDLEAYFKDCVFKDWEELGEERGVKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774181_HBx_P-C Product feature CHAIN KC774181_HBx_P-C of FT:mat_peptide KC774181_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1012). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGSFGSLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774182_HBx_P-C Product feature CHAIN KC774182_HBx_P-C of FT:mat_peptide KC774182_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774184_HBx_P-C Product feature CHAIN KC774184_HBx_P-C of FT:mat_peptide KC774184_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774185_HBx_P-C Product feature CHAIN KC774185_HBx_P-C of FT:mat_peptide KC774185_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1023). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774187_HBx_P-C Product feature CHAIN KC774187_HBx_P-C of FT:mat_peptide KC774187_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774189_HBx_P-C Product feature CHAIN KC774189_HBx_P-C of FT:mat_peptide KC774189_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1030). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPFGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774190_HBx_P-C Product feature CHAIN KC774190_HBx_P-C of FT:mat_peptide KC774190_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1031). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774191_HBx_P-C Product feature CHAIN KC774191_HBx_P-C of FT:mat_peptide KC774191_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1032). Complete genome. [Hepadnaviridae] (length=154 residues).
MDDRVCCQLDPARDVLCLRPVGVESRGRPVSGPFGAFPSPSSFAVPADHGAHLSLRGLPVCALLSAGPCALRFTCARCME
TTVNAHQVLPKVLHKRTLGLSAMLTTDLEAYFKDCVFKDWEELGEEIRIMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774192_HBx_P-C Product feature CHAIN KC774192_HBx_P-C of FT:mat_peptide KC774192_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1034). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774194_HBx_P-C Product feature CHAIN KC774194_HBx_P-C of FT:mat_peptide KC774194_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1036). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774195_HBx_P-C Product feature CHAIN KC774195_HBx_P-C of FT:mat_peptide KC774195_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1046). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGTFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774196_HBx_P-C Product feature CHAIN KC774196_HBx_P-C of FT:mat_peptide KC774196_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2015). Complete genome. [Hepadnaviridae] (length=154 residues).
MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHGAHLSIRGLPVCAVSSPGPCALRFTCARCME
TTVNARQVLPKVLHKRTSGLSARLTTDLEAYFKACVFKEWEELGEESRIKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774197_HBx_P-C Product feature CHAIN KC774197_HBx_P-C of FT:mat_peptide KC774197_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2035). Complete genome. [Hepadnaviridae] (length=154 residues).
MVARVCCQLDPARDVLCLRPVGAESRGRPVSGPCGALPSPCSSAVPADRGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRIKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774199_HBx_P-C Product feature CHAIN KC774199_HBx_P-C of FT:mat_peptide KC774199_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2040). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTPSAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774200_HBx_P-C Product feature CHAIN KC774200_HBx_P-C of FT:mat_peptide KC774200_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2044). Complete genome. [Hepadnaviridae] (length=154 residues).
MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPTLFAVPADHGAHLSFRGLPVCAFTSAGPCALRFTCARCME
TTVNAHQVLPKVLHKRTSGLSARSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774202_HBx_P-C Product feature CHAIN KC774202_HBx_P-C of FT:mat_peptide KC774202_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2048). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774203_HBx_P-C Product feature CHAIN KC774203_HBx_P-C of FT:mat_peptide KC774203_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2051). Complete genome. [Hepadnaviridae] (length=154 residues).
MDVRVCCQVDRARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCAFCFTSARRME
TTVNAHQVLPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDREELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774204_HBx_P-C Product feature CHAIN KC774204_HBx_P-C of FT:mat_peptide KC774204_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2056). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774205_HBx_P-C Product feature CHAIN KC774205_HBx_P-C of FT:mat_peptide KC774205_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2058). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774206_HBx_P-C Product feature CHAIN KC774206_HBx_P-C of FT:mat_peptide KC774206_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2079). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774207_HBx_P-C Product feature CHAIN KC774207_HBx_P-C of FT:mat_peptide KC774207_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2084). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774208_HBx_P-C Product feature CHAIN KC774208_HBx_P-C of FT:mat_peptide KC774208_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2086). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774209_HBx_P-C Product feature CHAIN KC774209_HBx_P-C of FT:mat_peptide KC774209_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2087). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774210_HBx_P-C Product feature CHAIN KC774210_HBx_P-C of FT:mat_peptide KC774210_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2098). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774211_HBx_P-C Product feature CHAIN KC774211_HBx_P-C of FT:mat_peptide KC774211_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774213_HBx_P-C Product feature CHAIN KC774213_HBx_P-C of FT:mat_peptide KC774213_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2123). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNATQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774214_HBx_P-C Product feature CHAIN KC774214_HBx_P-C of FT:mat_peptide KC774214_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2124). Complete genome. [Hepadnaviridae] (length=154 residues).
MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNATQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774215_HBx_P-C Product feature CHAIN KC774215_HBx_P-C of FT:mat_peptide KC774215_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2125). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774216_HBx_P-C Product feature CHAIN KC774216_HBx_P-C of FT:mat_peptide KC774216_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774217_HBx_P-C Product feature CHAIN KC774217_HBx_P-C of FT:mat_peptide KC774217_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2129). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774218_HBx_P-C Product feature CHAIN KC774218_HBx_P-C of FT:mat_peptide KC774218_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2134). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774219_HBx_P-C Product feature CHAIN KC774219_HBx_P-C of FT:mat_peptide KC774219_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2144). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774220_HBx_P-C Product feature CHAIN KC774220_HBx_P-C of FT:mat_peptide KC774220_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2152). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSTVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774221_HBx_P-C Product feature CHAIN KC774221_HBx_P-C of FT:mat_peptide KC774221_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2153). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774223_HBx_P-C Product feature CHAIN KC774223_HBx_P-C of FT:mat_peptide KC774223_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2183). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774224_HBx_P-C Product feature CHAIN KC774224_HBx_P-C of FT:mat_peptide KC774224_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2184). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774225_HBx_P-C Product feature CHAIN KC774225_HBx_P-C of FT:mat_peptide KC774225_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2188). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774226_HBx_P-C Product feature CHAIN KC774226_HBx_P-C of FT:mat_peptide KC774226_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2194). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774227_HBx_P-C Product feature CHAIN KC774227_HBx_P-C of FT:mat_peptide KC774227_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1009). Complete genome. [Hepadnaviridae] (length=154 residues).
MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFLFAVPTDHGGHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAKSTTDLEAYFKDCVFKNWEELGEEIRLKVFVTGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774228_HBx_P-C Product feature CHAIN KC774228_HBx_P-C of FT:mat_peptide KC774228_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1023). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774229_HBx_P-C Product feature CHAIN KC774229_HBx_P-C of FT:mat_peptide KC774229_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1024). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSSSAVPADHGGHLSLRGLPVCAFSSAGPCALRFTSASCME
TPVNAPQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774231_HBx_P-C Product feature CHAIN KC774231_HBx_P-C of FT:mat_peptide KC774231_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1028). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774232_HBx_P-C Product feature CHAIN KC774232_HBx_P-C of FT:mat_peptide KC774232_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1031). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774233_HBx_P-C Product feature CHAIN KC774233_HBx_P-C of FT:mat_peptide KC774233_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1035). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774235_HBx_P-C Product feature CHAIN KC774235_HBx_P-C of FT:mat_peptide KC774235_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1041). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPSGALPSPSLSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774236_HBx_P-C Product feature CHAIN KC774236_HBx_P-C of FT:mat_peptide KC774236_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1042). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774237_HBx_P-C Product feature CHAIN KC774237_HBx_P-C of FT:mat_peptide KC774237_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1051). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774238_HBx_P-C Product feature CHAIN KC774238_HBx_P-C of FT:mat_peptide KC774238_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1052). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774239_HBx_P-C Product feature CHAIN KC774239_HBx_P-C of FT:mat_peptide KC774239_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1063). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774240_HBx_P-C Product feature CHAIN KC774240_HBx_P-C of FT:mat_peptide KC774240_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1066). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774241_HBx_P-C Product feature CHAIN KC774241_HBx_P-C of FT:mat_peptide KC774241_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1067). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPACAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774242_HBx_P-C Product feature CHAIN KC774242_HBx_P-C of FT:mat_peptide KC774242_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1070). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRSFSGPFGALSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774243_HBx_P-C Product feature CHAIN KC774243_HBx_P-C of FT:mat_peptide KC774243_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1007). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774244_HBx_P-C Product feature CHAIN KC774244_HBx_P-C of FT:mat_peptide KC774244_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1012). Complete genome. [Hepadnaviridae] (length=154 residues).
MVARVCCQVDHARDVLSLRPVGAESRGRPISGPFGTLRSHCSFAVPADHGAHLSTRGLPVCPFSSAGPCALRLTSSRRME
TTVNAHQVFPKVSHKRTSGLSAMSKTDREAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774245_HBx_P-C Product feature CHAIN KC774245_HBx_P-C of FT:mat_peptide KC774245_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774247_HBx_P-C Product feature CHAIN KC774247_HBx_P-C of FT:mat_peptide KC774247_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1021). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774248_HBx_P-C Product feature CHAIN KC774248_HBx_P-C of FT:mat_peptide KC774248_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774249_HBx_P-C Product feature CHAIN KC774249_HBx_P-C of FT:mat_peptide KC774249_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774250_HBx_P-C Product feature CHAIN KC774250_HBx_P-C of FT:mat_peptide KC774250_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1029). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774251_HBx_P-C Product feature CHAIN KC774251_HBx_P-C of FT:mat_peptide KC774251_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1030). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774252_HBx_P-C Product feature CHAIN KC774252_HBx_P-C of FT:mat_peptide KC774252_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1031). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774253_HBx_P-C Product feature CHAIN KC774253_HBx_P-C of FT:mat_peptide KC774253_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1039). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARNVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774254_HBx_P-C Product feature CHAIN KC774254_HBx_P-C of FT:mat_peptide KC774254_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1046). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774255_HBx_P-C Product feature CHAIN KC774255_HBx_P-C of FT:mat_peptide KC774255_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1050). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774256_HBx_P-C Product feature CHAIN KC774256_HBx_P-C of FT:mat_peptide KC774256_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1053). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774257_HBx_P-C Product feature CHAIN KC774257_HBx_P-C of FT:mat_peptide KC774257_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1056). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774259_HBx_P-C Product feature CHAIN KC774259_HBx_P-C of FT:mat_peptide KC774259_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1061). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774260_HBx_P-C Product feature CHAIN KC774260_HBx_P-C of FT:mat_peptide KC774260_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1065). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774261_HBx_P-C Product feature CHAIN KC774261_HBx_P-C of FT:mat_peptide KC774261_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1067). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSLSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774262_HBx_P-C Product feature CHAIN KC774262_HBx_P-C of FT:mat_peptide KC774262_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1068). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774264_HBx_P-C Product feature CHAIN KC774264_HBx_P-C of FT:mat_peptide KC774264_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1072). Complete genome. [Hepadnaviridae] (length=154 residues).
MDARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALRSPSSFAVPADHGAHLSIRGLPVCALSSAGPCALRFTCARCME
TTVNAHQVLPKVLHKRTRGLSARSTTDLEAYFKDCVFKEWEELGEEIRIKVCVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774265_HBx_P-C Product feature CHAIN KC774265_HBx_P-C of FT:mat_peptide KC774265_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1074). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVRAESRGRPVSGPFGALPSPSSFAVPADHGAHLSLRGLPVCAFSSAGPCALRFTCARCME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRIKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774266_HBx_P-C Product feature CHAIN KC774266_HBx_P-C of FT:mat_peptide KC774266_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1075). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774267_HBx_P-C Product feature CHAIN KC774267_HBx_P-C of FT:mat_peptide KC774267_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1084). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774268_HBx_P-C Product feature CHAIN KC774268_HBx_P-C of FT:mat_peptide KC774268_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1085). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774269_HBx_P-C Product feature CHAIN KC774269_HBx_P-C of FT:mat_peptide KC774269_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1086). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774270_HBx_P-C Product feature CHAIN KC774270_HBx_P-C of FT:mat_peptide KC774270_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1093). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774271_HBx_P-C Product feature CHAIN KC774271_HBx_P-C of FT:mat_peptide KC774271_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1094). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQVLPKVLHKRTLGLAAMSMTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774272_HBx_P-C Product feature CHAIN KC774272_HBx_P-C of FT:mat_peptide KC774272_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1107). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774274_HBx_P-C Product feature CHAIN KC774274_HBx_P-C of FT:mat_peptide KC774274_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1124). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774275_HBx_P-C Product feature CHAIN KC774275_HBx_P-C of FT:mat_peptide KC774275_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774276_HBx_P-C Product feature CHAIN KC774276_HBx_P-C of FT:mat_peptide KC774276_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1128). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774277_HBx_P-C Product feature CHAIN KC774277_HBx_P-C of FT:mat_peptide KC774277_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2151). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774278_HBx_P-C Product feature CHAIN KC774278_HBx_P-C of FT:mat_peptide KC774278_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2155). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSLSAVPADHGAHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774279_HBx_P-C Product feature CHAIN KC774279_HBx_P-C of FT:mat_peptide KC774279_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2157). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSPAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774280_HBx_P-C Product feature CHAIN KC774280_HBx_P-C of FT:mat_peptide KC774280_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1053). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774281_HBx_P-C Product feature CHAIN KC774281_HBx_P-C of FT:mat_peptide KC774281_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1058). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGDCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774282_HBx_P-C Product feature CHAIN KC774282_HBx_P-C of FT:mat_peptide KC774282_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1060). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774283_HBx_P-C Product feature CHAIN KC774283_HBx_P-C of FT:mat_peptide KC774283_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1062). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRILGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774284_HBx_P-C Product feature CHAIN KC774284_HBx_P-C of FT:mat_peptide KC774284_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1065). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774285_HBx_P-C Product feature CHAIN KC774285_HBx_P-C of FT:mat_peptide KC774285_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1067). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774286_HBx_P-C Product feature CHAIN KC774286_HBx_P-C of FT:mat_peptide KC774286_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1076). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774287_HBx_P-C Product feature CHAIN KC774287_HBx_P-C of FT:mat_peptide KC774287_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1087). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774288_HBx_P-C Product feature CHAIN KC774288_HBx_P-C of FT:mat_peptide KC774288_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1175). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774289_HBx_P-C Product feature CHAIN KC774289_HBx_P-C of FT:mat_peptide KC774289_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1180). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774290_HBx_P-C Product feature CHAIN KC774290_HBx_P-C of FT:mat_peptide KC774290_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1183). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNGHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKEWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774292_HBx_P-C Product feature CHAIN KC774292_HBx_P-C of FT:mat_peptide KC774292_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1196). Complete genome. [Hepadnaviridae] (length=154 residues).
MDARLCSQLDPARAILYLRPVGAESRGRPVSGQFGPLPSLFASAVPANHGAHLSLRGLPVCAFSSAGPCALRFTYARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774293_HBx_P-C Product feature CHAIN KC774293_HBx_P-C of FT:mat_peptide KC774293_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1204). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774295_HBx_P-C Product feature CHAIN KC774295_HBx_P-C of FT:mat_peptide KC774295_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1207). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774296_HBx_P-C Product feature CHAIN KC774296_HBx_P-C of FT:mat_peptide KC774296_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1210). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEETRLKVYVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774297_HBx_P-C Product feature CHAIN KC774297_HBx_P-C of FT:mat_peptide KC774297_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1580). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774298_HBx_P-C Product feature CHAIN KC774298_HBx_P-C of FT:mat_peptide KC774298_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1586). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774299_HBx_P-C Product feature CHAIN KC774299_HBx_P-C of FT:mat_peptide KC774299_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1601). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774300_HBx_P-C Product feature CHAIN KC774300_HBx_P-C of FT:mat_peptide KC774300_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1602). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774301_HBx_P-C Product feature CHAIN KC774301_HBx_P-C of FT:mat_peptide KC774301_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1627). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774302_HBx_P-C Product feature CHAIN KC774302_HBx_P-C of FT:mat_peptide KC774302_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1650). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774303_HBx_P-C Product feature CHAIN KC774303_HBx_P-C of FT:mat_peptide KC774303_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1659). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774304_HBx_P-C Product feature CHAIN KC774304_HBx_P-C of FT:mat_peptide KC774304_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1662). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774306_HBx_P-C Product feature CHAIN KC774306_HBx_P-C of FT:mat_peptide KC774306_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRSFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774308_HBx_P-C Product feature CHAIN KC774308_HBx_P-C of FT:mat_peptide KC774308_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2019). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774309_HBx_P-C Product feature CHAIN KC774309_HBx_P-C of FT:mat_peptide KC774309_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2020). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774310_HBx_P-C Product feature CHAIN KC774310_HBx_P-C of FT:mat_peptide KC774310_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSDSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774311_HBx_P-C Product feature CHAIN KC774311_HBx_P-C of FT:mat_peptide KC774311_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2026). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSLTSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774312_HBx_P-C Product feature CHAIN KC774312_HBx_P-C of FT:mat_peptide KC774312_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2029). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774313_HBx_P-C Product feature CHAIN KC774313_HBx_P-C of FT:mat_peptide KC774313_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2032). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVNVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774314_HBx_P-C Product feature CHAIN KC774314_HBx_P-C of FT:mat_peptide KC774314_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2033). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774315_HBx_P-C Product feature CHAIN KC774315_HBx_P-C of FT:mat_peptide KC774315_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2039). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774316_HBx_P-C Product feature CHAIN KC774316_HBx_P-C of FT:mat_peptide KC774316_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2041). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSFAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774318_HBx_P-C Product feature CHAIN KC774318_HBx_P-C of FT:mat_peptide KC774318_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2043). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774319_HBx_P-C Product feature CHAIN KC774319_HBx_P-C of FT:mat_peptide KC774319_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2044). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNDHQALPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774320_HBx_P-C Product feature CHAIN KC774320_HBx_P-C of FT:mat_peptide KC774320_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2051). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFNDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774321_HBx_P-C Product feature CHAIN KC774321_HBx_P-C of FT:mat_peptide KC774321_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2052). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774325_HBx_P-C Product feature CHAIN KC774325_HBx_P-C of FT:mat_peptide KC774325_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2063). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSRPFGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774326_HBx_P-C Product feature CHAIN KC774326_HBx_P-C of FT:mat_peptide KC774326_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2067). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774327_HBx_P-C Product feature CHAIN KC774327_HBx_P-C of FT:mat_peptide KC774327_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2069). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAIPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774329_HBx_P-C Product feature CHAIN KC774329_HBx_P-C of FT:mat_peptide KC774329_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2074). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPVSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHNRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774330_HBx_P-C Product feature CHAIN KC774330_HBx_P-C of FT:mat_peptide KC774330_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2075). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGNLPSPSSSAVPAAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774331_HBx_P-C Product feature CHAIN KC774331_HBx_P-C of FT:mat_peptide KC774331_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2077). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774333_HBx_P-C Product feature CHAIN KC774333_HBx_P-C of FT:mat_peptide KC774333_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAYLSLRGLPVCAFSAAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774334_HBx_P-C Product feature CHAIN KC774334_HBx_P-C of FT:mat_peptide KC774334_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1007). Complete genome. [Hepadnaviridae] (length=154 residues).
MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTIGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774335_HBx_P-C Product feature CHAIN KC774335_HBx_P-C of FT:mat_peptide KC774335_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPIGDLPSPSTSAVPAEHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774336_HBx_P-C Product feature CHAIN KC774336_HBx_P-C of FT:mat_peptide KC774336_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1015). Complete genome. [Hepadnaviridae] (length=154 residues).
MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHGAHLSIRGLPVCAVSSPGPCALRFTCARCME
TTVNARQVLPKVLHKRTIGLSARLTTDLEAYFKACVFKEWEELGEESRIKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774337_HBx_P-C Product feature CHAIN KC774337_HBx_P-C of FT:mat_peptide KC774337_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1019). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSRPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774338_HBx_P-C Product feature CHAIN KC774338_HBx_P-C of FT:mat_peptide KC774338_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774339_HBx_P-C Product feature CHAIN KC774339_HBx_P-C of FT:mat_peptide KC774339_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1029). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774340_HBx_P-C Product feature CHAIN KC774340_HBx_P-C of FT:mat_peptide KC774340_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1034). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774342_HBx_P-C Product feature CHAIN KC774342_HBx_P-C of FT:mat_peptide KC774342_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1044). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774343_HBx_P-C Product feature CHAIN KC774343_HBx_P-C of FT:mat_peptide KC774343_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1046). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774345_HBx_P-C Product feature CHAIN KC774345_HBx_P-C of FT:mat_peptide KC774345_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1076). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSLSAVPADHGAHLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774346_HBx_P-C Product feature CHAIN KC774346_HBx_P-C of FT:mat_peptide KC774346_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1078). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774347_HBx_P-C Product feature CHAIN KC774347_HBx_P-C of FT:mat_peptide KC774347_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1092). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774348_HBx_P-C Product feature CHAIN KC774348_HBx_P-C of FT:mat_peptide KC774348_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1093). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAVPATHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774351_HBx_P-C Product feature CHAIN KC774351_HBx_P-C of FT:mat_peptide KC774351_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1031). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGPMGSRPEPPRGRPCIRRIGGETRGGPVSGPSGPFPSRCPCGAPGAPGAPRSSRGLPLCACSSAGPCTLRFTHADRPE
TAVNPHQVFPQVVQKRTTGGSAASKTDLQAYRPTLKVKEWKEWEKEGRGRILVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774352_HBx_P-C Product feature CHAIN KC774352_HBx_P-C of FT:mat_peptide KC774352_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1042). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774353_HBx_P-C Product feature CHAIN KC774353_HBx_P-C of FT:mat_peptide KC774353_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1043). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774354_HBx_P-C Product feature CHAIN KC774354_HBx_P-C of FT:mat_peptide KC774354_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1048). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774355_HBx_P-C Product feature CHAIN KC774355_HBx_P-C of FT:mat_peptide KC774355_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1070). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774356_HBx_P-C Product feature CHAIN KC774356_HBx_P-C of FT:mat_peptide KC774356_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1080). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774357_HBx_P-C Product feature CHAIN KC774357_HBx_P-C of FT:mat_peptide KC774357_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1081). Complete genome. [Hepadnaviridae] (length=154 residues).
MAVRGCCQLDPARDVLGLRPVGVESRGRPVSGPFGHLPSLSSSAVPADHGAHLCLRGLPVGAFSFPGPCAVRFTFARRME
TAVNPHQVFPKVLQKRTLGLSEKSTTDLEASFKDCVFKESLHCVEEISLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774358_HBx_P-C Product feature CHAIN KC774358_HBx_P-C of FT:mat_peptide KC774358_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1098). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774359_HBx_P-C Product feature CHAIN KC774359_HBx_P-C of FT:mat_peptide KC774359_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1099). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARRVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774360_HBx_P-C Product feature CHAIN KC774360_HBx_P-C of FT:mat_peptide KC774360_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774361_HBx_P-C Product feature CHAIN KC774361_HBx_P-C of FT:mat_peptide KC774361_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVIGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC814852_HBx_P-C Product feature CHAIN KC814852_HBx_P-C of FT:mat_peptide KC814852_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020941C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSE
>gnl|hbvpro|KC814854_HBx_P-C Product feature CHAIN KC814854_HBx_P-C of FT:mat_peptide KC814854_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020943C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
KAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814855_HBx_P-C Product feature CHAIN KC814855_HBx_P-C of FT:mat_peptide KC814855_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020944C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAVRVCCQLDLARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814857_HBx_P-C Product feature CHAIN KC814857_HBx_P-C of FT:mat_peptide KC814857_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020946C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC814858_HBx_P-C Product feature CHAIN KC814858_HBx_P-C of FT:mat_peptide KC814858_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020947C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814862_HBx_P-C Product feature CHAIN KC814862_HBx_P-C of FT:mat_peptide KC814862_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209411C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814863_HBx_P-C Product feature CHAIN KC814863_HBx_P-C of FT:mat_peptide KC814863_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209412C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLGLARDVLCLRPVGAESRGRPVSGPFGLLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTPGLAAMSTTDLEAYFKDCLFKDWEELGEKIRLMIFVLRGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814865_HBx_P-C Product feature CHAIN KC814865_HBx_P-C of FT:mat_peptide KC814865_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209414C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
LAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814866_HBx_P-C Product feature CHAIN KC814866_HBx_P-C of FT:mat_peptide KC814866_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209415C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDSMREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSE
>gnl|hbvpro|KC814871_HBx_P-C Product feature CHAIN KC814871_HBx_P-C of FT:mat_peptide KC814871_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209420C). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
KAARVCCQLNSAGDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGKNTKLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814874_HBx_P-C Product feature CHAIN KC814874_HBx_P-C of FT:mat_peptide KC814874_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209423C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCLRRQCNFFTSA
>gnl|hbvpro|KC814877_HBx_P-C Product feature CHAIN KC814877_HBx_P-C of FT:mat_peptide KC814877_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209426C). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLTEAGDVLCLRPVGAESRGRPVSGPVGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814879_HBx_P-C Product feature CHAIN KC814879_HBx_P-C of FT:mat_peptide KC814879_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209428C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDILCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVLTLRGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814880_HBx_P-C Product feature CHAIN KC814880_HBx_P-C of FT:mat_peptide KC814880_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209429C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
FAARVCCQLDDAEDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814881_HBx_P-C Product feature CHAIN KC814881_HBx_P-C of FT:mat_peptide KC814881_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209430C). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
LAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCLRRLVNFFTSA
>gnl|hbvpro|KC814882_HBx_P-C Product feature CHAIN KC814882_HBx_P-C of FT:mat_peptide KC814882_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209431C). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLVLMPFVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814884_HBx_P-C Product feature CHAIN KC814884_HBx_P-C of FT:mat_peptide KC814884_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209433C). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLSLTPEVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814887_HBx_P-C Product feature CHAIN KC814887_HBx_P-C of FT:mat_peptide KC814887_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020941P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814888_HBx_P-C Product feature CHAIN KC814888_HBx_P-C of FT:mat_peptide KC814888_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020942P). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
IGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLFCSPSPCNFFTSP
>gnl|hbvpro|KC814889_HBx_P-C Product feature CHAIN KC814889_HBx_P-C of FT:mat_peptide KC814889_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020943P). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KC814891_HBx_P-C Product feature CHAIN KC814891_HBx_P-C of FT:mat_peptide KC814891_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020945P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814892_HBx_P-C Product feature CHAIN KC814892_HBx_P-C of FT:mat_peptide KC814892_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020946P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPSPCNFFTSA
>gnl|hbvpro|KC814893_HBx_P-C Product feature CHAIN KC814893_HBx_P-C of FT:mat_peptide KC814893_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020947P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814894_HBx_P-C Product feature CHAIN KC814894_HBx_P-C of FT:mat_peptide KC814894_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M020948P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814896_HBx_P-C Product feature CHAIN KC814896_HBx_P-C of FT:mat_peptide KC814896_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209410P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
WAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSM
>gnl|hbvpro|KC814897_HBx_P-C Product feature CHAIN KC814897_HBx_P-C of FT:mat_peptide KC814897_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209411P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
LAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814898_HBx_P-C Product feature CHAIN KC814898_HBx_P-C of FT:mat_peptide KC814898_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209412P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
KAARVCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814899_HBx_P-C Product feature CHAIN KC814899_HBx_P-C of FT:mat_peptide KC814899_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209413P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPTPCNFFTTA
>gnl|hbvpro|KC814900_HBx_P-C Product feature CHAIN KC814900_HBx_P-C of FT:mat_peptide KC814900_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209414P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDDARDVVCLRAVGAESRGRPVSGPFGTLPSPSSSAVPADQGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|KC814901_HBx_P-C Product feature CHAIN KC814901_HBx_P-C of FT:mat_peptide KC814901_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209415P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGFPVCAFSSAGPCAIRFTSARCKE
TTVNAHQVLPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVIGGSRHKLVSTPSPCNFFTSP
>gnl|hbvpro|KC814902_HBx_P-C Product feature CHAIN KC814902_HBx_P-C of FT:mat_peptide KC814902_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209416P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVYSPSPCNFFTSP
>gnl|hbvpro|KC814903_HBx_P-C Product feature CHAIN KC814903_HBx_P-C of FT:mat_peptide KC814903_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209417P). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLNYAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTTA
>gnl|hbvpro|KC814904_HBx_P-C Product feature CHAIN KC814904_HBx_P-C of FT:mat_peptide KC814904_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209418P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
KAARVCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLFCSPAPCNFFTSA
>gnl|hbvpro|KC814905_HBx_P-C Product feature CHAIN KC814905_HBx_P-C of FT:mat_peptide KC814905_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209419P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDDAREVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814906_HBx_P-C Product feature CHAIN KC814906_HBx_P-C of FT:mat_peptide KC814906_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209420P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
LAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSLAPCNFFTSA
>gnl|hbvpro|KC814907_HBx_P-C Product feature CHAIN KC814907_HBx_P-C of FT:mat_peptide KC814907_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209421P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814908_HBx_P-C Product feature CHAIN KC814908_HBx_P-C of FT:mat_peptide KC814908_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209422P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
WAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVSSPAPCNFFTSA
>gnl|hbvpro|KC814909_HBx_P-C Product feature CHAIN KC814909_HBx_P-C of FT:mat_peptide KC814909_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209423P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSM
>gnl|hbvpro|KC814910_HBx_P-C Product feature CHAIN KC814910_HBx_P-C of FT:mat_peptide KC814910_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209424P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTFC
>gnl|hbvpro|KC814911_HBx_P-C Product feature CHAIN KC814911_HBx_P-C of FT:mat_peptide KC814911_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209425P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPSNFFTSP
>gnl|hbvpro|KC814912_HBx_P-C Product feature CHAIN KC814912_HBx_P-C of FT:mat_peptide KC814912_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209426P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARECLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814913_HBx_P-C Product feature CHAIN KC814913_HBx_P-C of FT:mat_peptide KC814913_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209427P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAVRVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAFGNFFTSA
>gnl|hbvpro|KC814914_HBx_P-C Product feature CHAIN KC814914_HBx_P-C of FT:mat_peptide KC814914_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209428P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPPPCNFFTSA
>gnl|hbvpro|KC814915_HBx_P-C Product feature CHAIN KC814915_HBx_P-C of FT:mat_peptide KC814915_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209429P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPTHGNFFTSA
>gnl|hbvpro|KC814916_HBx_P-C Product feature CHAIN KC814916_HBx_P-C of FT:mat_peptide KC814916_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209430P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLGPAEYVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814919_HBx_P-C Product feature CHAIN KC814919_HBx_P-C of FT:mat_peptide KC814919_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209433P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGVESCGRPISGPFGTLPSPFSSAVPPDHGAHLSLRGLPVCAFSFAGPCAFCFTSARRME
TTVNAHQVLPKVLHKRTMGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVSRHAPCNFFTSA
>gnl|hbvpro|KC814920_HBx_P-C Product feature CHAIN KC814920_HBx_P-C of FT:mat_peptide KC814920_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209434P). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCTHKLVCSPSPCNFFTSA
>gnl|hbvpro|KC814922_HBx_P-C Product feature CHAIN KC814922_HBx_P-C of FT:mat_peptide KC814922_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209436P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGPLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLFCSPPPCNFFTSP
>gnl|hbvpro|KC814923_HBx_P-C Product feature CHAIN KC814923_HBx_P-C of FT:mat_peptide KC814923_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209437P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814924_HBx_P-C Product feature CHAIN KC814924_HBx_P-C of FT:mat_peptide KC814924_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209438P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814925_HBx_P-C Product feature CHAIN KC814925_HBx_P-C of FT:mat_peptide KC814925_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209439P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC814926_HBx_P-C Product feature CHAIN KC814926_HBx_P-C of FT:mat_peptide KC814926_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209440P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPTPCNFFTTA
>gnl|hbvpro|KC814927_HBx_P-C Product feature CHAIN KC814927_HBx_P-C of FT:mat_peptide KC814927_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209441P). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARVCCQLNYAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNFFTTA
>gnl|hbvpro|KC814928_HBx_P-C Product feature CHAIN KC814928_HBx_P-C of FT:mat_peptide KC814928_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0209442P). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875261_HBx_P-C Product feature CHAIN KC875261_HBx_P-C of FT:mat_peptide KC875261_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV26). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLAKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875262_HBx_P-C Product feature CHAIN KC875262_HBx_P-C of FT:mat_peptide KC875262_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPAGDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLDAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875263_HBx_P-C Product feature CHAIN KC875263_HBx_P-C of FT:mat_peptide KC875263_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCAIRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875264_HBx_P-C Product feature CHAIN KC875264_HBx_P-C of FT:mat_peptide KC875264_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875265_HBx_P-C Product feature CHAIN KC875265_HBx_P-C of FT:mat_peptide KC875265_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875267_HBx_P-C Product feature CHAIN KC875267_HBx_P-C of FT:mat_peptide KC875267_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875268_HBx_P-C Product feature CHAIN KC875268_HBx_P-C of FT:mat_peptide KC875268_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV68). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875269_HBx_P-C Product feature CHAIN KC875269_HBx_P-C of FT:mat_peptide KC875269_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLAAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875270_HBx_P-C Product feature CHAIN KC875270_HBx_P-C of FT:mat_peptide KC875270_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV63). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875271_HBx_P-C Product feature CHAIN KC875271_HBx_P-C of FT:mat_peptide KC875271_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875272_HBx_P-C Product feature CHAIN KC875272_HBx_P-C of FT:mat_peptide KC875272_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDVEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875273_HBx_P-C Product feature CHAIN KC875273_HBx_P-C of FT:mat_peptide KC875273_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV77). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC875274_HBx_P-C Product feature CHAIN KC875274_HBx_P-C of FT:mat_peptide KC875274_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV78). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214651_HBx_P-C Product feature CHAIN KF214651_HBx_P-C of FT:mat_peptide KF214651_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214652_HBx_P-C Product feature CHAIN KF214652_HBx_P-C of FT:mat_peptide KF214652_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214655_HBx_P-C Product feature CHAIN KF214655_HBx_P-C of FT:mat_peptide KF214655_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVYCQLDPPRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214667_HBx_P-C Product feature CHAIN KF214667_HBx_P-C of FT:mat_peptide KF214667_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-19). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214668_HBx_P-C Product feature CHAIN KF214668_HBx_P-C of FT:mat_peptide KF214668_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2011-22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLQGPLGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214669_HBx_P-C Product feature CHAIN KF214669_HBx_P-C of FT:mat_peptide KF214669_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-16). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214670_HBx_P-C Product feature CHAIN KF214670_HBx_P-C of FT:mat_peptide KF214670_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2010-20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGDENRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214671_HBx_P-C Product feature CHAIN KF214671_HBx_P-C of FT:mat_peptide KF214671_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2007-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214672_HBx_P-C Product feature CHAIN KF214672_HBx_P-C of FT:mat_peptide KF214672_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-18). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KF214673_HBx_P-C Product feature CHAIN KF214673_HBx_P-C of FT:mat_peptide KF214673_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPSSCNFFTSA
>gnl|hbvpro|KF214675_HBx_P-C Product feature CHAIN KF214675_HBx_P-C of FT:mat_peptide KF214675_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214676_HBx_P-C Product feature CHAIN KF214676_HBx_P-C of FT:mat_peptide KF214676_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF214677_HBx_P-C Product feature CHAIN KF214677_HBx_P-C of FT:mat_peptide KF214677_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-15). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFPSA
>gnl|hbvpro|KF485389_HBx_P-C Product feature CHAIN KF485389_HBx_P-C of FT:mat_peptide KF485389_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF485390_HBx_P-C Product feature CHAIN KF485390_HBx_P-C of FT:mat_peptide KF485390_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSPGPCALRFTSARRME
TTVNAHQALPKVLHKRTLGLSSMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF495606_HBx_P-C Product feature CHAIN KF495606_HBx_P-C of FT:mat_peptide KF495606_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NT-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873514_HBx_P-C Product feature CHAIN KF873514_HBx_P-C of FT:mat_peptide KF873514_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 053_EA_Gap). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAEPRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873516_HBx_P-C Product feature CHAIN KF873516_HBx_P-C of FT:mat_peptide KF873516_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 020_EA_Ram). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873520_HBx_P-C Product feature CHAIN KF873520_HBx_P-C of FT:mat_peptide KF873520_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 025_EA_Yir). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRITSARRME
TTVNTHMILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873525_HBx_P-C Product feature CHAIN KF873525_HBx_P-C of FT:mat_peptide KF873525_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 034_K_Kat). Partial genome (Contains: HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGXXPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRXKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873526_HBx_P-C Product feature CHAIN KF873526_HBx_P-C of FT:mat_peptide KF873526_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 040_K_Laj). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873528_HBx_P-C Product feature CHAIN KF873528_HBx_P-C of FT:mat_peptide KF873528_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 026_K_Laj). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHLILPKVLHKRTLGLXAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873529_HBx_P-C Product feature CHAIN KF873529_HBx_P-C of FT:mat_peptide KF873529_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 060_K_Laj). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAAXLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHLILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873536_HBx_P-C Product feature CHAIN KF873536_HBx_P-C of FT:mat_peptide KF873536_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 062_WA_Man). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSSGPCALRFTSARRME
TTVNAHMILPKVLHKRTLGLXAMSTTDLEAYFKDCLFKDWEELGEEXRLXIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873539_HBx_P-C Product feature CHAIN KF873539_HBx_P-C of FT:mat_peptide KF873539_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 033_TI_Ngu). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRMA
TTVNAHMILPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873541_HBx_P-C Product feature CHAIN KF873541_HBx_P-C of FT:mat_peptide KF873541_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 042_DR_Wad). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGXLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSACRMA
TTVNAHMILPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KF873544_HBx_P-C Product feature CHAIN KF873544_HBx_P-C of FT:mat_peptide KF873544_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 009_DR_Wad). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHMXLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGZEIRLXXYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173281_HBx_P-C Product feature CHAIN KJ173281_HBx_P-C of FT:mat_peptide KJ173281_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX009C(e216)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173282_HBx_P-C Product feature CHAIN KJ173282_HBx_P-C of FT:mat_peptide KJ173282_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX009M(e217)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173283_HBx_P-C Product feature CHAIN KJ173283_HBx_P-C of FT:mat_peptide KJ173283_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX022C(e230)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|KJ173284_HBx_P-C Product feature CHAIN KJ173284_HBx_P-C of FT:mat_peptide KJ173284_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX022M(e231)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|KJ173285_HBx_P-C Product feature CHAIN KJ173285_HBx_P-C of FT:mat_peptide KJ173285_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX026C(e241)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173286_HBx_P-C Product feature CHAIN KJ173286_HBx_P-C of FT:mat_peptide KJ173286_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX026M(e242)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173287_HBx_P-C Product feature CHAIN KJ173287_HBx_P-C of FT:mat_peptide KJ173287_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX028C(e244)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173288_HBx_P-C Product feature CHAIN KJ173288_HBx_P-C of FT:mat_peptide KJ173288_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX028M(e245n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173289_HBx_P-C Product feature CHAIN KJ173289_HBx_P-C of FT:mat_peptide KJ173289_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX038C(e252)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173290_HBx_P-C Product feature CHAIN KJ173290_HBx_P-C of FT:mat_peptide KJ173290_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX038M(e253n)). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGANLSLRGLPICAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173291_HBx_P-C Product feature CHAIN KJ173291_HBx_P-C of FT:mat_peptide KJ173291_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX050C(e275n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173292_HBx_P-C Product feature CHAIN KJ173292_HBx_P-C of FT:mat_peptide KJ173292_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX050M(e276n)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173293_HBx_P-C Product feature CHAIN KJ173293_HBx_P-C of FT:mat_peptide KJ173293_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX063C(e307)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173294_HBx_P-C Product feature CHAIN KJ173294_HBx_P-C of FT:mat_peptide KJ173294_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX063M(e308)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173295_HBx_P-C Product feature CHAIN KJ173295_HBx_P-C of FT:mat_peptide KJ173295_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH001C(e44)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAXSTTDLEAYFKDCVFTDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173296_HBx_P-C Product feature CHAIN KJ173296_HBx_P-C of FT:mat_peptide KJ173296_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH001M(e45)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173301_HBx_P-C Product feature CHAIN KJ173301_HBx_P-C of FT:mat_peptide KJ173301_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB129C(m130)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173302_HBx_P-C Product feature CHAIN KJ173302_HBx_P-C of FT:mat_peptide KJ173302_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB129M(m129)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173303_HBx_P-C Product feature CHAIN KJ173303_HBx_P-C of FT:mat_peptide KJ173303_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB215C(m216)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAPQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173304_HBx_P-C Product feature CHAIN KJ173304_HBx_P-C of FT:mat_peptide KJ173304_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB215M(m215)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173305_HBx_P-C Product feature CHAIN KJ173305_HBx_P-C of FT:mat_peptide KJ173305_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB023C(m24)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173306_HBx_P-C Product feature CHAIN KJ173306_HBx_P-C of FT:mat_peptide KJ173306_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB023M(M23)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173307_HBx_P-C Product feature CHAIN KJ173307_HBx_P-C of FT:mat_peptide KJ173307_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB255C(m256)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ173308_HBx_P-C Product feature CHAIN KJ173308_HBx_P-C of FT:mat_peptide KJ173308_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB255M(m255)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ173309_HBx_P-C Product feature CHAIN KJ173309_HBx_P-C of FT:mat_peptide KJ173309_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB045C(m46)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173310_HBx_P-C Product feature CHAIN KJ173310_HBx_P-C of FT:mat_peptide KJ173310_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NB045M(m45)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173311_HBx_P-C Product feature CHAIN KJ173311_HBx_P-C of FT:mat_peptide KJ173311_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH005C(e49)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173312_HBx_P-C Product feature CHAIN KJ173312_HBx_P-C of FT:mat_peptide KJ173312_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH005M(e50)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173313_HBx_P-C Product feature CHAIN KJ173313_HBx_P-C of FT:mat_peptide KJ173313_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH006C(e34)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173314_HBx_P-C Product feature CHAIN KJ173314_HBx_P-C of FT:mat_peptide KJ173314_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH006M(e35)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173315_HBx_P-C Product feature CHAIN KJ173315_HBx_P-C of FT:mat_peptide KJ173315_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH017C(e36)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173317_HBx_P-C Product feature CHAIN KJ173317_HBx_P-C of FT:mat_peptide KJ173317_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH25C(e38)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173318_HBx_P-C Product feature CHAIN KJ173318_HBx_P-C of FT:mat_peptide KJ173318_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH25M1(e39)). Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSALSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173319_HBx_P-C Product feature CHAIN KJ173319_HBx_P-C of FT:mat_peptide KJ173319_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NH29C(e40)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173323_HBx_P-C Product feature CHAIN KJ173323_HBx_P-C of FT:mat_peptide KJ173323_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P001-C2(001b)). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173324_HBx_P-C Product feature CHAIN KJ173324_HBx_P-C of FT:mat_peptide KJ173324_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P001-M(003)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173327_HBx_P-C Product feature CHAIN KJ173327_HBx_P-C of FT:mat_peptide KJ173327_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P005_C(017)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TAVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173328_HBx_P-C Product feature CHAIN KJ173328_HBx_P-C of FT:mat_peptide KJ173328_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P005-M(327)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TAVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173331_HBx_P-C Product feature CHAIN KJ173331_HBx_P-C of FT:mat_peptide KJ173331_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY002C(e101)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173332_HBx_P-C Product feature CHAIN KJ173332_HBx_P-C of FT:mat_peptide KJ173332_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY002M(e102)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173333_HBx_P-C Product feature CHAIN KJ173333_HBx_P-C of FT:mat_peptide KJ173333_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY003C(e104)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173334_HBx_P-C Product feature CHAIN KJ173334_HBx_P-C of FT:mat_peptide KJ173334_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY003M(e105)). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFNDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173335_HBx_P-C Product feature CHAIN KJ173335_HBx_P-C of FT:mat_peptide KJ173335_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY010C(e112)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ173336_HBx_P-C Product feature CHAIN KJ173336_HBx_P-C of FT:mat_peptide KJ173336_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY010M(e113)). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNANQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ173337_HBx_P-C Product feature CHAIN KJ173337_HBx_P-C of FT:mat_peptide KJ173337_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY028C(e133)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173338_HBx_P-C Product feature CHAIN KJ173338_HBx_P-C of FT:mat_peptide KJ173338_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YY028M2(e134-B)). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173391_HBx_P-C Product feature CHAIN KJ173391_HBx_P-C of FT:mat_peptide KJ173391_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac01-M(m601)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173392_HBx_P-C Product feature CHAIN KJ173392_HBx_P-C of FT:mat_peptide KJ173392_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac01-C(m602)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173393_HBx_P-C Product feature CHAIN KJ173393_HBx_P-C of FT:mat_peptide KJ173393_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac04-M(m611)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173394_HBx_P-C Product feature CHAIN KJ173394_HBx_P-C of FT:mat_peptide KJ173394_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac04-C(m612)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173395_HBx_P-C Product feature CHAIN KJ173395_HBx_P-C of FT:mat_peptide KJ173395_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac06-M(m619)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173396_HBx_P-C Product feature CHAIN KJ173396_HBx_P-C of FT:mat_peptide KJ173396_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Vac06-C(m620)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173426_HBx_P-C Product feature CHAIN KJ173426_HBx_P-C of FT:mat_peptide KJ173426_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_CLP(3)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173427_HBx_P-C Product feature CHAIN KJ173427_HBx_P-C of FT:mat_peptide KJ173427_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N01-M(011A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173428_HBx_P-C Product feature CHAIN KJ173428_HBx_P-C of FT:mat_peptide KJ173428_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N01-C(011B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173429_HBx_P-C Product feature CHAIN KJ173429_HBx_P-C of FT:mat_peptide KJ173429_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N02-M(085A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173430_HBx_P-C Product feature CHAIN KJ173430_HBx_P-C of FT:mat_peptide KJ173430_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N02-C(085B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173431_HBx_P-C Product feature CHAIN KJ173431_HBx_P-C of FT:mat_peptide KJ173431_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N04-M(158A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173432_HBx_P-C Product feature CHAIN KJ173432_HBx_P-C of FT:mat_peptide KJ173432_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N04-C(158B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPIGTESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173433_HBx_P-C Product feature CHAIN KJ173433_HBx_P-C of FT:mat_peptide KJ173433_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N05-M(159A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173434_HBx_P-C Product feature CHAIN KJ173434_HBx_P-C of FT:mat_peptide KJ173434_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N05-C(159B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173435_HBx_P-C Product feature CHAIN KJ173435_HBx_P-C of FT:mat_peptide KJ173435_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N06-M(166A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173436_HBx_P-C Product feature CHAIN KJ173436_HBx_P-C of FT:mat_peptide KJ173436_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N06-C(166B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173437_HBx_P-C Product feature CHAIN KJ173437_HBx_P-C of FT:mat_peptide KJ173437_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N08-M(6615A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173438_HBx_P-C Product feature CHAIN KJ173438_HBx_P-C of FT:mat_peptide KJ173438_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N08-C(3547B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173439_HBx_P-C Product feature CHAIN KJ173439_HBx_P-C of FT:mat_peptide KJ173439_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N12-M(6600A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173440_HBx_P-C Product feature CHAIN KJ173440_HBx_P-C of FT:mat_peptide KJ173440_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N12-C(4131B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSSSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173441_HBx_P-C Product feature CHAIN KJ173441_HBx_P-C of FT:mat_peptide KJ173441_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N17-M(199A)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173442_HBx_P-C Product feature CHAIN KJ173442_HBx_P-C of FT:mat_peptide KJ173442_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N17-C(199B)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173443_HBx_P-C Product feature CHAIN KJ173443_HBx_P-C of FT:mat_peptide KJ173443_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N207M(e413)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173444_HBx_P-C Product feature CHAIN KJ173444_HBx_P-C of FT:mat_peptide KJ173444_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N207C(e414)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173445_HBx_P-C Product feature CHAIN KJ173445_HBx_P-C of FT:mat_peptide KJ173445_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N208M(e415)). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ173446_HBx_P-C Product feature CHAIN KJ173446_HBx_P-C of FT:mat_peptide KJ173446_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate N208C(e416)). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410489_HBx_P-C Product feature CHAIN KJ410489_HBx_P-C of FT:mat_peptide KJ410489_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1202). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410491_HBx_P-C Product feature CHAIN KJ410491_HBx_P-C of FT:mat_peptide KJ410491_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1323). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKMVCSPAPCNFFTSA
>gnl|hbvpro|KJ410492_HBx_P-C Product feature CHAIN KJ410492_HBx_P-C of FT:mat_peptide KJ410492_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1313). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKMVCSPAPCNFFTSA
>gnl|hbvpro|KJ410493_HBx_P-C Product feature CHAIN KJ410493_HBx_P-C of FT:mat_peptide KJ410493_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1204). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410494_HBx_P-C Product feature CHAIN KJ410494_HBx_P-C of FT:mat_peptide KJ410494_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1100). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKMVCSPAPCNFFTSA
>gnl|hbvpro|KJ410495_HBx_P-C Product feature CHAIN KJ410495_HBx_P-C of FT:mat_peptide KJ410495_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1324). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKMVCSPAPCNFFTSA
>gnl|hbvpro|KJ410496_HBx_P-C Product feature CHAIN KJ410496_HBx_P-C of FT:mat_peptide KJ410496_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1095). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGSLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEELRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410498_HBx_P-C Product feature CHAIN KJ410498_HBx_P-C of FT:mat_peptide KJ410498_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK0015). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410499_HBx_P-C Product feature CHAIN KJ410499_HBx_P-C of FT:mat_peptide KJ410499_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK_1328). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNACQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCKHKMVCSPAPCNFFTSA
>gnl|hbvpro|KJ410501_HBx_P-C Product feature CHAIN KJ410501_HBx_P-C of FT:mat_peptide KJ410501_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK532). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410504_HBx_P-C Product feature CHAIN KJ410504_HBx_P-C of FT:mat_peptide KJ410504_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK315). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410505_HBx_P-C Product feature CHAIN KJ410505_HBx_P-C of FT:mat_peptide KJ410505_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HBV320). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPAGHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410508_HBx_P-C Product feature CHAIN KJ410508_HBx_P-C of FT:mat_peptide KJ410508_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK346). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSASAVPAVNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410510_HBx_P-C Product feature CHAIN KJ410510_HBx_P-C of FT:mat_peptide KJ410510_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK323). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410511_HBx_P-C Product feature CHAIN KJ410511_HBx_P-C of FT:mat_peptide KJ410511_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410513_HBx_P-C Product feature CHAIN KJ410513_HBx_P-C of FT:mat_peptide KJ410513_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK523). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNVRQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410514_HBx_P-C Product feature CHAIN KJ410514_HBx_P-C of FT:mat_peptide KJ410514_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGANLSLRGLPVCAFSSAGPCALRFTSARRVE
TTVNARQVLPKVLYKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEFRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410515_HBx_P-C Product feature CHAIN KJ410515_HBx_P-C of FT:mat_peptide KJ410515_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK319). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSTVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410518_HBx_P-C Product feature CHAIN KJ410518_HBx_P-C of FT:mat_peptide KJ410518_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK313). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQPVLPKVLHKRTIGLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410519_HBx_P-C Product feature CHAIN KJ410519_HBx_P-C of FT:mat_peptide KJ410519_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK514). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ410521_HBx_P-C Product feature CHAIN KJ410521_HBx_P-C of FT:mat_peptide KJ410521_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Occult_HK9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLAAMSTTDLEAYFKDCLFKDWEELGEETRLKIYVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KJ598635_HBx_P-C Product feature CHAIN KJ598635_HBx_P-C of FT:mat_peptide KJ598635_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSQAPCNFFTSA
>gnl|hbvpro|KJ598636_HBx_P-C Product feature CHAIN KJ598636_HBx_P-C of FT:mat_peptide KJ598636_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598637_HBx_P-C Product feature CHAIN KJ598637_HBx_P-C of FT:mat_peptide KJ598637_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKFVRSPAPCNFFTSA
>gnl|hbvpro|KJ598638_HBx_P-C Product feature CHAIN KJ598638_HBx_P-C of FT:mat_peptide KJ598638_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598639_HBx_P-C Product feature CHAIN KJ598639_HBx_P-C of FT:mat_peptide KJ598639_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598640_HBx_P-C Product feature CHAIN KJ598640_HBx_P-C of FT:mat_peptide KJ598640_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1C10). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598641_HBx_P-C Product feature CHAIN KJ598641_HBx_P-C of FT:mat_peptide KJ598641_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598642_HBx_P-C Product feature CHAIN KJ598642_HBx_P-C of FT:mat_peptide KJ598642_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB1A4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNGAHLSLRGLPVCTFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598644_HBx_P-C Product feature CHAIN KJ598644_HBx_P-C of FT:mat_peptide KJ598644_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598645_HBx_P-C Product feature CHAIN KJ598645_HBx_P-C of FT:mat_peptide KJ598645_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB210). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPGNFFTSA
>gnl|hbvpro|KJ598646_HBx_P-C Product feature CHAIN KJ598646_HBx_P-C of FT:mat_peptide KJ598646_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSQAPCNFFTSA
>gnl|hbvpro|KJ598647_HBx_P-C Product feature CHAIN KJ598647_HBx_P-C of FT:mat_peptide KJ598647_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598648_HBx_P-C Product feature CHAIN KJ598648_HBx_P-C of FT:mat_peptide KJ598648_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598649_HBx_P-C Product feature CHAIN KJ598649_HBx_P-C of FT:mat_peptide KJ598649_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2SA8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598650_HBx_P-C Product feature CHAIN KJ598650_HBx_P-C of FT:mat_peptide KJ598650_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2SA15). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598651_HBx_P-C Product feature CHAIN KJ598651_HBx_P-C of FT:mat_peptide KJ598651_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2SB4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598652_HBx_P-C Product feature CHAIN KJ598652_HBx_P-C of FT:mat_peptide KJ598652_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598653_HBx_P-C Product feature CHAIN KJ598653_HBx_P-C of FT:mat_peptide KJ598653_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB28). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598654_HBx_P-C Product feature CHAIN KJ598654_HBx_P-C of FT:mat_peptide KJ598654_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB211). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598655_HBx_P-C Product feature CHAIN KJ598655_HBx_P-C of FT:mat_peptide KJ598655_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB212). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSASRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598656_HBx_P-C Product feature CHAIN KJ598656_HBx_P-C of FT:mat_peptide KJ598656_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB214). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598657_HBx_P-C Product feature CHAIN KJ598657_HBx_P-C of FT:mat_peptide KJ598657_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB215). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASAAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598658_HBx_P-C Product feature CHAIN KJ598658_HBx_P-C of FT:mat_peptide KJ598658_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2A8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598659_HBx_P-C Product feature CHAIN KJ598659_HBx_P-C of FT:mat_peptide KJ598659_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSQAPCNFFTSA
>gnl|hbvpro|KJ598660_HBx_P-C Product feature CHAIN KJ598660_HBx_P-C of FT:mat_peptide KJ598660_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB213). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>gnl|hbvpro|KJ598661_HBx_P-C Product feature CHAIN KJ598661_HBx_P-C of FT:mat_peptide KJ598661_HBx_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SHB2S4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNFFTSA
>