HBVdb

Dataset for protein LHBs of genotype C

[Download (right click)] [Alignment] [Repertoires]

2639 sequence(s)

>gnl|hbvpro|AB014360_LHBs_P-C Product feature CHAIN AB014360_LHBs_P-C of FT:mat_peptide AB014360_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D01HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTCNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLSNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB014362_LHBs_P-C Product feature CHAIN AB014362_LHBs_P-C of FT:mat_peptide AB014362_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 03D03HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGPSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB014363_LHBs_P-C Product feature CHAIN AB014363_LHBs_P-C of FT:mat_peptide AB014363_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04D04HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASH
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLBSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSIFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|AB014365_LHBs_P-C Product feature CHAIN AB014365_LHBs_P-C of FT:mat_peptide AB014365_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D06HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPSAPPPASTNRQSGRQHTPXSPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB014367_LHBs_P-C Product feature CHAIN AB014367_LHBs_P-C of FT:mat_peptide AB014367_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08D08HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGTCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014369_LHBs_P-C Product feature CHAIN AB014369_LHBs_P-C of FT:mat_peptide AB014369_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10D10HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTAVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGEAPXCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLXDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014371_LHBs_P-C Product feature CHAIN AB014371_LHBs_P-C of FT:mat_peptide AB014371_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 12D12HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014374_LHBs_P-C Product feature CHAIN AB014374_LHBs_P-C of FT:mat_peptide AB014374_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 15D15HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014376_LHBs_P-C Product feature CHAIN AB014376_LHBs_P-C of FT:mat_peptide AB014376_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17T02HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSFKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014377_LHBs_P-C Product feature CHAIN AB014377_LHBs_P-C of FT:mat_peptide AB014377_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18T03HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014378_LHBs_P-C Product feature CHAIN AB014378_LHBs_P-C of FT:mat_peptide AB014378_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19Y01HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGRSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPKVRGLYLPAGGSSSGTENPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSRYNIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014379_LHBs_P-C Product feature CHAIN AB014379_LHBs_P-C of FT:mat_peptide AB014379_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 20Y02HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTXTTSTGPCKTCTSPAQNTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014380_LHBs_P-C Product feature CHAIN AB014380_LHBs_P-C of FT:mat_peptide AB014380_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 21Y03HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLNPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRIRTIPQSLDSWWTSLNFLGGVPKCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGNSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB014381_LHBs_P-C Product feature CHAIN AB014381_LHBs_P-C of FT:mat_peptide AB014381_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 22Y04HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLHPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014382_LHBs_P-C Product feature CHAIN AB014382_LHBs_P-C of FT:mat_peptide AB014382_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23Y05HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAYGPGVTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ILSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPARNTSIFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014383_LHBs_P-C Product feature CHAIN AB014383_LHBs_P-C of FT:mat_peptide AB014383_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24Y06HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAQNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014384_LHBs_P-C Product feature CHAIN AB014384_LHBs_P-C of FT:mat_peptide AB014384_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 25Y07HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014385_LHBs_P-C Product feature CHAIN AB014385_LHBs_P-C of FT:mat_peptide AB014385_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26Y08HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPGLNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQNTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014389_LHBs_P-C Product feature CHAIN AB014389_LHBs_P-C of FT:mat_peptide AB014389_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30Y12HCC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCX
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014391_LHBs_P-C Product feature CHAIN AB014391_LHBs_P-C of FT:mat_peptide AB014391_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 32Y14HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGRNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQNNSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSXLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB014392_LHBs_P-C Product feature CHAIN AB014392_LHBs_P-C of FT:mat_peptide AB014392_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 33Y15HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRRGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQNTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB014393_LHBs_P-C Product feature CHAIN AB014393_LHBs_P-C of FT:mat_peptide AB014393_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 34Y16HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDHWPEAXQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDLAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLILLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014394_LHBs_P-C Product feature CHAIN AB014394_LHBs_P-C of FT:mat_peptide AB014394_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35Y17HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDFQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014396_LHBs_P-C Product feature CHAIN AB014396_LHBs_P-C of FT:mat_peptide AB014396_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37Y19HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQSTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014399_LHBs_P-C Product feature CHAIN AB014399_LHBs_P-C of FT:mat_peptide AB014399_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 40Y22HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB026811_LHBs_P-C Product feature CHAIN AB026811_LHBs_P-C of FT:mat_peptide AB026811_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Feb.). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPRGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026812_LHBs_P-C Product feature CHAIN AB026812_LHBs_P-C of FT:mat_peptide AB026812_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;98.May). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPRGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026813_LHBs_P-C Product feature CHAIN AB026813_LHBs_P-C of FT:mat_peptide AB026813_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Sep.). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEADQVGAGAFGPGFTPPRGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026814_LHBs_P-C Product feature CHAIN AB026814_LHBs_P-C of FT:mat_peptide AB026814_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Donor 3;98.May). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPRGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026815_LHBs_P-C Product feature CHAIN AB026815_LHBs_P-C of FT:mat_peptide AB026815_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 2:full). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB031262_LHBs_P-C Product feature CHAIN AB031262_LHBs_P-C of FT:mat_peptide AB031262_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV VietA-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPALGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB033550_LHBs_P-C Product feature CHAIN AB033550_LHBs_P-C of FT:mat_peptide AB033550_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NDR260). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAQNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB033551_LHBs_P-C Product feature CHAIN AB033551_LHBs_P-C of FT:mat_peptide AB033551_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK300). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKNRTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB033552_LHBs_P-C Product feature CHAIN AB033552_LHBs_P-C of FT:mat_peptide AB033552_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK494). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB033553_LHBs_P-C Product feature CHAIN AB033553_LHBs_P-C of FT:mat_peptide AB033553_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK619). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB033556_LHBs_P-C Product feature CHAIN AB033556_LHBs_P-C of FT:mat_peptide AB033556_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AK66). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB042282_LHBs_P-C Product feature CHAIN AB042282_LHBs_P-C of FT:mat_peptide AB042282_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB042283_LHBs_P-C Product feature CHAIN AB042283_LHBs_P-C of FT:mat_peptide AB042283_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB042284_LHBs_P-C Product feature CHAIN AB042284_LHBs_P-C of FT:mat_peptide AB042284_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGQSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB049610_LHBs_P-C Product feature CHAIN AB049610_LHBs_P-C of FT:mat_peptide AB049610_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV AN29). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPASNMESTTSGFLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLSFLGGAPTCRGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB050018_LHBs_P-C Product feature CHAIN AB050018_LHBs_P-C of FT:mat_peptide AB050018_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB074047_LHBs_P-C Product feature CHAIN AB074047_LHBs_P-C of FT:mat_peptide AB074047_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th11). Complete genome. [Hepadnaviridae] (length=399 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWGPQ
AQGILTTVPAAPPPASTNRQSGRRPTPISPPLRDSHPQAMWNSSTFRQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPI
SSIFSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLREIPACPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPARNISMFPSCCCTKPSDGNC
TCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYTIVKPFLPLLPIFFYLWAYI
>gnl|hbvpro|AB074755_LHBs_P-C Product feature CHAIN AB074755_LHBs_P-C of FT:mat_peptide AB074755_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th44). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGNLLGWSPQ
AQGILSTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB074756_LHBs_P-C Product feature CHAIN AB074756_LHBs_P-C of FT:mat_peptide AB074756_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th55). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB105173_LHBs_P-C Product feature CHAIN AB105173_LHBs_P-C of FT:mat_peptide AB105173_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB105174_LHBs_P-C Product feature CHAIN AB105174_LHBs_P-C of FT:mat_peptide AB105174_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 60). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGRSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPISNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB106895_LHBs_P-C Product feature CHAIN AB106895_LHBs_P-C of FT:mat_peptide AB106895_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pHB4-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWTGALQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQRNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111114_LHBs_P-C Product feature CHAIN AB111114_LHBs_P-C of FT:mat_peptide AB111114_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASSNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
QICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB111119_LHBs_P-C Product feature CHAIN AB111119_LHBs_P-C of FT:mat_peptide AB111119_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111120_LHBs_P-C Product feature CHAIN AB111120_LHBs_P-C of FT:mat_peptide AB111120_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWKSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111121_LHBs_P-C Product feature CHAIN AB111121_LHBs_P-C of FT:mat_peptide AB111121_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGVWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPL
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111122_LHBs_P-C Product feature CHAIN AB111122_LHBs_P-C of FT:mat_peptide AB111122_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSHTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111123_LHBs_P-C Product feature CHAIN AB111123_LHBs_P-C of FT:mat_peptide AB111123_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111124_LHBs_P-C Product feature CHAIN AB111124_LHBs_P-C of FT:mat_peptide AB111124_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMILYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111125_LHBs_P-C Product feature CHAIN AB111125_LHBs_P-C of FT:mat_peptide AB111125_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMILYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111946_LHBs_P-C Product feature CHAIN AB111946_LHBs_P-C of FT:mat_peptide AB111946_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT103). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGVGSFGPGFTPPHGGLLGWSPL
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHSQAMQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVQTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112063_LHBs_P-C Product feature CHAIN AB112063_LHBs_P-C of FT:mat_peptide AB112063_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT101). Complete genome. [Hepadnaviridae] (length=400 residues).
MGPWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISLPLRDSHPQAMQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVQTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCSGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTQPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112065_LHBs_P-C Product feature CHAIN AB112065_LHBs_P-C of FT:mat_peptide AB112065_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT140). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPYHQLDPAFRANSNNPYWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTENPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMWPVCPLLPGTSTTITGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112066_LHBs_P-C Product feature CHAIN AB112066_LHBs_P-C of FT:mat_peptide AB112066_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY624). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSNPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTITGPCKTCTNPAQGTSMFPSCCCTKPSDGN
GTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112348_LHBs_P-C Product feature CHAIN AB112348_LHBs_P-C of FT:mat_peptide AB112348_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY656). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRAHSNSPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLEPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCSVQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPALGDSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112471_LHBs_P-C Product feature CHAIN AB112471_LHBs_P-C of FT:mat_peptide AB112471_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH123). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTWTNPAQGTSMFPSCWWTKPWDGK
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112472_LHBs_P-C Product feature CHAIN AB112472_LHBs_P-C of FT:mat_peptide AB112472_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH124). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB113875_LHBs_P-C Product feature CHAIN AB113875_LHBs_P-C of FT:mat_peptide AB113875_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWFSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPNTDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB113876_LHBs_P-C Product feature CHAIN AB113876_LHBs_P-C of FT:mat_peptide AB113876_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWFSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPNTDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB113878_LHBs_P-C Product feature CHAIN AB113878_LHBs_P-C of FT:mat_peptide AB113878_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEATQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB113879_LHBs_P-C Product feature CHAIN AB113879_LHBs_P-C of FT:mat_peptide AB113879_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPESNQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB115417_LHBs_P-C Product feature CHAIN AB115417_LHBs_P-C of FT:mat_peptide AB115417_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-O47). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGSFPEHQLDPATGANTNNPDWDFNPNKDQWPEANQEGGGAFGPGFTPPHGGLSGWSPQ
TQGILTTAPAAPPPATTNRQTRRQPTTISPPLIDSHPQAMQWNSTTFHQALLDPKLRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSHSFLGGTPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLVVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQSTSMFPSWWWTKPSDGN
CTCIPIPSSWAFARILWEWASVRFSWLSLLVPFVQWFVGLPPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB117758_LHBs_P-C Product feature CHAIN AB117758_LHBs_P-C of FT:mat_peptide AB117758_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CB10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPICPPVRDSHTQAMLWNSATFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB176642_LHBs_P-C Product feature CHAIN AB176642_LHBs_P-C of FT:mat_peptide AB176642_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-115). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFAPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQXAFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLLNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB182589_LHBs_P-C Product feature CHAIN AB182589_LHBs_P-C of FT:mat_peptide AB182589_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CH:Mat-Ko). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTLCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195930_LHBs_P-C Product feature CHAIN AB195930_LHBs_P-C of FT:mat_peptide AB195930_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEATQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFVWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195931_LHBs_P-C Product feature CHAIN AB195931_LHBs_P-C of FT:mat_peptide AB195931_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEATQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195932_LHBs_P-C Product feature CHAIN AB195932_LHBs_P-C of FT:mat_peptide AB195932_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEATQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASFRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195936_LHBs_P-C Product feature CHAIN AB195936_LHBs_P-C of FT:mat_peptide AB195936_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195937_LHBs_P-C Product feature CHAIN AB195937_LHBs_P-C of FT:mat_peptide AB195937_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195938_LHBs_P-C Product feature CHAIN AB195938_LHBs_P-C of FT:mat_peptide AB195938_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195942_LHBs_P-C Product feature CHAIN AB195942_LHBs_P-C of FT:mat_peptide AB195942_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRSLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PISPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195943_LHBs_P-C Product feature CHAIN AB195943_LHBs_P-C of FT:mat_peptide AB195943_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRSLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195944_LHBs_P-C Product feature CHAIN AB195944_LHBs_P-C of FT:mat_peptide AB195944_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRSLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195947_LHBs_P-C Product feature CHAIN AB195947_LHBs_P-C of FT:mat_peptide AB195947_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195949_LHBs_P-C Product feature CHAIN AB195949_LHBs_P-C of FT:mat_peptide AB195949_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAKQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195952_LHBs_P-C Product feature CHAIN AB195952_LHBs_P-C of FT:mat_peptide AB195952_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195953_LHBs_P-C Product feature CHAIN AB195953_LHBs_P-C of FT:mat_peptide AB195953_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195954_LHBs_P-C Product feature CHAIN AB195954_LHBs_P-C of FT:mat_peptide AB195954_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198076_LHBs_P-C Product feature CHAIN AB198076_LHBs_P-C of FT:mat_peptide AB198076_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198077_LHBs_P-C Product feature CHAIN AB198077_LHBs_P-C of FT:mat_peptide AB198077_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198078_LHBs_P-C Product feature CHAIN AB198078_LHBs_P-C of FT:mat_peptide AB198078_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198079_LHBs_P-C Product feature CHAIN AB198079_LHBs_P-C of FT:mat_peptide AB198079_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198080_LHBs_P-C Product feature CHAIN AB198080_LHBs_P-C of FT:mat_peptide AB198080_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198081_LHBs_P-C Product feature CHAIN AB198081_LHBs_P-C of FT:mat_peptide AB198081_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALVDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198082_LHBs_P-C Product feature CHAIN AB198082_LHBs_P-C of FT:mat_peptide AB198082_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASP
TSSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198083_LHBs_P-C Product feature CHAIN AB198083_LHBs_P-C of FT:mat_peptide AB198083_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB202071_LHBs_P-C Product feature CHAIN AB202071_LHBs_P-C of FT:mat_peptide AB202071_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205123_LHBs_P-C Product feature CHAIN AB205123_LHBs_P-C of FT:mat_peptide AB205123_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CN578-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQSILTTVPVTPPPASANRQSGRQPTPISPPLRDSHPQAMRWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTAPP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTPTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205124_LHBs_P-C Product feature CHAIN AB205124_LHBs_P-C of FT:mat_peptide AB205124_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TJ3-1-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNPSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205125_LHBs_P-C Product feature CHAIN AB205125_LHBs_P-C of FT:mat_peptide AB205125_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VH34-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222714_LHBs_P-C Product feature CHAIN AB222714_LHBs_P-C of FT:mat_peptide AB222714_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222715_LHBs_P-C Product feature CHAIN AB222715_LHBs_P-C of FT:mat_peptide AB222715_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7M). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDXDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB241110_LHBs_P-C Product feature CHAIN AB241110_LHBs_P-C of FT:mat_peptide AB241110_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC03). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB241111_LHBs_P-C Product feature CHAIN AB241111_LHBs_P-C of FT:mat_peptide AB241111_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB246344_LHBs_P-C Product feature CHAIN AB246344_LHBs_P-C of FT:mat_peptide AB246344_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMILYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246345_LHBs_P-C Product feature CHAIN AB246345_LHBs_P-C of FT:mat_peptide AB246345_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246346_LHBs_P-C Product feature CHAIN AB246346_LHBs_P-C of FT:mat_peptide AB246346_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLFPIFFCLWVYI
>gnl|hbvpro|AB247916_LHBs_P-C Product feature CHAIN AB247916_LHBs_P-C of FT:mat_peptide AB247916_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSLLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB288026_LHBs_P-C Product feature CHAIN AB288026_LHBs_P-C of FT:mat_peptide AB288026_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGXGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQSTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNWQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB298720_LHBs_P-C Product feature CHAIN AB298720_LHBs_P-C of FT:mat_peptide AB298720_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1S). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB298721_LHBs_P-C Product feature CHAIN AB298721_LHBs_P-C of FT:mat_peptide AB298721_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1C). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB299858_LHBs_P-C Product feature CHAIN AB299858_LHBs_P-C of FT:mat_peptide AB299858_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILSTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB300359_LHBs_P-C Product feature CHAIN AB300359_LHBs_P-C of FT:mat_peptide AB300359_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300360_LHBs_P-C Product feature CHAIN AB300360_LHBs_P-C of FT:mat_peptide AB300360_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPGLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300361_LHBs_P-C Product feature CHAIN AB300361_LHBs_P-C of FT:mat_peptide AB300361_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVHPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300362_LHBs_P-C Product feature CHAIN AB300362_LHBs_P-C of FT:mat_peptide AB300362_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300363_LHBs_P-C Product feature CHAIN AB300363_LHBs_P-C of FT:mat_peptide AB300363_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPKKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300365_LHBs_P-C Product feature CHAIN AB300365_LHBs_P-C of FT:mat_peptide AB300365_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPIAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300368_LHBs_P-C Product feature CHAIN AB300368_LHBs_P-C of FT:mat_peptide AB300368_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLAVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB362932_LHBs_P-C Product feature CHAIN AB362932_LHBs_P-C of FT:mat_peptide AB362932_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB365451_LHBs_P-C Product feature CHAIN AB365451_LHBs_P-C of FT:mat_peptide AB365451_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL196). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTALP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367392_LHBs_P-C Product feature CHAIN AB367392_LHBs_P-C of FT:mat_peptide AB367392_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFRQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTKILTIPQSLDLWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWFWGRSLYNILSPFLPLLPIFFRLWVYI
>gnl|hbvpro|AB367394_LHBs_P-C Product feature CHAIN AB367394_LHBs_P-C of FT:mat_peptide AB367394_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 3/Adefovir-treated Pt. 8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367395_LHBs_P-C Product feature CHAIN AB367395_LHBs_P-C of FT:mat_peptide AB367395_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367396_LHBs_P-C Product feature CHAIN AB367396_LHBs_P-C of FT:mat_peptide AB367396_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367397_LHBs_P-C Product feature CHAIN AB367397_LHBs_P-C of FT:mat_peptide AB367397_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMHWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAQNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367398_LHBs_P-C Product feature CHAIN AB367398_LHBs_P-C of FT:mat_peptide AB367398_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 7/Adefovir-treated Pt. 20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPITASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367399_LHBs_P-C Product feature CHAIN AB367399_LHBs_P-C of FT:mat_peptide AB367399_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 8/Adefovir-treated Pt. 29). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367401_LHBs_P-C Product feature CHAIN AB367401_LHBs_P-C of FT:mat_peptide AB367401_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 10/Adefovir-treated Pt. 9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHKAMLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB367402_LHBs_P-C Product feature CHAIN AB367402_LHBs_P-C of FT:mat_peptide AB367402_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSSLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367403_LHBs_P-C Product feature CHAIN AB367403_LHBs_P-C of FT:mat_peptide AB367403_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 12/Adefovir-treated Pt. 17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367404_LHBs_P-C Product feature CHAIN AB367404_LHBs_P-C of FT:mat_peptide AB367404_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 13/Adefovir-treated Pt. 22). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367406_LHBs_P-C Product feature CHAIN AB367406_LHBs_P-C of FT:mat_peptide AB367406_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 15/Adefovir-treated Pt. 7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGLTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTCNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367407_LHBs_P-C Product feature CHAIN AB367407_LHBs_P-C of FT:mat_peptide AB367407_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 16/Adefovir-treated Pt. 11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367410_LHBs_P-C Product feature CHAIN AB367410_LHBs_P-C of FT:mat_peptide AB367410_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 19/Adefovir-treated Pt. 19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMWLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367411_LHBs_P-C Product feature CHAIN AB367411_LHBs_P-C of FT:mat_peptide AB367411_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRKPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWFSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB367412_LHBs_P-C Product feature CHAIN AB367412_LHBs_P-C of FT:mat_peptide AB367412_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 21). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367414_LHBs_P-C Product feature CHAIN AB367414_LHBs_P-C of FT:mat_peptide AB367414_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 23/Adefovir-treated Pt. 3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367416_LHBs_P-C Product feature CHAIN AB367416_LHBs_P-C of FT:mat_peptide AB367416_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 25). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTTASP
ISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMWLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367417_LHBs_P-C Product feature CHAIN AB367417_LHBs_P-C of FT:mat_peptide AB367417_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 26). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|AB367418_LHBs_P-C Product feature CHAIN AB367418_LHBs_P-C of FT:mat_peptide AB367418_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 27/Adefovir-treated Pt. 21). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGTCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMIWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367420_LHBs_P-C Product feature CHAIN AB367420_LHBs_P-C of FT:mat_peptide AB367420_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 29). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPNLYNILSPFLPLLPIFCLLWVYI
>gnl|hbvpro|AB367422_LHBs_P-C Product feature CHAIN AB367422_LHBs_P-C of FT:mat_peptide AB367422_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 31/Adefovir-treated Pt. 12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367423_LHBs_P-C Product feature CHAIN AB367423_LHBs_P-C of FT:mat_peptide AB367423_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 32/Adefovir-treated Pt. 28). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367424_LHBs_P-C Product feature CHAIN AB367424_LHBs_P-C of FT:mat_peptide AB367424_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 33). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367427_LHBs_P-C Product feature CHAIN AB367427_LHBs_P-C of FT:mat_peptide AB367427_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 36/Adefovir-treated Pt. 18). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB367431_LHBs_P-C Product feature CHAIN AB367431_LHBs_P-C of FT:mat_peptide AB367431_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 40). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRTSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367432_LHBs_P-C Product feature CHAIN AB367432_LHBs_P-C of FT:mat_peptide AB367432_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 41). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPQQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367434_LHBs_P-C Product feature CHAIN AB367434_LHBs_P-C of FT:mat_peptide AB367434_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 43/Adefovir-treated Pt. 26). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSTKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDSVPNMENTASGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGRNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB367435_LHBs_P-C Product feature CHAIN AB367435_LHBs_P-C of FT:mat_peptide AB367435_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 44/Adefovir-treated Pt. 23). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGGSTSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGSSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLPAGGSSSGTVNPVPTTASPIS
SIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACPGQNSQSPTSNHSLTSCPPT
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCT
CIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPRLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367803_LHBs_P-C Product feature CHAIN AB367803_LHBs_P-C of FT:mat_peptide AB367803_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTTASP
ISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMWLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367804_LHBs_P-C Product feature CHAIN AB367804_LHBs_P-C of FT:mat_peptide AB367804_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPHQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB426467_LHBs_P-C Product feature CHAIN AB426467_LHBs_P-C of FT:mat_peptide AB426467_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILSTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB471848_LHBs_P-C Product feature CHAIN AB471848_LHBs_P-C of FT:mat_peptide AB471848_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-F). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471849_LHBs_P-C Product feature CHAIN AB471849_LHBs_P-C of FT:mat_peptide AB471849_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471850_LHBs_P-C Product feature CHAIN AB471850_LHBs_P-C of FT:mat_peptide AB471850_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471851_LHBs_P-C Product feature CHAIN AB471851_LHBs_P-C of FT:mat_peptide AB471851_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2NK-F). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471852_LHBs_P-C Product feature CHAIN AB471852_LHBs_P-C of FT:mat_peptide AB471852_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471853_LHBs_P-C Product feature CHAIN AB471853_LHBs_P-C of FT:mat_peptide AB471853_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB485808_LHBs_P-C Product feature CHAIN AB485808_LHBs_P-C of FT:mat_peptide AB485808_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-IT). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB485810_LHBs_P-C Product feature CHAIN AB485810_LHBs_P-C of FT:mat_peptide AB485810_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FEP2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVRWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB493839_LHBs_P-C Product feature CHAIN AB493839_LHBs_P-C of FT:mat_peptide AB493839_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPNKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTIASP
ISSIFSWTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB493844_LHBs_P-C Product feature CHAIN AB493844_LHBs_P-C of FT:mat_peptide AB493844_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 43UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPNKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB640730_LHBs_P-C Product feature CHAIN AB640730_LHBs_P-C of FT:mat_peptide AB640730_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ehime-EPCH-HBV-C1-HN). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642095_LHBs_P-C Product feature CHAIN AB642095_LHBs_P-C of FT:mat_peptide AB642095_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2000-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRXPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642097_LHBs_P-C Product feature CHAIN AB642097_LHBs_P-C of FT:mat_peptide AB642097_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2003-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AXGILTTVPAAPPPASTNRQSGRQPTPISPPXRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGYFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642099_LHBs_P-C Product feature CHAIN AB642099_LHBs_P-C of FT:mat_peptide AB642099_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2005-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642100_LHBs_P-C Product feature CHAIN AB642100_LHBs_P-C of FT:mat_peptide AB642100_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2006-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670237_LHBs_P-C Product feature CHAIN AB670237_LHBs_P-C of FT:mat_peptide AB670237_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPIXPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHXPTSCP
PTXPGYRWMCLXRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQXTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFXCLWVYI
>gnl|hbvpro|AB670238_LHBs_P-C Product feature CHAIN AB670238_LHBs_P-C of FT:mat_peptide AB670238_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGALGPGFTPPHGGLLGWSPQ
XQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSLTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670239_LHBs_P-C Product feature CHAIN AB670239_LHBs_P-C of FT:mat_peptide AB670239_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVKWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB670240_LHBs_P-C Product feature CHAIN AB670240_LHBs_P-C of FT:mat_peptide AB670240_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVKWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB670241_LHBs_P-C Product feature CHAIN AB670241_LHBs_P-C of FT:mat_peptide AB670241_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSVIWMXWYWGXSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB670242_LHBs_P-C Product feature CHAIN AB670242_LHBs_P-C of FT:mat_peptide AB670242_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PXCPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670243_LHBs_P-C Product feature CHAIN AB670243_LHBs_P-C of FT:mat_peptide AB670243_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.7). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670247_LHBs_P-C Product feature CHAIN AB670247_LHBs_P-C of FT:mat_peptide AB670247_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670249_LHBs_P-C Product feature CHAIN AB670249_LHBs_P-C of FT:mat_peptide AB670249_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670251_LHBs_P-C Product feature CHAIN AB670251_LHBs_P-C of FT:mat_peptide AB670251_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGPYTKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670252_LHBs_P-C Product feature CHAIN AB670252_LHBs_P-C of FT:mat_peptide AB670252_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHCPEANQVGAGAFGPGFTPPXGGXLGWSXQ
AQGXLXTVPAAPPPASTNRQXGRQPTXXSPPLXDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670253_LHBs_P-C Product feature CHAIN AB670253_LHBs_P-C of FT:mat_peptide AB670253_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFLLTRILTILKNLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRHFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670256_LHBs_P-C Product feature CHAIN AB670256_LHBs_P-C of FT:mat_peptide AB670256_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670258_LHBs_P-C Product feature CHAIN AB670258_LHBs_P-C of FT:mat_peptide AB670258_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.22). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPATTNRQSRRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMWLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670259_LHBs_P-C Product feature CHAIN AB670259_LHBs_P-C of FT:mat_peptide AB670259_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.23). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSXNPDWDFNPNKDHWPEANXVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMHRISTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDLAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPKCLGQSSQSPTCNHSPTSCP
PTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670260_LHBs_P-C Product feature CHAIN AB670260_LHBs_P-C of FT:mat_peptide AB670260_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.24). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDHAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSGIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670262_LHBs_P-C Product feature CHAIN AB670262_LHBs_P-C of FT:mat_peptide AB670262_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.26). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTMTTVPAAPPPASTNRQSGRKPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670263_LHBs_P-C Product feature CHAIN AB670263_LHBs_P-C of FT:mat_peptide AB670263_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.27). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQ
AQGILTTVPASPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670264_LHBs_P-C Product feature CHAIN AB670264_LHBs_P-C of FT:mat_peptide AB670264_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.28). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSLTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB670265_LHBs_P-C Product feature CHAIN AB670265_LHBs_P-C of FT:mat_peptide AB670265_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.29). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGRNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670267_LHBs_P-C Product feature CHAIN AB670267_LHBs_P-C of FT:mat_peptide AB670267_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.31). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
APGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCXTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670269_LHBs_P-C Product feature CHAIN AB670269_LHBs_P-C of FT:mat_peptide AB670269_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.33). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB670270_LHBs_P-C Product feature CHAIN AB670270_LHBs_P-C of FT:mat_peptide AB670270_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.34). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB670272_LHBs_P-C Product feature CHAIN AB670272_LHBs_P-C of FT:mat_peptide AB670272_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.36). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAQNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVISMMWFWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670273_LHBs_P-C Product feature CHAIN AB670273_LHBs_P-C of FT:mat_peptide AB670273_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.37). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATKWNSTTFHQVLLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670274_LHBs_P-C Product feature CHAIN AB670274_LHBs_P-C of FT:mat_peptide AB670274_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCQRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWYWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670275_LHBs_P-C Product feature CHAIN AB670275_LHBs_P-C of FT:mat_peptide AB670275_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|AB670276_LHBs_P-C Product feature CHAIN AB670276_LHBs_P-C of FT:mat_peptide AB670276_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670277_LHBs_P-C Product feature CHAIN AB670277_LHBs_P-C of FT:mat_peptide AB670277_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTSPAQGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670278_LHBs_P-C Product feature CHAIN AB670278_LHBs_P-C of FT:mat_peptide AB670278_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTAPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670279_LHBs_P-C Product feature CHAIN AB670279_LHBs_P-C of FT:mat_peptide AB670279_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGDLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTAAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670281_LHBs_P-C Product feature CHAIN AB670281_LHBs_P-C of FT:mat_peptide AB670281_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGXSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGAGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670282_LHBs_P-C Product feature CHAIN AB670282_LHBs_P-C of FT:mat_peptide AB670282_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670283_LHBs_P-C Product feature CHAIN AB670283_LHBs_P-C of FT:mat_peptide AB670283_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670285_LHBs_P-C Product feature CHAIN AB670285_LHBs_P-C of FT:mat_peptide AB670285_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILXLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670287_LHBs_P-C Product feature CHAIN AB670287_LHBs_P-C of FT:mat_peptide AB670287_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670288_LHBs_P-C Product feature CHAIN AB670288_LHBs_P-C of FT:mat_peptide AB670288_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.15). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670289_LHBs_P-C Product feature CHAIN AB670289_LHBs_P-C of FT:mat_peptide AB670289_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFXXALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRXLTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670290_LHBs_P-C Product feature CHAIN AB670290_LHBs_P-C of FT:mat_peptide AB670290_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.17). Complete genome. [Hepadnaviridae] (length=395 residues).
TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPAALPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIF
SRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPPLPIFFCLWVYI
>gnl|hbvpro|AB670291_LHBs_P-C Product feature CHAIN AB670291_LHBs_P-C of FT:mat_peptide AB670291_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.18). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670292_LHBs_P-C Product feature CHAIN AB670292_LHBs_P-C of FT:mat_peptide AB670292_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670295_LHBs_P-C Product feature CHAIN AB670295_LHBs_P-C of FT:mat_peptide AB670295_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.22). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPLAVCWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670297_LHBs_P-C Product feature CHAIN AB670297_LHBs_P-C of FT:mat_peptide AB670297_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.24). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
APGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670298_LHBs_P-C Product feature CHAIN AB670298_LHBs_P-C of FT:mat_peptide AB670298_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.25). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPANGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGRSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB670300_LHBs_P-C Product feature CHAIN AB670300_LHBs_P-C of FT:mat_peptide AB670300_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.27). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGRNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670301_LHBs_P-C Product feature CHAIN AB670301_LHBs_P-C of FT:mat_peptide AB670301_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.28). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670302_LHBs_P-C Product feature CHAIN AB670302_LHBs_P-C of FT:mat_peptide AB670302_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.29). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670305_LHBs_P-C Product feature CHAIN AB670305_LHBs_P-C of FT:mat_peptide AB670305_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.32). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670306_LHBs_P-C Product feature CHAIN AB670306_LHBs_P-C of FT:mat_peptide AB670306_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.33). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRRMCLRRFIIFLFILLLCLIFLWVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670307_LHBs_P-C Product feature CHAIN AB670307_LHBs_P-C of FT:mat_peptide AB670307_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.34). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670310_LHBs_P-C Product feature CHAIN AB670310_LHBs_P-C of FT:mat_peptide AB670310_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.37). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670311_LHBs_P-C Product feature CHAIN AB670311_LHBs_P-C of FT:mat_peptide AB670311_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.38). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB675674_LHBs_P-C Product feature CHAIN AB675674_LHBs_P-C of FT:mat_peptide AB675674_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A33). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWGPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTIPAQGPSMFPSCCCSKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|AB675675_LHBs_P-C Product feature CHAIN AB675675_LHBs_P-C of FT:mat_peptide AB675675_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A34). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWGPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTIPAQGPSMFPSCCCSKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|AB675677_LHBs_P-C Product feature CHAIN AB675677_LHBs_P-C of FT:mat_peptide AB675677_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A39). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697490_LHBs_P-C Product feature CHAIN AB697490_LHBs_P-C of FT:mat_peptide AB697490_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697500_LHBs_P-C Product feature CHAIN AB697500_LHBs_P-C of FT:mat_peptide AB697500_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697502_LHBs_P-C Product feature CHAIN AB697502_LHBs_P-C of FT:mat_peptide AB697502_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXXGPRLYTILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697510_LHBs_P-C Product feature CHAIN AB697510_LHBs_P-C of FT:mat_peptide AB697510_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No33). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVEAGAFGPGFTPPHGGLLGWSPQ
AQGMLTSVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGIVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900099_LHBs_P-C Product feature CHAIN AB900099_LHBs_P-C of FT:mat_peptide AB900099_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSLTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900109_LHBs_P-C Product feature CHAIN AB900109_LHBs_P-C of FT:mat_peptide AB900109_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
TQGILTTVPAAPPPATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPACRGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB900113_LHBs_P-C Product feature CHAIN AB900113_LHBs_P-C of FT:mat_peptide AB900113_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNPTKDQWPEAHQVGVGAFGPGFTPPHGGLLGWSPQ
TQGILTTVPTAPPPATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGAPTCPGQNSQCPTSNHSPTSCP
PICPGYRWMCLRHFIIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900115_LHBs_P-C Product feature CHAIN AB900115_LHBs_P-C of FT:mat_peptide AB900115_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGDLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900116_LHBs_P-C Product feature CHAIN AB900116_LHBs_P-C of FT:mat_peptide AB900116_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB931170_LHBs_P-C Product feature CHAIN AB931170_LHBs_P-C of FT:mat_peptide AB931170_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2P_HB11-0921). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGLGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
TQGKLTSMPAAPPPATTNRQLGRRPTPITPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
QICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDWKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCSKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB931171_LHBs_P-C Product feature CHAIN AB931171_LHBs_P-C of FT:mat_peptide AB931171_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2S_HB11-0922). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGLGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPTKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
TQGKLTSMPAAPPPATTNRQSGRRPTPITPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB971714_LHBs_P-C Product feature CHAIN AB971714_LHBs_P-C of FT:mat_peptide AB971714_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1026). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB971715_LHBs_P-C Product feature CHAIN AB971715_LHBs_P-C of FT:mat_peptide AB971715_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1027). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTTLVQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF068756_LHBs_P-C Product feature CHAIN AF068756_LHBs_P-C of FT:mat_peptide AF068756_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF182802_LHBs_P-C Product feature CHAIN AF182802_LHBs_P-C of FT:mat_peptide AF182802_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGVTPPHGGLLGRSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMQNTTSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASIRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|AF182803_LHBs_P-C Product feature CHAIN AF182803_LHBs_P-C of FT:mat_peptide AF182803_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGVTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLVFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASIRFSWLSLLVPFVQWVVRLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|AF223954_LHBs_P-C Product feature CHAIN AF223954_LHBs_P-C of FT:mat_peptide AF223954_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223955_LHBs_P-C Product feature CHAIN AF223955_LHBs_P-C of FT:mat_peptide AF223955_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223957_LHBs_P-C Product feature CHAIN AF223957_LHBs_P-C of FT:mat_peptide AF223957_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223958_LHBs_P-C Product feature CHAIN AF223958_LHBs_P-C of FT:mat_peptide AF223958_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPALNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223960_LHBs_P-C Product feature CHAIN AF223960_LHBs_P-C of FT:mat_peptide AF223960_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
QICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223961_LHBs_P-C Product feature CHAIN AF223961_LHBs_P-C of FT:mat_peptide AF223961_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF241410_LHBs_P-C Product feature CHAIN AF241410_LHBs_P-C of FT:mat_peptide AF241410_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3270). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPVPKMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF241411_LHBs_P-C Product feature CHAIN AF241411_LHBs_P-C of FT:mat_peptide AF241411_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8290). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPVPKMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXXSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF286594_LHBs_P-C Product feature CHAIN AF286594_LHBs_P-C of FT:mat_peptide AF286594_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPDGIKVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF363961_LHBs_P-C Product feature CHAIN AF363961_LHBs_P-C of FT:mat_peptide AF363961_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWASARFLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF384371_LHBs_P-C Product feature CHAIN AF384371_LHBs_P-C of FT:mat_peptide AF384371_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|AF411408_LHBs_P-C Product feature CHAIN AF411408_LHBs_P-C of FT:mat_peptide AF411408_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF411411_LHBs_P-C Product feature CHAIN AF411411_LHBs_P-C of FT:mat_peptide AF411411_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF411412_LHBs_P-C Product feature CHAIN AF411412_LHBs_P-C of FT:mat_peptide AF411412_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF458664_LHBs_P-C Product feature CHAIN AF458664_LHBs_P-C of FT:mat_peptide AF458664_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C84). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF458665_LHBs_P-C Product feature CHAIN AF458665_LHBs_P-C of FT:mat_peptide AF458665_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C733). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTDLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILSTVPVAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTTGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRCFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461357_LHBs_P-C Product feature CHAIN AF461357_LHBs_P-C of FT:mat_peptide AF461357_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPCLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461358_LHBs_P-C Product feature CHAIN AF461358_LHBs_P-C of FT:mat_peptide AF461358_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH8). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPKKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCAIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461359_LHBs_P-C Product feature CHAIN AF461359_LHBs_P-C of FT:mat_peptide AF461359_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate c16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPKKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCAIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461363_LHBs_P-C Product feature CHAIN AF461363_LHBs_P-C of FT:mat_peptide AF461363_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPCLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF473543_LHBs_P-C Product feature CHAIN AF473543_LHBs_P-C of FT:mat_peptide AF473543_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2e). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDSNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF533983_LHBs_P-C Product feature CHAIN AF533983_LHBs_P-C of FT:mat_peptide AF533983_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGGPAPNMESTTSGFLGPLLVLQAGFFLLTRILTVPQSLDSRWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWTCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011097_LHBs_P-C Product feature CHAIN AP011097_LHBs_P-C of FT:mat_peptide AP011097_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011098_LHBs_P-C Product feature CHAIN AP011098_LHBs_P-C of FT:mat_peptide AP011098_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011099_LHBs_P-C Product feature CHAIN AP011099_LHBs_P-C of FT:mat_peptide AP011099_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011100_LHBs_P-C Product feature CHAIN AP011100_LHBs_P-C of FT:mat_peptide AP011100_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011101_LHBs_P-C Product feature CHAIN AP011101_LHBs_P-C of FT:mat_peptide AP011101_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011106_LHBs_P-C Product feature CHAIN AP011106_LHBs_P-C of FT:mat_peptide AP011106_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTPVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTSASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011107_LHBs_P-C Product feature CHAIN AP011107_LHBs_P-C of FT:mat_peptide AP011107_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTPVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY057947_LHBs_P-C Product feature CHAIN AY057947_LHBs_P-C of FT:mat_peptide AY057947_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet705). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHHLDPAFGANSNNPDWDFNPIKDHWPAANQVGVGAFGPGLTPPHGGILGWSPQ
AQGILTTVSTIPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY066028_LHBs_P-C Product feature CHAIN AY066028_LHBs_P-C of FT:mat_peptide AY066028_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGTGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY167091_LHBs_P-C Product feature CHAIN AY167091_LHBs_P-C of FT:mat_peptide AY167091_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ic). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
TQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY167096_LHBs_P-C Product feature CHAIN AY167096_LHBs_P-C of FT:mat_peptide AY167096_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IIIa). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSKTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY167099_LHBs_P-C Product feature CHAIN AY167099_LHBs_P-C of FT:mat_peptide AY167099_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IVb). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPXQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGK
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206376_LHBs_P-C Product feature CHAIN AY206376_LHBs_P-C of FT:mat_peptide AY206376_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAKQVGVGAFGPGFTPPHGSLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRRPTPISPPLRDSHPQALKWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKACTTPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206379_LHBs_P-C Product feature CHAIN AY206379_LHBs_P-C of FT:mat_peptide AY206379_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAKQVGVGAFGPGFTPPHGSLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRRPTPISPPLRDSHPQALKWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKACTTPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206381_LHBs_P-C Product feature CHAIN AY206381_LHBs_P-C of FT:mat_peptide AY206381_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206382_LHBs_P-C Product feature CHAIN AY206382_LHBs_P-C of FT:mat_peptide AY206382_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPKANQVGAGAFGPGFTPPRGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFFWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPTFFCLWVYI
>gnl|hbvpro|AY206384_LHBs_P-C Product feature CHAIN AY206384_LHBs_P-C of FT:mat_peptide AY206384_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWKCASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206386_LHBs_P-C Product feature CHAIN AY206386_LHBs_P-C of FT:mat_peptide AY206386_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
TQGILTTVPAAPPPATTNRQSGRQPTPISPPLRDSHPQTMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVXLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206392_LHBs_P-C Product feature CHAIN AY206392_LHBs_P-C of FT:mat_peptide AY206392_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAHPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY220699_LHBs_P-C Product feature CHAIN AY220699_LHBs_P-C of FT:mat_peptide AY220699_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDLAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPHAIQWNSTTFHQTLLDPRVRGLYIPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|AY247031_LHBs_P-C Product feature CHAIN AY247031_LHBs_P-C of FT:mat_peptide AY247031_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB84). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY247032_LHBs_P-C Product feature CHAIN AY247032_LHBs_P-C of FT:mat_peptide AY247032_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB95). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY306136_LHBs_P-C Product feature CHAIN AY306136_LHBs_P-C of FT:mat_peptide AY306136_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H85). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFPRTGDPALNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCRRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY596107_LHBs_P-C Product feature CHAIN AY596107_LHBs_P-C of FT:mat_peptide AY596107_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-1). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSAFTNRESGRQTTPISPPLRDSHPQAMQWNFTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY596108_LHBs_P-C Product feature CHAIN AY596108_LHBs_P-C of FT:mat_peptide AY596108_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPVGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPIFPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641558_LHBs_P-C Product feature CHAIN AY641558_LHBs_P-C of FT:mat_peptide AY641558_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He74). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641559_LHBs_P-C Product feature CHAIN AY641559_LHBs_P-C of FT:mat_peptide AY641559_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He53). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
ARGIVTPVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLPIFLCLWVYI
>gnl|hbvpro|AY641560_LHBs_P-C Product feature CHAIN AY641560_LHBs_P-C of FT:mat_peptide AY641560_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He100). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGTFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641561_LHBs_P-C Product feature CHAIN AY641561_LHBs_P-C of FT:mat_peptide AY641561_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He127). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY641563_LHBs_P-C Product feature CHAIN AY641563_LHBs_P-C of FT:mat_peptide AY641563_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He52). Complete genome. [Hepadnaviridae] (length=395 residues).
IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIF
SRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWYWGPNLYNIWSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY862869_LHBs_P-C Product feature CHAIN AY862869_LHBs_P-C of FT:mat_peptide AY862869_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H8). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGNLLGWSSQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|D00630_LHBs_P-C Product feature CHAIN D00630_LHBs_P-C of FT:mat_peptide D00630_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQAVLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGPNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D12980_LHBs_P-C Product feature CHAIN D12980_LHBs_P-C of FT:mat_peptide D12980_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPDGIKVGAGDFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCWCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D23681_LHBs_P-C Product feature CHAIN D23681_LHBs_P-C of FT:mat_peptide D23681_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C4-HBVST2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMLPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|D23682_LHBs_P-C Product feature CHAIN D23682_LHBs_P-C of FT:mat_peptide D23682_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B5-HBVKO1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFSLTRIHTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D23683_LHBs_P-C Product feature CHAIN D23683_LHBs_P-C of FT:mat_peptide D23683_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C5-HBVKO2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFSLTRIHTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQGLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|D23684_LHBs_P-C Product feature CHAIN D23684_LHBs_P-C of FT:mat_peptide D23684_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C6-TKB588). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D28880_LHBs_P-C Product feature CHAIN D28880_LHBs_P-C of FT:mat_peptide D28880_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Plasma 1992-085-9434). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSISSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPKCPGLNSQSPTSNHSPTSCP
PICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTPTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CICIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50517_LHBs_P-C Product feature CHAIN D50517_LHBs_P-C of FT:mat_peptide D50517_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50518_LHBs_P-C Product feature CHAIN D50518_LHBs_P-C of FT:mat_peptide D50518_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50519_LHBs_P-C Product feature CHAIN D50519_LHBs_P-C of FT:mat_peptide D50519_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPEAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWVSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50520_LHBs_P-C Product feature CHAIN D50520_LHBs_P-C of FT:mat_peptide D50520_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPEAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089757_LHBs_P-C Product feature CHAIN DQ089757_LHBs_P-C of FT:mat_peptide DQ089757_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2342). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGXSSKPRXGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPEAHQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGXNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPXVWLSVIWMMWYWGPSLYNXLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089758_LHBs_P-C Product feature CHAIN DQ089758_LHBs_P-C of FT:mat_peptide DQ089758_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1733). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDLAFRANTNNPDWDFNPNKDPWPEAXQVGAGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPISPPLRDSHPQAVQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089760_LHBs_P-C Product feature CHAIN DQ089760_LHBs_P-C of FT:mat_peptide DQ089760_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK454). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGXGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089761_LHBs_P-C Product feature CHAIN DQ089761_LHBs_P-C of FT:mat_peptide DQ089761_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK515). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTIPAAPPPASTNRQVGRKPTPISPPLRDSHPQAXQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSVFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089762_LHBs_P-C Product feature CHAIN DQ089762_LHBs_P-C of FT:mat_peptide DQ089762_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1644). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSHQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSRTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089763_LHBs_P-C Product feature CHAIN DQ089763_LHBs_P-C of FT:mat_peptide DQ089763_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1048). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPAASTNRQSGRQPTPISPPLRDSHPQATQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCP
PTCPGYRLMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089764_LHBs_P-C Product feature CHAIN DQ089764_LHBs_P-C of FT:mat_peptide DQ089764_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK967). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089765_LHBs_P-C Product feature CHAIN DQ089765_LHBs_P-C of FT:mat_peptide DQ089765_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK428). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089766_LHBs_P-C Product feature CHAIN DQ089766_LHBs_P-C of FT:mat_peptide DQ089766_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK553). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANTNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTKRQSGRQPTPISPPLRDSHPQATQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYXGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089767_LHBs_P-C Product feature CHAIN DQ089767_LHBs_P-C of FT:mat_peptide DQ089767_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1663). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPK
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSGP
PXCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPXLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089768_LHBs_P-C Product feature CHAIN DQ089768_LHBs_P-C of FT:mat_peptide DQ089768_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1814). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILSTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSSTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTFCP
PTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089769_LHBs_P-C Product feature CHAIN DQ089769_LHBs_P-C of FT:mat_peptide DQ089769_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK430). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089770_LHBs_P-C Product feature CHAIN DQ089770_LHBs_P-C of FT:mat_peptide DQ089770_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1272). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTLPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPXTASP
ISSIFSRXGDPAPNMESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089771_LHBs_P-C Product feature CHAIN DQ089771_LHBs_P-C of FT:mat_peptide DQ089771_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1629). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFRANSNIPDWDFNPNKDQWPAAHQVGVGSFGPGLTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRRSGRQPTPITPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089772_LHBs_P-C Product feature CHAIN DQ089772_LHBs_P-C of FT:mat_peptide DQ089772_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK910). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPKKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRKPTPISPPLRDSHPQAMQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|DQ089773_LHBs_P-C Product feature CHAIN DQ089773_LHBs_P-C of FT:mat_peptide DQ089773_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1193). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSKTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSILSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSCP
QICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089775_LHBs_P-C Product feature CHAIN DQ089775_LHBs_P-C of FT:mat_peptide DQ089775_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK290). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNXPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTKRQPKRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILXLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLLVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089776_LHBs_P-C Product feature CHAIN DQ089776_LHBs_P-C of FT:mat_peptide DQ089776_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK884). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089777_LHBs_P-C Product feature CHAIN DQ089777_LHBs_P-C of FT:mat_peptide DQ089777_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1159). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089778_LHBs_P-C Product feature CHAIN DQ089778_LHBs_P-C of FT:mat_peptide DQ089778_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1442). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ089779_LHBs_P-C Product feature CHAIN DQ089779_LHBs_P-C of FT:mat_peptide DQ089779_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK554). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089780_LHBs_P-C Product feature CHAIN DQ089780_LHBs_P-C of FT:mat_peptide DQ089780_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK947). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNXSTFHQALLDPRVRGXYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLVVLXDYRGMLPVCPXLPGTSTTSXGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089781_LHBs_P-C Product feature CHAIN DQ089781_LHBs_P-C of FT:mat_peptide DQ089781_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1476). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPTANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089782_LHBs_P-C Product feature CHAIN DQ089782_LHBs_P-C of FT:mat_peptide DQ089782_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2032). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089783_LHBs_P-C Product feature CHAIN DQ089783_LHBs_P-C of FT:mat_peptide DQ089783_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1402). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPTFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRKPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089784_LHBs_P-C Product feature CHAIN DQ089784_LHBs_P-C of FT:mat_peptide DQ089784_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1285). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089785_LHBs_P-C Product feature CHAIN DQ089785_LHBs_P-C of FT:mat_peptide DQ089785_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1386). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVRWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089786_LHBs_P-C Product feature CHAIN DQ089786_LHBs_P-C of FT:mat_peptide DQ089786_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2074). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPSTASP
ISSIFARTGDPAPNMESISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089787_LHBs_P-C Product feature CHAIN DQ089787_LHBs_P-C of FT:mat_peptide DQ089787_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK352). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSCVSRFIPAHGHLVGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089788_LHBs_P-C Product feature CHAIN DQ089788_LHBs_P-C of FT:mat_peptide DQ089788_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK820). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIISLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWSWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ089789_LHBs_P-C Product feature CHAIN DQ089789_LHBs_P-C of FT:mat_peptide DQ089789_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK926). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPAANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089790_LHBs_P-C Product feature CHAIN DQ089790_LHBs_P-C of FT:mat_peptide DQ089790_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1248). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDLNPNKDPWPAAQQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPITASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWVSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089791_LHBs_P-C Product feature CHAIN DQ089791_LHBs_P-C of FT:mat_peptide DQ089791_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1205). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSXTFHQALPDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXNILNPFLPLLPIFFXLWVYI
>gnl|hbvpro|DQ089792_LHBs_P-C Product feature CHAIN DQ089792_LHBs_P-C of FT:mat_peptide DQ089792_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK870). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDSRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILNPFXPLLPIFFXLWVYI
>gnl|hbvpro|DQ089793_LHBs_P-C Product feature CHAIN DQ089793_LHBs_P-C of FT:mat_peptide DQ089793_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK343). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089795_LHBs_P-C Product feature CHAIN DQ089795_LHBs_P-C of FT:mat_peptide DQ089795_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1465). Complete genome. [Hepadnaviridae] (length=401 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPXPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSSFSRTGDPAPNMENTISXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGNSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDG
NCTCIPIPSSWAFARFLWEWXSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVY
I
>gnl|hbvpro|DQ089796_LHBs_P-C Product feature CHAIN DQ089796_LHBs_P-C of FT:mat_peptide DQ089796_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK751). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDHWPEAXQVGVGAFGPGFTPPHGGLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSRSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089797_LHBs_P-C Product feature CHAIN DQ089797_LHBs_P-C of FT:mat_peptide DQ089797_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1169). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGXLTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTIHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASP
ISSNFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSXHSLISCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWSWGPXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089799_LHBs_P-C Product feature CHAIN DQ089799_LHBs_P-C of FT:mat_peptide DQ089799_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK734). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089801_LHBs_P-C Product feature CHAIN DQ089801_LHBs_P-C of FT:mat_peptide DQ089801_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2100). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
TQGILTTVPAAPPPATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089802_LHBs_P-C Product feature CHAIN DQ089802_LHBs_P-C of FT:mat_peptide DQ089802_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1371). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
TQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPAGGSSSGAVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089803_LHBs_P-C Product feature CHAIN DQ089803_LHBs_P-C of FT:mat_peptide DQ089803_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK931). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSIPNPLGFFPSHQLDPAFRANSNNPDWDFNPNKDQWPAANKVGVGSFGPGFTPPHGSLLGWSPQ
AQGTLTTVPAAPPPASTNRQSRRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089804_LHBs_P-C Product feature CHAIN DQ089804_LHBs_P-C of FT:mat_peptide DQ089804_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK262). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLXPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFSLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFLCLWVYI
>gnl|hbvpro|DQ246215_LHBs_P-C Product feature CHAIN DQ246215_LHBs_P-C of FT:mat_peptide DQ246215_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPYVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377164_LHBs_P-C Product feature CHAIN DQ377164_LHBs_P-C of FT:mat_peptide DQ377164_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPAHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPVQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARSLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377165_LHBs_P-C Product feature CHAIN DQ377165_LHBs_P-C of FT:mat_peptide DQ377165_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT35). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGVGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHRPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNPTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTRTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRLSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478885_LHBs_P-C Product feature CHAIN DQ478885_LHBs_P-C of FT:mat_peptide DQ478885_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQSMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478899_LHBs_P-C Product feature CHAIN DQ478899_LHBs_P-C of FT:mat_peptide DQ478899_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVHPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMYLRRFIILLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRSSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478900_LHBs_P-C Product feature CHAIN DQ478900_LHBs_P-C of FT:mat_peptide DQ478900_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H172). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILQLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478901_LHBs_P-C Product feature CHAIN DQ478901_LHBs_P-C of FT:mat_peptide DQ478901_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H155). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPVFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFNIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSTWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWRMWYWGPRLYNILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ536410_LHBs_P-C Product feature CHAIN DQ536410_LHBs_P-C of FT:mat_peptide DQ536410_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ536412_LHBs_P-C Product feature CHAIN DQ536412_LHBs_P-C of FT:mat_peptide DQ536412_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVRTTASP
ISSIFSRTGDLAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFPFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ683578_LHBs_P-C Product feature CHAIN DQ683578_LHBs_P-C of FT:mat_peptide DQ683578_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSERQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ890381_LHBs_P-C Product feature CHAIN DQ890381_LHBs_P-C of FT:mat_peptide DQ890381_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPKVRGLYLPVGGSSSGTVNPVPTIASP
ISSIFSKTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ922649_LHBs_P-C Product feature CHAIN DQ922649_LHBs_P-C of FT:mat_peptide DQ922649_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ922650_LHBs_P-C Product feature CHAIN DQ922650_LHBs_P-C of FT:mat_peptide DQ922650_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ922651_LHBs_P-C Product feature CHAIN DQ922651_LHBs_P-C of FT:mat_peptide DQ922651_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ975272_LHBs_P-C Product feature CHAIN DQ975272_LHBs_P-C of FT:mat_peptide DQ975272_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ975273_LHBs_P-C Product feature CHAIN DQ975273_LHBs_P-C of FT:mat_peptide DQ975273_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDINPNKDHWPGATQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ980547_LHBs_P-C Product feature CHAIN DQ980547_LHBs_P-C of FT:mat_peptide DQ980547_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGACKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ993691_LHBs_P-C Product feature CHAIN DQ993691_LHBs_P-C of FT:mat_peptide DQ993691_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0803-Nature2.2-unSero). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ993692_LHBs_P-C Product feature CHAIN DQ993692_LHBs_P-C of FT:mat_peptide DQ993692_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0810-Nature2.1-unSero). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ993693_LHBs_P-C Product feature CHAIN DQ993693_LHBs_P-C of FT:mat_peptide DQ993693_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 232-1125-Nature1.1-unSero). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF137803_LHBs_P-C Product feature CHAIN EF137803_LHBs_P-C of FT:mat_peptide EF137803_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=395 residues).
IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIF
SRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWLSLLVPFAQWFAGLSPTVWLSVIWMMWYWGPSLYNIWSPFLPLLPIFFCLWAYI
>gnl|hbvpro|EF384200_LHBs_P-C Product feature CHAIN EF384200_LHBs_P-C of FT:mat_peptide EF384200_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASSNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF384206_LHBs_P-C Product feature CHAIN EF384206_LHBs_P-C of FT:mat_peptide EF384206_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-07). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASXNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF494379_LHBs_P-C Product feature CHAIN EF494379_LHBs_P-C of FT:mat_peptide EF494379_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW8585). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPAPTNRQSGRQPTPISPPLRDSHPQAVQWNSNTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF536065_LHBs_P-C Product feature CHAIN EF536065_LHBs_P-C of FT:mat_peptide EF536065_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTFCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF536066_LHBs_P-C Product feature CHAIN EF536066_LHBs_P-C of FT:mat_peptide EF536066_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASP
ISPIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPGQNSQSPTSNHSLTFCP
LTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF688062_LHBs_P-C Product feature CHAIN EF688062_LHBs_P-C of FT:mat_peptide EF688062_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ28-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075315_LHBs_P-C Product feature CHAIN EU075315_LHBs_P-C of FT:mat_peptide EU075315_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S194-A11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSSFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQAMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075334_LHBs_P-C Product feature CHAIN EU075334_LHBs_P-C of FT:mat_peptide EU075334_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075335_LHBs_P-C Product feature CHAIN EU075335_LHBs_P-C of FT:mat_peptide EU075335_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075336_LHBs_P-C Product feature CHAIN EU075336_LHBs_P-C of FT:mat_peptide EU075336_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-49). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075338_LHBs_P-C Product feature CHAIN EU075338_LHBs_P-C of FT:mat_peptide EU075338_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-B9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075342_LHBs_P-C Product feature CHAIN EU075342_LHBs_P-C of FT:mat_peptide EU075342_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-C14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082428_LHBs_P-C Product feature CHAIN EU082428_LHBs_P-C of FT:mat_peptide EU082428_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-A1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082429_LHBs_P-C Product feature CHAIN EU082429_LHBs_P-C of FT:mat_peptide EU082429_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-A2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082430_LHBs_P-C Product feature CHAIN EU082430_LHBs_P-C of FT:mat_peptide EU082430_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-A3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082431_LHBs_P-C Product feature CHAIN EU082431_LHBs_P-C of FT:mat_peptide EU082431_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-B4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082432_LHBs_P-C Product feature CHAIN EU082432_LHBs_P-C of FT:mat_peptide EU082432_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-B6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFITFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082435_LHBs_P-C Product feature CHAIN EU082435_LHBs_P-C of FT:mat_peptide EU082435_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-B12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTWPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086837_LHBs_P-C Product feature CHAIN EU086837_LHBs_P-C of FT:mat_peptide EU086837_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S246-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086839_LHBs_P-C Product feature CHAIN EU086839_LHBs_P-C of FT:mat_peptide EU086839_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S246-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=395 residues).
TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPISSIF
SRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086840_LHBs_P-C Product feature CHAIN EU086840_LHBs_P-C of FT:mat_peptide EU086840_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGISTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPI
SSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNC
TCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086841_LHBs_P-C Product feature CHAIN EU086841_LHBs_P-C of FT:mat_peptide EU086841_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=399 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGISTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPI
SSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP
ICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNC
TCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086842_LHBs_P-C Product feature CHAIN EU086842_LHBs_P-C of FT:mat_peptide EU086842_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGDLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086843_LHBs_P-C Product feature CHAIN EU086843_LHBs_P-C of FT:mat_peptide EU086843_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGISTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086844_LHBs_P-C Product feature CHAIN EU086844_LHBs_P-C of FT:mat_peptide EU086844_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLSTPVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086845_LHBs_P-C Product feature CHAIN EU086845_LHBs_P-C of FT:mat_peptide EU086845_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-B3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGLSTPVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPPCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086846_LHBs_P-C Product feature CHAIN EU086846_LHBs_P-C of FT:mat_peptide EU086846_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-B4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGLSTPVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086847_LHBs_P-C Product feature CHAIN EU086847_LHBs_P-C of FT:mat_peptide EU086847_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-B7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGLSTPVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093883_LHBs_P-C Product feature CHAIN EU093883_LHBs_P-C of FT:mat_peptide EU093883_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S385-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093895_LHBs_P-C Product feature CHAIN EU093895_LHBs_P-C of FT:mat_peptide EU093895_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S402-13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSARQPTPISPPLRDSHPQAIQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093896_LHBs_P-C Product feature CHAIN EU093896_LHBs_P-C of FT:mat_peptide EU093896_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S402-14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPVSTNRQSARQPTPISPPLRDSHPQAIQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU093898_LHBs_P-C Product feature CHAIN EU093898_LHBs_P-C of FT:mat_peptide EU093898_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S402-4). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPVSTNRQSARQPTPISPPLRDSHPQAIQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093900_LHBs_P-C Product feature CHAIN EU093900_LHBs_P-C of FT:mat_peptide EU093900_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S403-6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMYLRGFIIFLFILLLCLICLLVLVDSRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093902_LHBs_P-C Product feature CHAIN EU093902_LHBs_P-C of FT:mat_peptide EU093902_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S404-24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPTFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVLTTVPVVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVTFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093903_LHBs_P-C Product feature CHAIN EU093903_LHBs_P-C of FT:mat_peptide EU093903_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S406-16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093907_LHBs_P-C Product feature CHAIN EU093907_LHBs_P-C of FT:mat_peptide EU093907_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S408-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093908_LHBs_P-C Product feature CHAIN EU093908_LHBs_P-C of FT:mat_peptide EU093908_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S410-7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093909_LHBs_P-C Product feature CHAIN EU093909_LHBs_P-C of FT:mat_peptide EU093909_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate X441-8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093910_LHBs_P-C Product feature CHAIN EU093910_LHBs_P-C of FT:mat_peptide EU093910_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S205-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093911_LHBs_P-C Product feature CHAIN EU093911_LHBs_P-C of FT:mat_peptide EU093911_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S205-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHSGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093912_LHBs_P-C Product feature CHAIN EU093912_LHBs_P-C of FT:mat_peptide EU093912_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S205-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093913_LHBs_P-C Product feature CHAIN EU093913_LHBs_P-C of FT:mat_peptide EU093913_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S259-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093914_LHBs_P-C Product feature CHAIN EU093914_LHBs_P-C of FT:mat_peptide EU093914_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S259-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSAPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSIHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093915_LHBs_P-C Product feature CHAIN EU093915_LHBs_P-C of FT:mat_peptide EU093915_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S259-12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWYSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWERASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093916_LHBs_P-C Product feature CHAIN EU093916_LHBs_P-C of FT:mat_peptide EU093916_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093917_LHBs_P-C Product feature CHAIN EU093917_LHBs_P-C of FT:mat_peptide EU093917_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGTGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILGPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093918_LHBs_P-C Product feature CHAIN EU093918_LHBs_P-C of FT:mat_peptide EU093918_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU305540_LHBs_P-C Product feature CHAIN EU305540_LHBs_P-C of FT:mat_peptide EU305540_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-123). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGRSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTTSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU305541_LHBs_P-C Product feature CHAIN EU305541_LHBs_P-C of FT:mat_peptide EU305541_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-190). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPLSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306673_LHBs_P-C Product feature CHAIN EU306673_LHBs_P-C of FT:mat_peptide EU306673_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLGPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCPRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306674_LHBs_P-C Product feature CHAIN EU306674_LHBs_P-C of FT:mat_peptide EU306674_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLGPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVQGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQPPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306675_LHBs_P-C Product feature CHAIN EU306675_LHBs_P-C of FT:mat_peptide EU306675_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVQGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306685_LHBs_P-C Product feature CHAIN EU306685_LHBs_P-C of FT:mat_peptide EU306685_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306687_LHBs_P-C Product feature CHAIN EU306687_LHBs_P-C of FT:mat_peptide EU306687_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306688_LHBs_P-C Product feature CHAIN EU306688_LHBs_P-C of FT:mat_peptide EU306688_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306689_LHBs_P-C Product feature CHAIN EU306689_LHBs_P-C of FT:mat_peptide EU306689_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306690_LHBs_P-C Product feature CHAIN EU306690_LHBs_P-C of FT:mat_peptide EU306690_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESATSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306691_LHBs_P-C Product feature CHAIN EU306691_LHBs_P-C of FT:mat_peptide EU306691_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFSPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPISCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306694_LHBs_P-C Product feature CHAIN EU306694_LHBs_P-C of FT:mat_peptide EU306694_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306719_LHBs_P-C Product feature CHAIN EU306719_LHBs_P-C of FT:mat_peptide EU306719_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLSVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306720_LHBs_P-C Product feature CHAIN EU306720_LHBs_P-C of FT:mat_peptide EU306720_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSRSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306721_LHBs_P-C Product feature CHAIN EU306721_LHBs_P-C of FT:mat_peptide EU306721_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGSCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306726_LHBs_P-C Product feature CHAIN EU306726_LHBs_P-C of FT:mat_peptide EU306726_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306728_LHBs_P-C Product feature CHAIN EU306728_LHBs_P-C of FT:mat_peptide EU306728_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU410079_LHBs_P-C Product feature CHAIN EU410079_LHBs_P-C of FT:mat_peptide EU410079_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph109). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRLRTPISPPIRDTHPQAXQWNSTTFHQALLDPRVRGLXFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU410080_LHBs_P-C Product feature CHAIN EU410080_LHBs_P-C of FT:mat_peptide EU410080_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph76). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU410081_LHBs_P-C Product feature CHAIN EU410081_LHBs_P-C of FT:mat_peptide EU410081_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph80). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU439015_LHBs_P-C Product feature CHAIN EU439015_LHBs_P-C of FT:mat_peptide EU439015_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAKQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU498227_LHBs_P-C Product feature CHAIN EU498227_LHBs_P-C of FT:mat_peptide EU498227_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JL). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPP
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHKALLDPRVRGPYFPAGGSSSGTVNPVPTTASP
ISSIFSMTGDPAPNMESTTSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTTTTSRGPCRTCTTPAQGTSMFPSCCCTKLSDAN
CTCIPIPTSGAFAKFLWGSASVRFSWLNSLVPFVQWFEELSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU522068_LHBs_P-C Product feature CHAIN EU522068_LHBs_P-C of FT:mat_peptide EU522068_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5N). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVAVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDSRGMLRVCPLLPGTSTTSTGPCKTCTIPAQGTSMYPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU547562_LHBs_P-C Product feature CHAIN EU547562_LHBs_P-C of FT:mat_peptide EU547562_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MC05). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGRSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRXFIIFLFILLLCLIFLLVLVDXQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554535_LHBs_P-C Product feature CHAIN EU554535_LHBs_P-C of FT:mat_peptide EU554535_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-20). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDGHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGASMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554536_LHBs_P-C Product feature CHAIN EU554536_LHBs_P-C of FT:mat_peptide EU554536_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-24). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGASTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWAPVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554537_LHBs_P-C Product feature CHAIN EU554537_LHBs_P-C of FT:mat_peptide EU554537_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPRAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCRTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554538_LHBs_P-C Product feature CHAIN EU554538_LHBs_P-C of FT:mat_peptide EU554538_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-15). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554539_LHBs_P-C Product feature CHAIN EU554539_LHBs_P-C of FT:mat_peptide EU554539_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-21). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554540_LHBs_P-C Product feature CHAIN EU554540_LHBs_P-C of FT:mat_peptide EU554540_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S304-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554541_LHBs_P-C Product feature CHAIN EU554541_LHBs_P-C of FT:mat_peptide EU554541_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVTPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWPSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|EU554542_LHBs_P-C Product feature CHAIN EU554542_LHBs_P-C of FT:mat_peptide EU554542_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|EU560438_LHBs_P-C Product feature CHAIN EU560438_LHBs_P-C of FT:mat_peptide EU560438_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2-B74). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENAASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVTPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU560439_LHBs_P-C Product feature CHAIN EU560439_LHBs_P-C of FT:mat_peptide EU560439_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-B74). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQAGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU560440_LHBs_P-C Product feature CHAIN EU560440_LHBs_P-C of FT:mat_peptide EU560440_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-S869). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU560441_LHBs_P-C Product feature CHAIN EU560441_LHBs_P-C of FT:mat_peptide EU560441_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4-S869). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|EU562215_LHBs_P-C Product feature CHAIN EU562215_LHBs_P-C of FT:mat_peptide EU562215_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTYTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU562217_LHBs_P-C Product feature CHAIN EU562217_LHBs_P-C of FT:mat_peptide EU562217_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU562218_LHBs_P-C Product feature CHAIN EU562218_LHBs_P-C of FT:mat_peptide EU562218_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570067_LHBs_P-C Product feature CHAIN EU570067_LHBs_P-C of FT:mat_peptide EU570067_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18-S541). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGCRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGD
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU570068_LHBs_P-C Product feature CHAIN EU570068_LHBs_P-C of FT:mat_peptide EU570068_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26-S541). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVEAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQALQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570072_LHBs_P-C Product feature CHAIN EU570072_LHBs_P-C of FT:mat_peptide EU570072_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-B74). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPSPASTNRQSGRQPTPISPPLRDSHPQATQWTSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSSHSPTSCP
PICPGYRWICLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPLSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570073_LHBs_P-C Product feature CHAIN EU570073_LHBs_P-C of FT:mat_peptide EU570073_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8-S698). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLTVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGKLTKAPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASP
ISSIFSRTGDPATNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCIKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570074_LHBs_P-C Product feature CHAIN EU570074_LHBs_P-C of FT:mat_peptide EU570074_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11-S698). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLTVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGKLTKVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASP
ISSIFSRTGDPATNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCIKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU579442_LHBs_P-C Product feature CHAIN EU579442_LHBs_P-C of FT:mat_peptide EU579442_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|EU579443_LHBs_P-C Product feature CHAIN EU579443_LHBs_P-C of FT:mat_peptide EU579443_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU589336_LHBs_P-C Product feature CHAIN EU589336_LHBs_P-C of FT:mat_peptide EU589336_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1175-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVTPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSIFSRTGDPVPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|EU670263_LHBs_P-C Product feature CHAIN EU670263_LHBs_P-C of FT:mat_peptide EU670263_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph105). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDHWPEAWQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSTFSRTGDPALNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPMCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU717212_LHBs_P-C Product feature CHAIN EU717212_LHBs_P-C of FT:mat_peptide EU717212_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D26K-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFLDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU796069_LHBs_P-C Product feature CHAIN EU796069_LHBs_P-C of FT:mat_peptide EU796069_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMETNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGTGAFGPGFTPPHGGVLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGPYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFASFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU796070_LHBs_P-C Product feature CHAIN EU796070_LHBs_P-C of FT:mat_peptide EU796070_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU796072_LHBs_P-C Product feature CHAIN EU796072_LHBs_P-C of FT:mat_peptide EU796072_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871969_LHBs_P-C Product feature CHAIN EU871969_LHBs_P-C of FT:mat_peptide EU871969_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGVTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871970_LHBs_P-C Product feature CHAIN EU871970_LHBs_P-C of FT:mat_peptide EU871970_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGGSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLHPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871971_LHBs_P-C Product feature CHAIN EU871971_LHBs_P-C of FT:mat_peptide EU871971_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLCFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFCCLWVYI
>gnl|hbvpro|EU871972_LHBs_P-C Product feature CHAIN EU871972_LHBs_P-C of FT:mat_peptide EU871972_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGGSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLALFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871973_LHBs_P-C Product feature CHAIN EU871973_LHBs_P-C of FT:mat_peptide EU871973_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-99-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGRSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871974_LHBs_P-C Product feature CHAIN EU871974_LHBs_P-C of FT:mat_peptide EU871974_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANANNPDWDVNPNKDHWPEANQVGAGAFGPGVNPPHSGLLGWSPQ
AQGILTTVPVAAPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGRLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871975_LHBs_P-C Product feature CHAIN EU871975_LHBs_P-C of FT:mat_peptide EU871975_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLMGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871976_LHBs_P-C Product feature CHAIN EU871976_LHBs_P-C of FT:mat_peptide EU871976_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-04-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSLAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871977_LHBs_P-C Product feature CHAIN EU871977_LHBs_P-C of FT:mat_peptide EU871977_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871978_LHBs_P-C Product feature CHAIN EU871978_LHBs_P-C of FT:mat_peptide EU871978_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-2). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQTGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871979_LHBs_P-C Product feature CHAIN EU871979_LHBs_P-C of FT:mat_peptide EU871979_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-4). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDRWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSRTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871980_LHBs_P-C Product feature CHAIN EU871980_LHBs_P-C of FT:mat_peptide EU871980_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-01-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWNPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFHAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871982_LHBs_P-C Product feature CHAIN EU871982_LHBs_P-C of FT:mat_peptide EU871982_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-96-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871998_LHBs_P-C Product feature CHAIN EU871998_LHBs_P-C of FT:mat_peptide EU871998_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-00-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWNPQ
ARGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFHAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872000_LHBs_P-C Product feature CHAIN EU872000_LHBs_P-C of FT:mat_peptide EU872000_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGATSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQDMLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTIWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872001_LHBs_P-C Product feature CHAIN EU872001_LHBs_P-C of FT:mat_peptide EU872001_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872002_LHBs_P-C Product feature CHAIN EU872002_LHBs_P-C of FT:mat_peptide EU872002_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVCI
>gnl|hbvpro|EU872003_LHBs_P-C Product feature CHAIN EU872003_LHBs_P-C of FT:mat_peptide EU872003_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872004_LHBs_P-C Product feature CHAIN EU872004_LHBs_P-C of FT:mat_peptide EU872004_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872012_LHBs_P-C Product feature CHAIN EU872012_LHBs_P-C of FT:mat_peptide EU872012_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-99-5). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=395 residues).
IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIF
SRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLLGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU881996_LHBs_P-C Product feature CHAIN EU881996_LHBs_P-C of FT:mat_peptide EU881996_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDPWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGTCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|EU882005_LHBs_P-C Product feature CHAIN EU882005_LHBs_P-C of FT:mat_peptide EU882005_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient22). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
TQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916210_LHBs_P-C Product feature CHAIN EU916210_LHBs_P-C of FT:mat_peptide EU916210_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2.4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPALGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916219_LHBs_P-C Product feature CHAIN EU916219_LHBs_P-C of FT:mat_peptide EU916219_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKICTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916222_LHBs_P-C Product feature CHAIN EU916222_LHBs_P-C of FT:mat_peptide EU916222_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRAGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916223_LHBs_P-C Product feature CHAIN EU916223_LHBs_P-C of FT:mat_peptide EU916223_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916224_LHBs_P-C Product feature CHAIN EU916224_LHBs_P-C of FT:mat_peptide EU916224_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916225_LHBs_P-C Product feature CHAIN EU916225_LHBs_P-C of FT:mat_peptide EU916225_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWERASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSPYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916233_LHBs_P-C Product feature CHAIN EU916233_LHBs_P-C of FT:mat_peptide EU916233_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNRSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916234_LHBs_P-C Product feature CHAIN EU916234_LHBs_P-C of FT:mat_peptide EU916234_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.2). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTAASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPRKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916237_LHBs_P-C Product feature CHAIN EU916237_LHBs_P-C of FT:mat_peptide EU916237_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSCSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916238_LHBs_P-C Product feature CHAIN EU916238_LHBs_P-C of FT:mat_peptide EU916238_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU919168_LHBs_P-C Product feature CHAIN EU919168_LHBs_P-C of FT:mat_peptide EU919168_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDRN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU919169_LHBs_P-C Product feature CHAIN EU919169_LHBs_P-C of FT:mat_peptide EU919169_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPVPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTATTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|EU939536_LHBs_P-C Product feature CHAIN EU939536_LHBs_P-C of FT:mat_peptide EU939536_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHLPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939538_LHBs_P-C Product feature CHAIN EU939538_LHBs_P-C of FT:mat_peptide EU939538_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939539_LHBs_P-C Product feature CHAIN EU939539_LHBs_P-C of FT:mat_peptide EU939539_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C22). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGRSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|EU939540_LHBs_P-C Product feature CHAIN EU939540_LHBs_P-C of FT:mat_peptide EU939540_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C24). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939542_LHBs_P-C Product feature CHAIN EU939542_LHBs_P-C of FT:mat_peptide EU939542_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGVTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVSI
>gnl|hbvpro|EU939543_LHBs_P-C Product feature CHAIN EU939543_LHBs_P-C of FT:mat_peptide EU939543_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C38). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPTVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939544_LHBs_P-C Product feature CHAIN EU939544_LHBs_P-C of FT:mat_peptide EU939544_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C39). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPESNQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYT
>gnl|hbvpro|EU939545_LHBs_P-C Product feature CHAIN EU939545_LHBs_P-C of FT:mat_peptide EU939545_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C41). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939546_LHBs_P-C Product feature CHAIN EU939546_LHBs_P-C of FT:mat_peptide EU939546_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C44). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939548_LHBs_P-C Product feature CHAIN EU939548_LHBs_P-C of FT:mat_peptide EU939548_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C46). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939550_LHBs_P-C Product feature CHAIN EU939550_LHBs_P-C of FT:mat_peptide EU939550_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C55). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNPNKDHWPEAHQVGTGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939561_LHBs_P-C Product feature CHAIN EU939561_LHBs_P-C of FT:mat_peptide EU939561_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C70). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPVGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939562_LHBs_P-C Product feature CHAIN EU939562_LHBs_P-C of FT:mat_peptide EU939562_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C75). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939563_LHBs_P-C Product feature CHAIN EU939563_LHBs_P-C of FT:mat_peptide EU939563_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLXIFFCLWVYI
>gnl|hbvpro|EU939564_LHBs_P-C Product feature CHAIN EU939564_LHBs_P-C of FT:mat_peptide EU939564_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C77). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRVSHPQAVKWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTPASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939566_LHBs_P-C Product feature CHAIN EU939566_LHBs_P-C of FT:mat_peptide EU939566_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C88). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939567_LHBs_P-C Product feature CHAIN EU939567_LHBs_P-C of FT:mat_peptide EU939567_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C91). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGRSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939568_LHBs_P-C Product feature CHAIN EU939568_LHBs_P-C of FT:mat_peptide EU939568_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C93). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGXSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPKKDQWPEANQVGVGAFGPRFTPPHGGLLGWSPQ
AHGILTTVPTPPPPASTDRQSRRQPTTISPPLRDSHPHAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWICLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939570_LHBs_P-C Product feature CHAIN EU939570_LHBs_P-C of FT:mat_peptide EU939570_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C103). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939571_LHBs_P-C Product feature CHAIN EU939571_LHBs_P-C of FT:mat_peptide EU939571_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C104). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939572_LHBs_P-C Product feature CHAIN EU939572_LHBs_P-C of FT:mat_peptide EU939572_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C105). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939578_LHBs_P-C Product feature CHAIN EU939578_LHBs_P-C of FT:mat_peptide EU939578_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C119). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939579_LHBs_P-C Product feature CHAIN EU939579_LHBs_P-C of FT:mat_peptide EU939579_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPTAPPPASTNRQSGRQPTPISPPLRDTHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939582_LHBs_P-C Product feature CHAIN EU939582_LHBs_P-C of FT:mat_peptide EU939582_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B25). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939585_LHBs_P-C Product feature CHAIN EU939585_LHBs_P-C of FT:mat_peptide EU939585_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B126). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEASQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939586_LHBs_P-C Product feature CHAIN EU939586_LHBs_P-C of FT:mat_peptide EU939586_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B142). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMETNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTVHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939587_LHBs_P-C Product feature CHAIN EU939587_LHBs_P-C of FT:mat_peptide EU939587_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|EU939588_LHBs_P-C Product feature CHAIN EU939588_LHBs_P-C of FT:mat_peptide EU939588_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRLSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939590_LHBs_P-C Product feature CHAIN EU939590_LHBs_P-C of FT:mat_peptide EU939590_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939591_LHBs_P-C Product feature CHAIN EU939591_LHBs_P-C of FT:mat_peptide EU939591_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C131). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939592_LHBs_P-C Product feature CHAIN EU939592_LHBs_P-C of FT:mat_peptide EU939592_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C141). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGTPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939593_LHBs_P-C Product feature CHAIN EU939593_LHBs_P-C of FT:mat_peptide EU939593_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C144). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939594_LHBs_P-C Product feature CHAIN EU939594_LHBs_P-C of FT:mat_peptide EU939594_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C146). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGLTPPHGGLLGWSPQ
AQGILTTMPEAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSPTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939595_LHBs_P-C Product feature CHAIN EU939595_LHBs_P-C of FT:mat_peptide EU939595_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C147). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGSSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPIAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939596_LHBs_P-C Product feature CHAIN EU939596_LHBs_P-C of FT:mat_peptide EU939596_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C149). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTIASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PTCPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939597_LHBs_P-C Product feature CHAIN EU939597_LHBs_P-C of FT:mat_peptide EU939597_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C151). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGSYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939600_LHBs_P-C Product feature CHAIN EU939600_LHBs_P-C of FT:mat_peptide EU939600_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C176). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939601_LHBs_P-C Product feature CHAIN EU939601_LHBs_P-C of FT:mat_peptide EU939601_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C177). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939603_LHBs_P-C Product feature CHAIN EU939603_LHBs_P-C of FT:mat_peptide EU939603_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C183). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSXKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLSTVPVAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLALLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDXN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLXPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939604_LHBs_P-C Product feature CHAIN EU939604_LHBs_P-C of FT:mat_peptide EU939604_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C192). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPDGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939605_LHBs_P-C Product feature CHAIN EU939605_LHBs_P-C of FT:mat_peptide EU939605_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C200). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQASQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939607_LHBs_P-C Product feature CHAIN EU939607_LHBs_P-C of FT:mat_peptide EU939607_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSQTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWAFI
>gnl|hbvpro|EU939609_LHBs_P-C Product feature CHAIN EU939609_LHBs_P-C of FT:mat_peptide EU939609_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C209). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPHWDFNPNKDPWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPSASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939610_LHBs_P-C Product feature CHAIN EU939610_LHBs_P-C of FT:mat_peptide EU939610_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C211). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPGANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939611_LHBs_P-C Product feature CHAIN EU939611_LHBs_P-C of FT:mat_peptide EU939611_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C212). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939612_LHBs_P-C Product feature CHAIN EU939612_LHBs_P-C of FT:mat_peptide EU939612_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C213). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939613_LHBs_P-C Product feature CHAIN EU939613_LHBs_P-C of FT:mat_peptide EU939613_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C214). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939614_LHBs_P-C Product feature CHAIN EU939614_LHBs_P-C of FT:mat_peptide EU939614_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C217). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939615_LHBs_P-C Product feature CHAIN EU939615_LHBs_P-C of FT:mat_peptide EU939615_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939616_LHBs_P-C Product feature CHAIN EU939616_LHBs_P-C of FT:mat_peptide EU939616_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C228). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRRGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939617_LHBs_P-C Product feature CHAIN EU939617_LHBs_P-C of FT:mat_peptide EU939617_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C229). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939618_LHBs_P-C Product feature CHAIN EU939618_LHBs_P-C of FT:mat_peptide EU939618_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C230). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVVTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939619_LHBs_P-C Product feature CHAIN EU939619_LHBs_P-C of FT:mat_peptide EU939619_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C233). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSRSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939625_LHBs_P-C Product feature CHAIN EU939625_LHBs_P-C of FT:mat_peptide EU939625_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C167). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPVPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|EU939626_LHBs_P-C Product feature CHAIN EU939626_LHBs_P-C of FT:mat_peptide EU939626_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D158). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPXFFCLWVYI
>gnl|hbvpro|EU939640_LHBs_P-C Product feature CHAIN EU939640_LHBs_P-C of FT:mat_peptide EU939640_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C239). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTXNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939644_LHBs_P-C Product feature CHAIN EU939644_LHBs_P-C of FT:mat_peptide EU939644_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D36). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGDLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEVPKCPGQNSQSPTFNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939647_LHBs_P-C Product feature CHAIN EU939647_LHBs_P-C of FT:mat_peptide EU939647_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D90). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQAGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
ISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGLNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939648_LHBs_P-C Product feature CHAIN EU939648_LHBs_P-C of FT:mat_peptide EU939648_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D96). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPALNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939649_LHBs_P-C Product feature CHAIN EU939649_LHBs_P-C of FT:mat_peptide EU939649_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D98). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSITFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939651_LHBs_P-C Product feature CHAIN EU939651_LHBs_P-C of FT:mat_peptide EU939651_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D104). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGTGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPACPGQNSQSPTSNHLPTSCP
PTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939652_LHBs_P-C Product feature CHAIN EU939652_LHBs_P-C of FT:mat_peptide EU939652_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D107). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939653_LHBs_P-C Product feature CHAIN EU939653_LHBs_P-C of FT:mat_peptide EU939653_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D109). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGMGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939654_LHBs_P-C Product feature CHAIN EU939654_LHBs_P-C of FT:mat_peptide EU939654_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D115). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPKKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939655_LHBs_P-C Product feature CHAIN EU939655_LHBs_P-C of FT:mat_peptide EU939655_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D116). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939656_LHBs_P-C Product feature CHAIN EU939656_LHBs_P-C of FT:mat_peptide EU939656_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D117). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939657_LHBs_P-C Product feature CHAIN EU939657_LHBs_P-C of FT:mat_peptide EU939657_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D139). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNTLRPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939659_LHBs_P-C Product feature CHAIN EU939659_LHBs_P-C of FT:mat_peptide EU939659_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D165). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQTGRQPTPISPPLRDSHPQAVQWTSTTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGAPRCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023639_LHBs_P-C Product feature CHAIN FJ023639_LHBs_P-C of FT:mat_peptide FJ023639_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-0968). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGXFGPGFTPPHGNLLGWSPQ
AQGIXTTXPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIXSRTGDPAPNMESTTSGFLGPLLVLXEGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023641_LHBs_P-C Product feature CHAIN FJ023641_LHBs_P-C of FT:mat_peptide FJ023641_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1237). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023642_LHBs_P-C Product feature CHAIN FJ023642_LHBs_P-C of FT:mat_peptide FJ023642_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1257). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023643_LHBs_P-C Product feature CHAIN FJ023643_LHBs_P-C of FT:mat_peptide FJ023643_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1306). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023644_LHBs_P-C Product feature CHAIN FJ023644_LHBs_P-C of FT:mat_peptide FJ023644_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1318). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023645_LHBs_P-C Product feature CHAIN FJ023645_LHBs_P-C of FT:mat_peptide FJ023645_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0071). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPKKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSRRRPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTLNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDFHGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ023646_LHBs_P-C Product feature CHAIN FJ023646_LHBs_P-C of FT:mat_peptide FJ023646_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0201). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRXGMGTNLXVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGTLTTLPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023647_LHBs_P-C Product feature CHAIN FJ023647_LHBs_P-C of FT:mat_peptide FJ023647_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0214). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023648_LHBs_P-C Product feature CHAIN FJ023648_LHBs_P-C of FT:mat_peptide FJ023648_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0273). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGXLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIKWNSSTFHQALLDPRVRGLYIPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023649_LHBs_P-C Product feature CHAIN FJ023649_LHBs_P-C of FT:mat_peptide FJ023649_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0289). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023650_LHBs_P-C Product feature CHAIN FJ023650_LHBs_P-C of FT:mat_peptide FJ023650_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0341). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSAKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023653_LHBs_P-C Product feature CHAIN FJ023653_LHBs_P-C of FT:mat_peptide FJ023653_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0909). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023654_LHBs_P-C Product feature CHAIN FJ023654_LHBs_P-C of FT:mat_peptide FJ023654_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1412). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023656_LHBs_P-C Product feature CHAIN FJ023656_LHBs_P-C of FT:mat_peptide FJ023656_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0938). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDPWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023657_LHBs_P-C Product feature CHAIN FJ023657_LHBs_P-C of FT:mat_peptide FJ023657_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0987). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023658_LHBs_P-C Product feature CHAIN FJ023658_LHBs_P-C of FT:mat_peptide FJ023658_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-1116). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSIPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032331_LHBs_P-C Product feature CHAIN FJ032331_LHBs_P-C of FT:mat_peptide FJ032331_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S193-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032333_LHBs_P-C Product feature CHAIN FJ032333_LHBs_P-C of FT:mat_peptide FJ032333_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359-7). Complete genome. [Hepadnaviridae] (length=395 residues).
IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIF
SRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032334_LHBs_P-C Product feature CHAIN FJ032334_LHBs_P-C of FT:mat_peptide FJ032334_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S445-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032336_LHBs_P-C Product feature CHAIN FJ032336_LHBs_P-C of FT:mat_peptide FJ032336_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTSTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWPSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032338_LHBs_P-C Product feature CHAIN FJ032338_LHBs_P-C of FT:mat_peptide FJ032338_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032339_LHBs_P-C Product feature CHAIN FJ032339_LHBs_P-C of FT:mat_peptide FJ032339_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032340_LHBs_P-C Product feature CHAIN FJ032340_LHBs_P-C of FT:mat_peptide FJ032340_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVHI
>gnl|hbvpro|FJ032341_LHBs_P-C Product feature CHAIN FJ032341_LHBs_P-C of FT:mat_peptide FJ032341_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032345_LHBs_P-C Product feature CHAIN FJ032345_LHBs_P-C of FT:mat_peptide FJ032345_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISPIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|FJ032346_LHBs_P-C Product feature CHAIN FJ032346_LHBs_P-C of FT:mat_peptide FJ032346_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVHLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCIKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032350_LHBs_P-C Product feature CHAIN FJ032350_LHBs_P-C of FT:mat_peptide FJ032350_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGSTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPYKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVMWMMWYWGPSLYNILSPFLPLLPIFWCLWVYI
>gnl|hbvpro|FJ032351_LHBs_P-C Product feature CHAIN FJ032351_LHBs_P-C of FT:mat_peptide FJ032351_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWASARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFWCLWAYI
>gnl|hbvpro|FJ032355_LHBs_P-C Product feature CHAIN FJ032355_LHBs_P-C of FT:mat_peptide FJ032355_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPVANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPALNMENTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032356_LHBs_P-C Product feature CHAIN FJ032356_LHBs_P-C of FT:mat_peptide FJ032356_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPVANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQALLDPRVRGLHFPAGGSGSGTVNPVPTTASP
ISSIFSRTGDPALNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032359_LHBs_P-C Product feature CHAIN FJ032359_LHBs_P-C of FT:mat_peptide FJ032359_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032361_LHBs_P-C Product feature CHAIN FJ032361_LHBs_P-C of FT:mat_peptide FJ032361_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFASFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349225_LHBs_P-C Product feature CHAIN FJ349225_LHBs_P-C of FT:mat_peptide FJ349225_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H94). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386574_LHBs_P-C Product feature CHAIN FJ386574_LHBs_P-C of FT:mat_peptide FJ386574_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1743). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386575_LHBs_P-C Product feature CHAIN FJ386575_LHBs_P-C of FT:mat_peptide FJ386575_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1745). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386576_LHBs_P-C Product feature CHAIN FJ386576_LHBs_P-C of FT:mat_peptide FJ386576_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1746). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386577_LHBs_P-C Product feature CHAIN FJ386577_LHBs_P-C of FT:mat_peptide FJ386577_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1747). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386579_LHBs_P-C Product feature CHAIN FJ386579_LHBs_P-C of FT:mat_peptide FJ386579_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1762). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386587_LHBs_P-C Product feature CHAIN FJ386587_LHBs_P-C of FT:mat_peptide FJ386587_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1812). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386588_LHBs_P-C Product feature CHAIN FJ386588_LHBs_P-C of FT:mat_peptide FJ386588_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1828). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386589_LHBs_P-C Product feature CHAIN FJ386589_LHBs_P-C of FT:mat_peptide FJ386589_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1830). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
APGILTSVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCP
PTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386591_LHBs_P-C Product feature CHAIN FJ386591_LHBs_P-C of FT:mat_peptide FJ386591_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1869). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386592_LHBs_P-C Product feature CHAIN FJ386592_LHBs_P-C of FT:mat_peptide FJ386592_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1870). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGSSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLXPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACLGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386594_LHBs_P-C Product feature CHAIN FJ386594_LHBs_P-C of FT:mat_peptide FJ386594_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1878). Non-functional genomic sequence. [Hepadnaviridae] (length=395 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVPAGGSSSGTVNPVPTTASPISSIF
SRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386595_LHBs_P-C Product feature CHAIN FJ386595_LHBs_P-C of FT:mat_peptide FJ386595_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1879). Complete genome. [Hepadnaviridae] (length=400 residues).
LGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGTFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386596_LHBs_P-C Product feature CHAIN FJ386596_LHBs_P-C of FT:mat_peptide FJ386596_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1887). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386597_LHBs_P-C Product feature CHAIN FJ386597_LHBs_P-C of FT:mat_peptide FJ386597_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1888). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386598_LHBs_P-C Product feature CHAIN FJ386598_LHBs_P-C of FT:mat_peptide FJ386598_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1889). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
QICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386601_LHBs_P-C Product feature CHAIN FJ386601_LHBs_P-C of FT:mat_peptide FJ386601_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1912). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANHVGAGAFGPGFTPPHGGLLGGSPH
AQGILTTMPISPPPASTNRQARRRTTPISPPLIDSHPQAIQWNSATFHQALLDPRVRGLYFPAGGSFSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386602_LHBs_P-C Product feature CHAIN FJ386602_LHBs_P-C of FT:mat_peptide FJ386602_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1914). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGSSPQ
AQGILTTVSTAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLALQAGLFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386603_LHBs_P-C Product feature CHAIN FJ386603_LHBs_P-C of FT:mat_peptide FJ386603_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1949). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHHSLLDPRVRGLYFAAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386604_LHBs_P-C Product feature CHAIN FJ386604_LHBs_P-C of FT:mat_peptide FJ386604_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1950). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSLAFARFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386605_LHBs_P-C Product feature CHAIN FJ386605_LHBs_P-C of FT:mat_peptide FJ386605_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1965). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRESHPHAMQWNSTTFHQALLDPXVRGLYFPAGGSSSGTXNPVPTTASP
ISSIFSRTGDPALNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386607_LHBs_P-C Product feature CHAIN FJ386607_LHBs_P-C of FT:mat_peptide FJ386607_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1967). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386609_LHBs_P-C Product feature CHAIN FJ386609_LHBs_P-C of FT:mat_peptide FJ386609_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1999). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386611_LHBs_P-C Product feature CHAIN FJ386611_LHBs_P-C of FT:mat_peptide FJ386611_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2018). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGALTCPGRNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386612_LHBs_P-C Product feature CHAIN FJ386612_LHBs_P-C of FT:mat_peptide FJ386612_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2019). Complete genome. [Hepadnaviridae] (length=397 residues).
RSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQG
ILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPTSS
IFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPIC
PGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGNCTC
IPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|FJ386613_LHBs_P-C Product feature CHAIN FJ386613_LHBs_P-C of FT:mat_peptide FJ386613_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2039). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386614_LHBs_P-C Product feature CHAIN FJ386614_LHBs_P-C of FT:mat_peptide FJ386614_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2040). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGNLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386618_LHBs_P-C Product feature CHAIN FJ386618_LHBs_P-C of FT:mat_peptide FJ386618_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2111). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386619_LHBs_P-C Product feature CHAIN FJ386619_LHBs_P-C of FT:mat_peptide FJ386619_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2119). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386620_LHBs_P-C Product feature CHAIN FJ386620_LHBs_P-C of FT:mat_peptide FJ386620_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2121). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGILGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386623_LHBs_P-C Product feature CHAIN FJ386623_LHBs_P-C of FT:mat_peptide FJ386623_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2165). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386624_LHBs_P-C Product feature CHAIN FJ386624_LHBs_P-C of FT:mat_peptide FJ386624_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2187). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCLGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386625_LHBs_P-C Product feature CHAIN FJ386625_LHBs_P-C of FT:mat_peptide FJ386625_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2190). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFARTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386626_LHBs_P-C Product feature CHAIN FJ386626_LHBs_P-C of FT:mat_peptide FJ386626_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2205). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRLGTGTNLSVPHPLGFFHDLDSDPAFGANSNNPDWDFNPNKDHWAEAEQVGAGAFGPGFTLPRSSLLGWSPQ
AQGTLTPPAAAPPPASRKPPSGSPPTLISLPLRDSHPNAIHCHSTLFHQVLRDPLVAGGYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILQLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386627_LHBs_P-C Product feature CHAIN FJ386627_LHBs_P-C of FT:mat_peptide FJ386627_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2242). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWFSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386630_LHBs_P-C Product feature CHAIN FJ386630_LHBs_P-C of FT:mat_peptide FJ386630_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2336). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTXSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGASMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386631_LHBs_P-C Product feature CHAIN FJ386631_LHBs_P-C of FT:mat_peptide FJ386631_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2359). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPH
AQGILTTVPPAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386632_LHBs_P-C Product feature CHAIN FJ386632_LHBs_P-C of FT:mat_peptide FJ386632_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2370). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGXFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386639_LHBs_P-C Product feature CHAIN FJ386639_LHBs_P-C of FT:mat_peptide FJ386639_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1929). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386644_LHBs_P-C Product feature CHAIN FJ386644_LHBs_P-C of FT:mat_peptide FJ386644_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S737). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANYPGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386647_LHBs_P-C Product feature CHAIN FJ386647_LHBs_P-C of FT:mat_peptide FJ386647_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2400). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPAGGSSSGTANPVPTTASP
TSSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFQWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386652_LHBs_P-C Product feature CHAIN FJ386652_LHBs_P-C of FT:mat_peptide FJ386652_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2518). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386653_LHBs_P-C Product feature CHAIN FJ386653_LHBs_P-C of FT:mat_peptide FJ386653_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FJ386657_LHBs_P-C Product feature CHAIN FJ386657_LHBs_P-C of FT:mat_peptide FJ386657_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S165). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386659_LHBs_P-C Product feature CHAIN FJ386659_LHBs_P-C of FT:mat_peptide FJ386659_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S219). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386661_LHBs_P-C Product feature CHAIN FJ386661_LHBs_P-C of FT:mat_peptide FJ386661_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S251). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|FJ386662_LHBs_P-C Product feature CHAIN FJ386662_LHBs_P-C of FT:mat_peptide FJ386662_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S269). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386664_LHBs_P-C Product feature CHAIN FJ386664_LHBs_P-C of FT:mat_peptide FJ386664_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S310). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386665_LHBs_P-C Product feature CHAIN FJ386665_LHBs_P-C of FT:mat_peptide FJ386665_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359). Complete genome. [Hepadnaviridae] (length=395 residues).
IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIF
SRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386670_LHBs_P-C Product feature CHAIN FJ386670_LHBs_P-C of FT:mat_peptide FJ386670_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S454). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386671_LHBs_P-C Product feature CHAIN FJ386671_LHBs_P-C of FT:mat_peptide FJ386671_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S586). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPISNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386672_LHBs_P-C Product feature CHAIN FJ386672_LHBs_P-C of FT:mat_peptide FJ386672_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S606). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPQHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ386673_LHBs_P-C Product feature CHAIN FJ386673_LHBs_P-C of FT:mat_peptide FJ386673_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S633). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVSPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSXFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILQLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386678_LHBs_P-C Product feature CHAIN FJ386678_LHBs_P-C of FT:mat_peptide FJ386678_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1147). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386679_LHBs_P-C Product feature CHAIN FJ386679_LHBs_P-C of FT:mat_peptide FJ386679_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1217). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGSSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386685_LHBs_P-C Product feature CHAIN FJ386685_LHBs_P-C of FT:mat_peptide FJ386685_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1568). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386687_LHBs_P-C Product feature CHAIN FJ386687_LHBs_P-C of FT:mat_peptide FJ386687_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1600). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386689_LHBs_P-C Product feature CHAIN FJ386689_LHBs_P-C of FT:mat_peptide FJ386689_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1649). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPKMYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ518813_LHBs_P-C Product feature CHAIN FJ518813_LHBs_P-C of FT:mat_peptide FJ518813_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FJ562218_LHBs_P-C Product feature CHAIN FJ562218_LHBs_P-C of FT:mat_peptide FJ562218_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562221_LHBs_P-C Product feature CHAIN FJ562221_LHBs_P-C of FT:mat_peptide FJ562221_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHLPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562225_LHBs_P-C Product feature CHAIN FJ562225_LHBs_P-C of FT:mat_peptide FJ562225_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562228_LHBs_P-C Product feature CHAIN FJ562228_LHBs_P-C of FT:mat_peptide FJ562228_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I33). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGQYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLSNILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|FJ562230_LHBs_P-C Product feature CHAIN FJ562230_LHBs_P-C of FT:mat_peptide FJ562230_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I38). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562232_LHBs_P-C Product feature CHAIN FJ562232_LHBs_P-C of FT:mat_peptide FJ562232_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I45). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562233_LHBs_P-C Product feature CHAIN FJ562233_LHBs_P-C of FT:mat_peptide FJ562233_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I48). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562235_LHBs_P-C Product feature CHAIN FJ562235_LHBs_P-C of FT:mat_peptide FJ562235_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I50). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562238_LHBs_P-C Product feature CHAIN FJ562238_LHBs_P-C of FT:mat_peptide FJ562238_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I62). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562239_LHBs_P-C Product feature CHAIN FJ562239_LHBs_P-C of FT:mat_peptide FJ562239_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I64). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562241_LHBs_P-C Product feature CHAIN FJ562241_LHBs_P-C of FT:mat_peptide FJ562241_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I67). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSTFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562242_LHBs_P-C Product feature CHAIN FJ562242_LHBs_P-C of FT:mat_peptide FJ562242_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I68). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562243_LHBs_P-C Product feature CHAIN FJ562243_LHBs_P-C of FT:mat_peptide FJ562243_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I71). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQGGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ562244_LHBs_P-C Product feature CHAIN FJ562244_LHBs_P-C of FT:mat_peptide FJ562244_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I72). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562248_LHBs_P-C Product feature CHAIN FJ562248_LHBs_P-C of FT:mat_peptide FJ562248_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I76). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVIPGKFGPGFTPLHDGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562249_LHBs_P-C Product feature CHAIN FJ562249_LHBs_P-C of FT:mat_peptide FJ562249_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I79). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGIMTTVPVAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562250_LHBs_P-C Product feature CHAIN FJ562250_LHBs_P-C of FT:mat_peptide FJ562250_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I83). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562251_LHBs_P-C Product feature CHAIN FJ562251_LHBs_P-C of FT:mat_peptide FJ562251_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I84). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQALQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562252_LHBs_P-C Product feature CHAIN FJ562252_LHBs_P-C of FT:mat_peptide FJ562252_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I85). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562255_LHBs_P-C Product feature CHAIN FJ562255_LHBs_P-C of FT:mat_peptide FJ562255_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I92). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTPVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|FJ562256_LHBs_P-C Product feature CHAIN FJ562256_LHBs_P-C of FT:mat_peptide FJ562256_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I95). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDLAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRSPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVSI
>gnl|hbvpro|FJ562258_LHBs_P-C Product feature CHAIN FJ562258_LHBs_P-C of FT:mat_peptide FJ562258_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I97). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562261_LHBs_P-C Product feature CHAIN FJ562261_LHBs_P-C of FT:mat_peptide FJ562261_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I109). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNDSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|FJ562264_LHBs_P-C Product feature CHAIN FJ562264_LHBs_P-C of FT:mat_peptide FJ562264_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I114). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562265_LHBs_P-C Product feature CHAIN FJ562265_LHBs_P-C of FT:mat_peptide FJ562265_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I116). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTMPVAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562266_LHBs_P-C Product feature CHAIN FJ562266_LHBs_P-C of FT:mat_peptide FJ562266_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I118). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562268_LHBs_P-C Product feature CHAIN FJ562268_LHBs_P-C of FT:mat_peptide FJ562268_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I121). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAYGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHKALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDXAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562269_LHBs_P-C Product feature CHAIN FJ562269_LHBs_P-C of FT:mat_peptide FJ562269_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I122). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPIAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCVRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562272_LHBs_P-C Product feature CHAIN FJ562272_LHBs_P-C of FT:mat_peptide FJ562272_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I125). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562273_LHBs_P-C Product feature CHAIN FJ562273_LHBs_P-C of FT:mat_peptide FJ562273_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I127). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562274_LHBs_P-C Product feature CHAIN FJ562274_LHBs_P-C of FT:mat_peptide FJ562274_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I128). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562275_LHBs_P-C Product feature CHAIN FJ562275_LHBs_P-C of FT:mat_peptide FJ562275_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I129). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562276_LHBs_P-C Product feature CHAIN FJ562276_LHBs_P-C of FT:mat_peptide FJ562276_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I130). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
XSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSSLVPFVQWLVGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562279_LHBs_P-C Product feature CHAIN FJ562279_LHBs_P-C of FT:mat_peptide FJ562279_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I140). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562280_LHBs_P-C Product feature CHAIN FJ562280_LHBs_P-C of FT:mat_peptide FJ562280_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I141). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562281_LHBs_P-C Product feature CHAIN FJ562281_LHBs_P-C of FT:mat_peptide FJ562281_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I143). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWNPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562282_LHBs_P-C Product feature CHAIN FJ562282_LHBs_P-C of FT:mat_peptide FJ562282_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I144). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562283_LHBs_P-C Product feature CHAIN FJ562283_LHBs_P-C of FT:mat_peptide FJ562283_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I145). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562284_LHBs_P-C Product feature CHAIN FJ562284_LHBs_P-C of FT:mat_peptide FJ562284_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I146). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPKKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562285_LHBs_P-C Product feature CHAIN FJ562285_LHBs_P-C of FT:mat_peptide FJ562285_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I147). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562288_LHBs_P-C Product feature CHAIN FJ562288_LHBs_P-C of FT:mat_peptide FJ562288_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I153). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562291_LHBs_P-C Product feature CHAIN FJ562291_LHBs_P-C of FT:mat_peptide FJ562291_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I163). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562292_LHBs_P-C Product feature CHAIN FJ562292_LHBs_P-C of FT:mat_peptide FJ562292_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I164). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNPTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWIYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPVQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562293_LHBs_P-C Product feature CHAIN FJ562293_LHBs_P-C of FT:mat_peptide FJ562293_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I167). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562298_LHBs_P-C Product feature CHAIN FJ562298_LHBs_P-C of FT:mat_peptide FJ562298_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I174). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
TQGILTTVPAAPPPATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562299_LHBs_P-C Product feature CHAIN FJ562299_LHBs_P-C of FT:mat_peptide FJ562299_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I175). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRKPTPISPPLRDSHPQAMQWNSTTFHQALIHAGVRGLYFPAGGSTSGTAKPAPTTATA
ISAIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562300_LHBs_P-C Product feature CHAIN FJ562300_LHBs_P-C of FT:mat_peptide FJ562300_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I182). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562301_LHBs_P-C Product feature CHAIN FJ562301_LHBs_P-C of FT:mat_peptide FJ562301_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I185). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562304_LHBs_P-C Product feature CHAIN FJ562304_LHBs_P-C of FT:mat_peptide FJ562304_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I190). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562306_LHBs_P-C Product feature CHAIN FJ562306_LHBs_P-C of FT:mat_peptide FJ562306_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I196). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562307_LHBs_P-C Product feature CHAIN FJ562307_LHBs_P-C of FT:mat_peptide FJ562307_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I197). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562308_LHBs_P-C Product feature CHAIN FJ562308_LHBs_P-C of FT:mat_peptide FJ562308_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I199). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPXLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562310_LHBs_P-C Product feature CHAIN FJ562310_LHBs_P-C of FT:mat_peptide FJ562310_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I201). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNFTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCSGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562313_LHBs_P-C Product feature CHAIN FJ562313_LHBs_P-C of FT:mat_peptide FJ562313_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I204). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPLQGTGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILQLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562315_LHBs_P-C Product feature CHAIN FJ562315_LHBs_P-C of FT:mat_peptide FJ562315_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I207). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562318_LHBs_P-C Product feature CHAIN FJ562318_LHBs_P-C of FT:mat_peptide FJ562318_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I211). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562319_LHBs_P-C Product feature CHAIN FJ562319_LHBs_P-C of FT:mat_peptide FJ562319_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I212). Complete genome. [Hepadnaviridae] (length=400 residues).
MRXWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSKTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562320_LHBs_P-C Product feature CHAIN FJ562320_LHBs_P-C of FT:mat_peptide FJ562320_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I213). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPXVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPYVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562323_LHBs_P-C Product feature CHAIN FJ562323_LHBs_P-C of FT:mat_peptide FJ562323_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I217). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562324_LHBs_P-C Product feature CHAIN FJ562324_LHBs_P-C of FT:mat_peptide FJ562324_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I219). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPQANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLKDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562325_LHBs_P-C Product feature CHAIN FJ562325_LHBs_P-C of FT:mat_peptide FJ562325_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I223). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGXLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562327_LHBs_P-C Product feature CHAIN FJ562327_LHBs_P-C of FT:mat_peptide FJ562327_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I228). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562329_LHBs_P-C Product feature CHAIN FJ562329_LHBs_P-C of FT:mat_peptide FJ562329_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I230). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562330_LHBs_P-C Product feature CHAIN FJ562330_LHBs_P-C of FT:mat_peptide FJ562330_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I231). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562332_LHBs_P-C Product feature CHAIN FJ562332_LHBs_P-C of FT:mat_peptide FJ562332_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I42). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPVSPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562333_LHBs_P-C Product feature CHAIN FJ562333_LHBs_P-C of FT:mat_peptide FJ562333_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I78). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562334_LHBs_P-C Product feature CHAIN FJ562334_LHBs_P-C of FT:mat_peptide FJ562334_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I82). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMSLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTNTAQGNSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562335_LHBs_P-C Product feature CHAIN FJ562335_LHBs_P-C of FT:mat_peptide FJ562335_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I108). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTAPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSKHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562337_LHBs_P-C Product feature CHAIN FJ562337_LHBs_P-C of FT:mat_peptide FJ562337_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I173). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562340_LHBs_P-C Product feature CHAIN FJ562340_LHBs_P-C of FT:mat_peptide FJ562340_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I220). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNRTPTSCP
PICPGYRWMCLRRFIIFLFILLLCLISLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQNTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ715342_LHBs_P-C Product feature CHAIN FJ715342_LHBs_P-C of FT:mat_peptide FJ715342_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGIVTTVPVTPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715343_LHBs_P-C Product feature CHAIN FJ715343_LHBs_P-C of FT:mat_peptide FJ715343_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGIVTTVPVTPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSSFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715344_LHBs_P-C Product feature CHAIN FJ715344_LHBs_P-C of FT:mat_peptide FJ715344_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGIVTTVPVTPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISPIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715350_LHBs_P-C Product feature CHAIN FJ715350_LHBs_P-C of FT:mat_peptide FJ715350_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPIPPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715351_LHBs_P-C Product feature CHAIN FJ715351_LHBs_P-C of FT:mat_peptide FJ715351_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSPLGWSPQ
AQGILTTVPAAPPPASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715352_LHBs_P-C Product feature CHAIN FJ715352_LHBs_P-C of FT:mat_peptide FJ715352_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAIKVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715353_LHBs_P-C Product feature CHAIN FJ715353_LHBs_P-C of FT:mat_peptide FJ715353_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715355_LHBs_P-C Product feature CHAIN FJ715355_LHBs_P-C of FT:mat_peptide FJ715355_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFLRTGDPAPNMDNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715357_LHBs_P-C Product feature CHAIN FJ715357_LHBs_P-C of FT:mat_peptide FJ715357_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANPNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPAPTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715358_LHBs_P-C Product feature CHAIN FJ715358_LHBs_P-C of FT:mat_peptide FJ715358_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715359_LHBs_P-C Product feature CHAIN FJ715359_LHBs_P-C of FT:mat_peptide FJ715359_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGAPTCPGQSSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGS
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715360_LHBs_P-C Product feature CHAIN FJ715360_LHBs_P-C of FT:mat_peptide FJ715360_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC62). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPVAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ715364_LHBs_P-C Product feature CHAIN FJ715364_LHBs_P-C of FT:mat_peptide FJ715364_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC72). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGPSMFPSRCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715365_LHBs_P-C Product feature CHAIN FJ715365_LHBs_P-C of FT:mat_peptide FJ715365_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC73). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715366_LHBs_P-C Product feature CHAIN FJ715366_LHBs_P-C of FT:mat_peptide FJ715366_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC74). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715367_LHBs_P-C Product feature CHAIN FJ715367_LHBs_P-C of FT:mat_peptide FJ715367_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC75). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715368_LHBs_P-C Product feature CHAIN FJ715368_LHBs_P-C of FT:mat_peptide FJ715368_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC81). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSPLGWSPQ
AQGILTTVPAAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715370_LHBs_P-C Product feature CHAIN FJ715370_LHBs_P-C of FT:mat_peptide FJ715370_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC83). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPIPPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715371_LHBs_P-C Product feature CHAIN FJ715371_LHBs_P-C of FT:mat_peptide FJ715371_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715372_LHBs_P-C Product feature CHAIN FJ715372_LHBs_P-C of FT:mat_peptide FJ715372_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSITFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
IPSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715374_LHBs_P-C Product feature CHAIN FJ715374_LHBs_P-C of FT:mat_peptide FJ715374_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGITPPHGGLLGWSPQ
AQGILTTVPVVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715375_LHBs_P-C Product feature CHAIN FJ715375_LHBs_P-C of FT:mat_peptide FJ715375_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGITPPHGGLLGWSPQ
AQGILTTVPVVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715376_LHBs_P-C Product feature CHAIN FJ715376_LHBs_P-C of FT:mat_peptide FJ715376_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGITPPHGGLLGWSPQ
AQGILTTVPVVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILGPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715377_LHBs_P-C Product feature CHAIN FJ715377_LHBs_P-C of FT:mat_peptide FJ715377_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPSKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTPCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWRPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715378_LHBs_P-C Product feature CHAIN FJ715378_LHBs_P-C of FT:mat_peptide FJ715378_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715379_LHBs_P-C Product feature CHAIN FJ715379_LHBs_P-C of FT:mat_peptide FJ715379_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDEN
CTCIPIPSSWTIARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715380_LHBs_P-C Product feature CHAIN FJ715380_LHBs_P-C of FT:mat_peptide FJ715380_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715381_LHBs_P-C Product feature CHAIN FJ715381_LHBs_P-C of FT:mat_peptide FJ715381_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVRPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715382_LHBs_P-C Product feature CHAIN FJ715382_LHBs_P-C of FT:mat_peptide FJ715382_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715383_LHBs_P-C Product feature CHAIN FJ715383_LHBs_P-C of FT:mat_peptide FJ715383_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715389_LHBs_P-C Product feature CHAIN FJ715389_LHBs_P-C of FT:mat_peptide FJ715389_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM62). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAIKVGAGAFGPGITPPHGGLLGWSPQ
AQGILTTVPVVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPSQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFIWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715390_LHBs_P-C Product feature CHAIN FJ715390_LHBs_P-C of FT:mat_peptide FJ715390_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM63). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSPLGWSPQ
AQGILTTVPAAPPPASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715391_LHBs_P-C Product feature CHAIN FJ715391_LHBs_P-C of FT:mat_peptide FJ715391_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSPLGWSPQ
AQGILTTVPAAPPPASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715392_LHBs_P-C Product feature CHAIN FJ715392_LHBs_P-C of FT:mat_peptide FJ715392_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM71). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFRPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFARTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715395_LHBs_P-C Product feature CHAIN FJ715395_LHBs_P-C of FT:mat_peptide FJ715395_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM81). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715397_LHBs_P-C Product feature CHAIN FJ715397_LHBs_P-C of FT:mat_peptide FJ715397_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM83). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMETNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFIQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715398_LHBs_P-C Product feature CHAIN FJ715398_LHBs_P-C of FT:mat_peptide FJ715398_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715400_LHBs_P-C Product feature CHAIN FJ715400_LHBs_P-C of FT:mat_peptide FJ715400_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPSPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRCMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715402_LHBs_P-C Product feature CHAIN FJ715402_LHBs_P-C of FT:mat_peptide FJ715402_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
RTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715403_LHBs_P-C Product feature CHAIN FJ715403_LHBs_P-C of FT:mat_peptide FJ715403_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715404_LHBs_P-C Product feature CHAIN FJ715404_LHBs_P-C of FT:mat_peptide FJ715404_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQSILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVFLDYQGMLPVCPLLPGTPTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPPVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715405_LHBs_P-C Product feature CHAIN FJ715405_LHBs_P-C of FT:mat_peptide FJ715405_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLMLQAGFLLLTRVLTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVRPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|FJ715406_LHBs_P-C Product feature CHAIN FJ715406_LHBs_P-C of FT:mat_peptide FJ715406_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLMLQAGFLLLTRVLTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVRPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|FJ715409_LHBs_P-C Product feature CHAIN FJ715409_LHBs_P-C of FT:mat_peptide FJ715409_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQVMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715415_LHBs_P-C Product feature CHAIN FJ715415_LHBs_P-C of FT:mat_peptide FJ715415_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN61). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSPLGWSPQ
AQGILTTVPAAPPPASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPRKTCTSPAQGTSMLPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCYLWVYI
>gnl|hbvpro|FJ715416_LHBs_P-C Product feature CHAIN FJ715416_LHBs_P-C of FT:mat_peptide FJ715416_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN62). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGLTPPHGSLLGWSPQ
AQGILTTVPVAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMLPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCYLWVYI
>gnl|hbvpro|FJ715418_LHBs_P-C Product feature CHAIN FJ715418_LHBs_P-C of FT:mat_peptide FJ715418_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSPLGWSPQ
AQGILTTVPAAPPPASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPASNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVHFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715421_LHBs_P-C Product feature CHAIN FJ715421_LHBs_P-C of FT:mat_peptide FJ715421_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN71). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFLDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVRPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715422_LHBs_P-C Product feature CHAIN FJ715422_LHBs_P-C of FT:mat_peptide FJ715422_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN72). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFARTGGPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787437_LHBs_P-C Product feature CHAIN FJ787437_LHBs_P-C of FT:mat_peptide FJ787437_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S129-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSLAFARFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787439_LHBs_P-C Product feature CHAIN FJ787439_LHBs_P-C of FT:mat_peptide FJ787439_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVTPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787441_LHBs_P-C Product feature CHAIN FJ787441_LHBs_P-C of FT:mat_peptide FJ787441_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVTPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
IPSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSLLSLLVPFVQWFIGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787442_LHBs_P-C Product feature CHAIN FJ787442_LHBs_P-C of FT:mat_peptide FJ787442_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787443_LHBs_P-C Product feature CHAIN FJ787443_LHBs_P-C of FT:mat_peptide FJ787443_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPTDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787445_LHBs_P-C Product feature CHAIN FJ787445_LHBs_P-C of FT:mat_peptide FJ787445_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S425-2). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787447_LHBs_P-C Product feature CHAIN FJ787447_LHBs_P-C of FT:mat_peptide FJ787447_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S461-2). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|FJ787448_LHBs_P-C Product feature CHAIN FJ787448_LHBs_P-C of FT:mat_peptide FJ787448_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S461-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPGVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICLGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCRTKPSDGN
CTCIPIPSFWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|FJ787449_LHBs_P-C Product feature CHAIN FJ787449_LHBs_P-C of FT:mat_peptide FJ787449_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S567-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPSKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTDRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPAGGSSSGTINPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRLIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQRFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|FJ787450_LHBs_P-C Product feature CHAIN FJ787450_LHBs_P-C of FT:mat_peptide FJ787450_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S627-2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNLNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
TSSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVELSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787452_LHBs_P-C Product feature CHAIN FJ787452_LHBs_P-C of FT:mat_peptide FJ787452_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S955-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFYLWAYI
>gnl|hbvpro|FJ787453_LHBs_P-C Product feature CHAIN FJ787453_LHBs_P-C of FT:mat_peptide FJ787453_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDRWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWVWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787454_LHBs_P-C Product feature CHAIN FJ787454_LHBs_P-C of FT:mat_peptide FJ787454_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDRWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWVWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787455_LHBs_P-C Product feature CHAIN FJ787455_LHBs_P-C of FT:mat_peptide FJ787455_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSPLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ787456_LHBs_P-C Product feature CHAIN FJ787456_LHBs_P-C of FT:mat_peptide FJ787456_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ787457_LHBs_P-C Product feature CHAIN FJ787457_LHBs_P-C of FT:mat_peptide FJ787457_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787458_LHBs_P-C Product feature CHAIN FJ787458_LHBs_P-C of FT:mat_peptide FJ787458_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-9). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSSQ
AQGILATVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787464_LHBs_P-C Product feature CHAIN FJ787464_LHBs_P-C of FT:mat_peptide FJ787464_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787465_LHBs_P-C Product feature CHAIN FJ787465_LHBs_P-C of FT:mat_peptide FJ787465_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-5). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787466_LHBs_P-C Product feature CHAIN FJ787466_LHBs_P-C of FT:mat_peptide FJ787466_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPIVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGASMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPLVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787467_LHBs_P-C Product feature CHAIN FJ787467_LHBs_P-C of FT:mat_peptide FJ787467_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-16). Complete genome. [Hepadnaviridae] (length=400 residues).
VGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPIVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTIPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787468_LHBs_P-C Product feature CHAIN FJ787468_LHBs_P-C of FT:mat_peptide FJ787468_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFEANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787469_LHBs_P-C Product feature CHAIN FJ787469_LHBs_P-C of FT:mat_peptide FJ787469_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFEANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787470_LHBs_P-C Product feature CHAIN FJ787470_LHBs_P-C of FT:mat_peptide FJ787470_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSMTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLRLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYV
>gnl|hbvpro|FJ787471_LHBs_P-C Product feature CHAIN FJ787471_LHBs_P-C of FT:mat_peptide FJ787471_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGFLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPACPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787479_LHBs_P-C Product feature CHAIN FJ787479_LHBs_P-C of FT:mat_peptide FJ787479_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVTPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPACPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787486_LHBs_P-C Product feature CHAIN FJ787486_LHBs_P-C of FT:mat_peptide FJ787486_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2235-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|FJ899761_LHBs_P-C Product feature CHAIN FJ899761_LHBs_P-C of FT:mat_peptide FJ899761_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899763_LHBs_P-C Product feature CHAIN FJ899763_LHBs_P-C of FT:mat_peptide FJ899763_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-4). Complete genome. [Hepadnaviridae] (length=395 residues).
TKPRQGMGTNLSVPNPPGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIF
SRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899764_LHBs_P-C Product feature CHAIN FJ899764_LHBs_P-C of FT:mat_peptide FJ899764_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899765_LHBs_P-C Product feature CHAIN FJ899765_LHBs_P-C of FT:mat_peptide FJ899765_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWSSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899767_LHBs_P-C Product feature CHAIN FJ899767_LHBs_P-C of FT:mat_peptide FJ899767_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGVTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVFI
>gnl|hbvpro|FJ899769_LHBs_P-C Product feature CHAIN FJ899769_LHBs_P-C of FT:mat_peptide FJ899769_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNWQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILGPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899770_LHBs_P-C Product feature CHAIN FJ899770_LHBs_P-C of FT:mat_peptide FJ899770_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-4). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANLNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899771_LHBs_P-C Product feature CHAIN FJ899771_LHBs_P-C of FT:mat_peptide FJ899771_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPTFFCLWVYI
>gnl|hbvpro|FJ899772_LHBs_P-C Product feature CHAIN FJ899772_LHBs_P-C of FT:mat_peptide FJ899772_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C113-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
IGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|FJ899773_LHBs_P-C Product feature CHAIN FJ899773_LHBs_P-C of FT:mat_peptide FJ899773_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C113-6). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPQANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILATVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
ILSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMRYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899774_LHBs_P-C Product feature CHAIN FJ899774_LHBs_P-C of FT:mat_peptide FJ899774_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPTAPPPASTNRQSGRQPTPISPPLRDTHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGHRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ899775_LHBs_P-C Product feature CHAIN FJ899775_LHBs_P-C of FT:mat_peptide FJ899775_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-6). Complete genome. [Hepadnaviridae] (length=395 residues).
TKPRQGMGTNLSVPNPPGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIF
SRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899776_LHBs_P-C Product feature CHAIN FJ899776_LHBs_P-C of FT:mat_peptide FJ899776_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C122-7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|FJ899777_LHBs_P-C Product feature CHAIN FJ899777_LHBs_P-C of FT:mat_peptide FJ899777_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDPWPEANQVGAGAFGPGFTPPHGGLLGWNPL
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899778_LHBs_P-C Product feature CHAIN FJ899778_LHBs_P-C of FT:mat_peptide FJ899778_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173-1). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGRLSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTEPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899783_LHBs_P-C Product feature CHAIN FJ899783_LHBs_P-C of FT:mat_peptide FJ899783_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207-1). Complete genome. [Hepadnaviridae] (length=399 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGIMTTAPAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPI
SSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSQTSCPP
TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNC
TCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWYWGPGLYNILSPFLPLLPIFFYLWAYI
>gnl|hbvpro|FJ899788_LHBs_P-C Product feature CHAIN FJ899788_LHBs_P-C of FT:mat_peptide FJ899788_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGSYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899789_LHBs_P-C Product feature CHAIN FJ899789_LHBs_P-C of FT:mat_peptide FJ899789_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGSYSKPRQGMGTNLSVPNPLGSFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ184326_LHBs_P-C Product feature CHAIN GQ184326_LHBs_P-C of FT:mat_peptide GQ184326_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZADGM501). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGALTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPAKISQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ259588_LHBs_P-C Product feature CHAIN GQ259588_LHBs_P-C of FT:mat_peptide GQ259588_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-22). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ358153_LHBs_P-C Product feature CHAIN GQ358153_LHBs_P-C of FT:mat_peptide GQ358153_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIHB006). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNDPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQSLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLVVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPNLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ358154_LHBs_P-C Product feature CHAIN GQ358154_LHBs_P-C of FT:mat_peptide GQ358154_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SLK126). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ358157_LHBs_P-C Product feature CHAIN GQ358157_LHBs_P-C of FT:mat_peptide GQ358157_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M007). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPKAHQVGTGSFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ358158_LHBs_C-C Product feature CHAIN GQ358158_LHBs_C-C of FT:mat_peptide GQ358158_LHBs_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M154). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPAATNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRSGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSSHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|GQ372968_LHBs_P-C Product feature CHAIN GQ372968_LHBs_P-C of FT:mat_peptide GQ372968_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6380-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGSFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQRNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCLGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377515_LHBs_P-C Product feature CHAIN GQ377515_LHBs_P-C of FT:mat_peptide GQ377515_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377517_LHBs_P-C Product feature CHAIN GQ377517_LHBs_P-C of FT:mat_peptide GQ377517_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDLAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377518_LHBs_P-C Product feature CHAIN GQ377518_LHBs_P-C of FT:mat_peptide GQ377518_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377521_LHBs_P-C Product feature CHAIN GQ377521_LHBs_P-C of FT:mat_peptide GQ377521_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377523_LHBs_P-C Product feature CHAIN GQ377523_LHBs_P-C of FT:mat_peptide GQ377523_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J21). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377524_LHBs_P-C Product feature CHAIN GQ377524_LHBs_P-C of FT:mat_peptide GQ377524_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J23). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTKFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQLFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377526_LHBs_P-C Product feature CHAIN GQ377526_LHBs_P-C of FT:mat_peptide GQ377526_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J27). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGSGAFGPGFTPPHGGLLGWSPQ
AQGISTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377527_LHBs_P-C Product feature CHAIN GQ377527_LHBs_P-C of FT:mat_peptide GQ377527_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J28). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377528_LHBs_P-C Product feature CHAIN GQ377528_LHBs_P-C of FT:mat_peptide GQ377528_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J29). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAEPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377529_LHBs_P-C Product feature CHAIN GQ377529_LHBs_P-C of FT:mat_peptide GQ377529_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J34). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|GQ377530_LHBs_P-C Product feature CHAIN GQ377530_LHBs_P-C of FT:mat_peptide GQ377530_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J35). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQAGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQXGFXLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377533_LHBs_P-C Product feature CHAIN GQ377533_LHBs_P-C of FT:mat_peptide GQ377533_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J39). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGVLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSLSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377536_LHBs_P-C Product feature CHAIN GQ377536_LHBs_P-C of FT:mat_peptide GQ377536_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J47). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377538_LHBs_P-C Product feature CHAIN GQ377538_LHBs_P-C of FT:mat_peptide GQ377538_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J52). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVHPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377540_LHBs_P-C Product feature CHAIN GQ377540_LHBs_P-C of FT:mat_peptide GQ377540_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J57). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377541_LHBs_P-C Product feature CHAIN GQ377541_LHBs_P-C of FT:mat_peptide GQ377541_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J58). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVSAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377545_LHBs_P-C Product feature CHAIN GQ377545_LHBs_P-C of FT:mat_peptide GQ377545_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J76). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377546_LHBs_P-C Product feature CHAIN GQ377546_LHBs_P-C of FT:mat_peptide GQ377546_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J77). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCSKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377551_LHBs_P-C Product feature CHAIN GQ377551_LHBs_P-C of FT:mat_peptide GQ377551_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J82). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPIAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377552_LHBs_P-C Product feature CHAIN GQ377552_LHBs_P-C of FT:mat_peptide GQ377552_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J83). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377553_LHBs_P-C Product feature CHAIN GQ377553_LHBs_P-C of FT:mat_peptide GQ377553_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J84). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIYLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377554_LHBs_P-C Product feature CHAIN GQ377554_LHBs_P-C of FT:mat_peptide GQ377554_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J85). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377555_LHBs_P-C Product feature CHAIN GQ377555_LHBs_P-C of FT:mat_peptide GQ377555_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J86). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGAGAFGPGLTPPHGGLLGWSQQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377557_LHBs_P-C Product feature CHAIN GQ377557_LHBs_P-C of FT:mat_peptide GQ377557_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J88). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNIWSRFIPLLPIFLCLWVYI
>gnl|hbvpro|GQ377559_LHBs_P-C Product feature CHAIN GQ377559_LHBs_P-C of FT:mat_peptide GQ377559_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J92). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377562_LHBs_P-C Product feature CHAIN GQ377562_LHBs_P-C of FT:mat_peptide GQ377562_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J97). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377563_LHBs_P-C Product feature CHAIN GQ377563_LHBs_P-C of FT:mat_peptide GQ377563_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J98). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377570_LHBs_P-C Product feature CHAIN GQ377570_LHBs_P-C of FT:mat_peptide GQ377570_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J110). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFFWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377571_LHBs_P-C Product feature CHAIN GQ377571_LHBs_P-C of FT:mat_peptide GQ377571_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J112). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSILSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|GQ377572_LHBs_P-C Product feature CHAIN GQ377572_LHBs_P-C of FT:mat_peptide GQ377572_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J113). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377574_LHBs_P-C Product feature CHAIN GQ377574_LHBs_P-C of FT:mat_peptide GQ377574_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J115). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377575_LHBs_P-C Product feature CHAIN GQ377575_LHBs_P-C of FT:mat_peptide GQ377575_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J116). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377576_LHBs_P-C Product feature CHAIN GQ377576_LHBs_P-C of FT:mat_peptide GQ377576_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J117). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377577_LHBs_P-C Product feature CHAIN GQ377577_LHBs_P-C of FT:mat_peptide GQ377577_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J118). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377578_LHBs_P-C Product feature CHAIN GQ377578_LHBs_P-C of FT:mat_peptide GQ377578_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J125). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377579_LHBs_P-C Product feature CHAIN GQ377579_LHBs_P-C of FT:mat_peptide GQ377579_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J126). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377580_LHBs_P-C Product feature CHAIN GQ377580_LHBs_P-C of FT:mat_peptide GQ377580_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J127). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPATNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377583_LHBs_P-C Product feature CHAIN GQ377583_LHBs_P-C of FT:mat_peptide GQ377583_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J132). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377584_LHBs_P-C Product feature CHAIN GQ377584_LHBs_P-C of FT:mat_peptide GQ377584_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J133). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTENPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377585_LHBs_P-C Product feature CHAIN GQ377585_LHBs_P-C of FT:mat_peptide GQ377585_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J134). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377586_LHBs_P-C Product feature CHAIN GQ377586_LHBs_P-C of FT:mat_peptide GQ377586_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J135). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377591_LHBs_P-C Product feature CHAIN GQ377591_LHBs_P-C of FT:mat_peptide GQ377591_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J148). Complete genome. [Hepadnaviridae] (length=398 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAALLCSHRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTS
SIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCT
CIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377593_LHBs_P-C Product feature CHAIN GQ377593_LHBs_P-C of FT:mat_peptide GQ377593_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J150). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377597_LHBs_P-C Product feature CHAIN GQ377597_LHBs_P-C of FT:mat_peptide GQ377597_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J157). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377598_LHBs_P-C Product feature CHAIN GQ377598_LHBs_P-C of FT:mat_peptide GQ377598_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J158). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377599_LHBs_P-C Product feature CHAIN GQ377599_LHBs_P-C of FT:mat_peptide GQ377599_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J160). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGLTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|GQ377600_LHBs_P-C Product feature CHAIN GQ377600_LHBs_P-C of FT:mat_peptide GQ377600_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J161). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377601_LHBs_P-C Product feature CHAIN GQ377601_LHBs_P-C of FT:mat_peptide GQ377601_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J164). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPITASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377603_LHBs_P-C Product feature CHAIN GQ377603_LHBs_P-C of FT:mat_peptide GQ377603_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J166). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377605_LHBs_P-C Product feature CHAIN GQ377605_LHBs_P-C of FT:mat_peptide GQ377605_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J169). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377608_LHBs_P-C Product feature CHAIN GQ377608_LHBs_P-C of FT:mat_peptide GQ377608_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J174). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSSFSRTGDLAPNMENTTSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377609_LHBs_P-C Product feature CHAIN GQ377609_LHBs_P-C of FT:mat_peptide GQ377609_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J176). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|GQ377615_LHBs_P-C Product feature CHAIN GQ377615_LHBs_P-C of FT:mat_peptide GQ377615_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J186). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|GQ377616_LHBs_P-C Product feature CHAIN GQ377616_LHBs_P-C of FT:mat_peptide GQ377616_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J192). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377617_LHBs_P-C Product feature CHAIN GQ377617_LHBs_P-C of FT:mat_peptide GQ377617_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J193). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377618_LHBs_P-C Product feature CHAIN GQ377618_LHBs_P-C of FT:mat_peptide GQ377618_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J194). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFARTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377619_LHBs_P-C Product feature CHAIN GQ377619_LHBs_P-C of FT:mat_peptide GQ377619_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J195). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTPSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377620_LHBs_P-C Product feature CHAIN GQ377620_LHBs_P-C of FT:mat_peptide GQ377620_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J197). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRYSTPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGRSPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFWWVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377621_LHBs_P-C Product feature CHAIN GQ377621_LHBs_P-C of FT:mat_peptide GQ377621_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J206). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPGAPPPAATNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377623_LHBs_P-C Product feature CHAIN GQ377623_LHBs_P-C of FT:mat_peptide GQ377623_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J208). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDRWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAATPPASTNRQSRRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377624_LHBs_P-C Product feature CHAIN GQ377624_LHBs_P-C of FT:mat_peptide GQ377624_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J221). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377628_LHBs_P-C Product feature CHAIN GQ377628_LHBs_P-C of FT:mat_peptide GQ377628_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J232). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFXRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|GQ377631_LHBs_P-C Product feature CHAIN GQ377631_LHBs_P-C of FT:mat_peptide GQ377631_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J239). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377632_LHBs_P-C Product feature CHAIN GQ377632_LHBs_P-C of FT:mat_peptide GQ377632_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J240). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377636_LHBs_P-C Product feature CHAIN GQ377636_LHBs_P-C of FT:mat_peptide GQ377636_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J248). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGXLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377637_LHBs_P-C Product feature CHAIN GQ377637_LHBs_P-C of FT:mat_peptide GQ377637_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J249). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377640_LHBs_P-C Product feature CHAIN GQ377640_LHBs_P-C of FT:mat_peptide GQ377640_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J253). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377642_LHBs_P-C Product feature CHAIN GQ377642_LHBs_P-C of FT:mat_peptide GQ377642_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J256). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475305_LHBs_P-C Product feature CHAIN GQ475305_LHBs_P-C of FT:mat_peptide GQ475305_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR1CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475306_LHBs_P-C Product feature CHAIN GQ475306_LHBs_P-C of FT:mat_peptide GQ475306_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR2CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475307_LHBs_P-C Product feature CHAIN GQ475307_LHBs_P-C of FT:mat_peptide GQ475307_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR3CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475308_LHBs_P-C Product feature CHAIN GQ475308_LHBs_P-C of FT:mat_peptide GQ475308_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR4CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475309_LHBs_P-C Product feature CHAIN GQ475309_LHBs_P-C of FT:mat_peptide GQ475309_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR5CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAATPPASTNRQSGRQPTPISPPLRDSHPQAIQWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475310_LHBs_P-C Product feature CHAIN GQ475310_LHBs_P-C of FT:mat_peptide GQ475310_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR6CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475311_LHBs_P-C Product feature CHAIN GQ475311_LHBs_P-C of FT:mat_peptide GQ475311_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR7CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475312_LHBs_P-C Product feature CHAIN GQ475312_LHBs_P-C of FT:mat_peptide GQ475312_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR8CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475313_LHBs_P-C Product feature CHAIN GQ475313_LHBs_P-C of FT:mat_peptide GQ475313_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR9CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475314_LHBs_P-C Product feature CHAIN GQ475314_LHBs_P-C of FT:mat_peptide GQ475314_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR10CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475315_LHBs_P-C Product feature CHAIN GQ475315_LHBs_P-C of FT:mat_peptide GQ475315_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR11CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475316_LHBs_P-C Product feature CHAIN GQ475316_LHBs_P-C of FT:mat_peptide GQ475316_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR12CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475317_LHBs_P-C Product feature CHAIN GQ475317_LHBs_P-C of FT:mat_peptide GQ475317_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR13CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475318_LHBs_P-C Product feature CHAIN GQ475318_LHBs_P-C of FT:mat_peptide GQ475318_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR14CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGILGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475319_LHBs_P-C Product feature CHAIN GQ475319_LHBs_P-C of FT:mat_peptide GQ475319_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR15CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475320_LHBs_P-C Product feature CHAIN GQ475320_LHBs_P-C of FT:mat_peptide GQ475320_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR16CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475321_LHBs_P-C Product feature CHAIN GQ475321_LHBs_P-C of FT:mat_peptide GQ475321_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR17CHB). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475322_LHBs_P-C Product feature CHAIN GQ475322_LHBs_P-C of FT:mat_peptide GQ475322_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR18LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475323_LHBs_P-C Product feature CHAIN GQ475323_LHBs_P-C of FT:mat_peptide GQ475323_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR19LC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475324_LHBs_P-C Product feature CHAIN GQ475324_LHBs_P-C of FT:mat_peptide GQ475324_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR20LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475325_LHBs_P-C Product feature CHAIN GQ475325_LHBs_P-C of FT:mat_peptide GQ475325_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR21LC). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLPAGGSSSGTVNPVPTTASPIS
SIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCT
CIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475327_LHBs_P-C Product feature CHAIN GQ475327_LHBs_P-C of FT:mat_peptide GQ475327_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR23LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475328_LHBs_P-C Product feature CHAIN GQ475328_LHBs_P-C of FT:mat_peptide GQ475328_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR24LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475329_LHBs_P-C Product feature CHAIN GQ475329_LHBs_P-C of FT:mat_peptide GQ475329_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR25LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475331_LHBs_P-C Product feature CHAIN GQ475331_LHBs_P-C of FT:mat_peptide GQ475331_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR27LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475332_LHBs_P-C Product feature CHAIN GQ475332_LHBs_P-C of FT:mat_peptide GQ475332_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR28LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475334_LHBs_P-C Product feature CHAIN GQ475334_LHBs_P-C of FT:mat_peptide GQ475334_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR30LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475336_LHBs_P-C Product feature CHAIN GQ475336_LHBs_P-C of FT:mat_peptide GQ475336_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR32LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ475337_LHBs_P-C Product feature CHAIN GQ475337_LHBs_P-C of FT:mat_peptide GQ475337_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR33LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475338_LHBs_P-C Product feature CHAIN GQ475338_LHBs_P-C of FT:mat_peptide GQ475338_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR34LC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ475339_LHBs_P-C Product feature CHAIN GQ475339_LHBs_P-C of FT:mat_peptide GQ475339_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR35HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475341_LHBs_P-C Product feature CHAIN GQ475341_LHBs_P-C of FT:mat_peptide GQ475341_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR37HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475344_LHBs_P-C Product feature CHAIN GQ475344_LHBs_P-C of FT:mat_peptide GQ475344_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR40HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475345_LHBs_P-C Product feature CHAIN GQ475345_LHBs_P-C of FT:mat_peptide GQ475345_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR41HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475346_LHBs_P-C Product feature CHAIN GQ475346_LHBs_P-C of FT:mat_peptide GQ475346_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR42HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475348_LHBs_P-C Product feature CHAIN GQ475348_LHBs_P-C of FT:mat_peptide GQ475348_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR44HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGSTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475349_LHBs_P-C Product feature CHAIN GQ475349_LHBs_P-C of FT:mat_peptide GQ475349_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR45HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475350_LHBs_P-C Product feature CHAIN GQ475350_LHBs_P-C of FT:mat_peptide GQ475350_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR46HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475351_LHBs_P-C Product feature CHAIN GQ475351_LHBs_P-C of FT:mat_peptide GQ475351_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR47HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGPSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVKGLYFPAGGSSSGTVHPVPTTALP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ475353_LHBs_P-C Product feature CHAIN GQ475353_LHBs_P-C of FT:mat_peptide GQ475353_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR49HCC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=395 residues).
IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIF
SRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKICTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ475354_LHBs_P-C Product feature CHAIN GQ475354_LHBs_P-C of FT:mat_peptide GQ475354_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR50HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475355_LHBs_P-C Product feature CHAIN GQ475355_LHBs_P-C of FT:mat_peptide GQ475355_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR51HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGXLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQXXXDSRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCXRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475356_LHBs_P-C Product feature CHAIN GQ475356_LHBs_P-C of FT:mat_peptide GQ475356_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR52HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGXSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPBKDHWPEANQVGAGAFGPGFTPPHGXLLGWSPQ
XQGXLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475357_LHBs_P-C Product feature CHAIN GQ475357_LHBs_P-C of FT:mat_peptide GQ475357_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR53HCC). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGXGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWXWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ872210_LHBs_P-C Product feature CHAIN GQ872210_LHBs_P-C of FT:mat_peptide GQ872210_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLRWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ872211_LHBs_P-C Product feature CHAIN GQ872211_LHBs_P-C of FT:mat_peptide GQ872211_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEATQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMGYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924604_LHBs_P-C Product feature CHAIN GQ924604_LHBs_P-C of FT:mat_peptide GQ924604_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924609_LHBs_P-C Product feature CHAIN GQ924609_LHBs_P-C of FT:mat_peptide GQ924609_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924612_LHBs_P-C Product feature CHAIN GQ924612_LHBs_P-C of FT:mat_peptide GQ924612_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30a). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGIMTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924613_LHBs_P-C Product feature CHAIN GQ924613_LHBs_P-C of FT:mat_peptide GQ924613_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30b). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGIMTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924614_LHBs_P-C Product feature CHAIN GQ924614_LHBs_P-C of FT:mat_peptide GQ924614_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M31). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924615_LHBs_P-C Product feature CHAIN GQ924615_LHBs_P-C of FT:mat_peptide GQ924615_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M32). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924616_LHBs_P-C Product feature CHAIN GQ924616_LHBs_P-C of FT:mat_peptide GQ924616_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M33). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRYSQPRKGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924620_LHBs_C-C Product feature CHAIN GQ924620_LHBs_C-C of FT:mat_peptide GQ924620_LHBs_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M38). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTPVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTTNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNXQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVFI
>gnl|hbvpro|GQ924622_LHBs_P-C Product feature CHAIN GQ924622_LHBs_P-C of FT:mat_peptide GQ924622_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M40). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924629_LHBs_P-C Product feature CHAIN GQ924629_LHBs_P-C of FT:mat_peptide GQ924629_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M51). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPAQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924633_LHBs_P-C Product feature CHAIN GQ924633_LHBs_P-C of FT:mat_peptide GQ924633_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M56). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924636_LHBs_P-C Product feature CHAIN GQ924636_LHBs_P-C of FT:mat_peptide GQ924636_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M68). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSDNPDWDLNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924642_LHBs_P-C Product feature CHAIN GQ924642_LHBs_P-C of FT:mat_peptide GQ924642_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M77). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTMPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVKWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTASGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924643_LHBs_P-C Product feature CHAIN GQ924643_LHBs_P-C of FT:mat_peptide GQ924643_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M78). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILATAPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSHTFHQAVLNPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924649_LHBs_P-C Product feature CHAIN GQ924649_LHBs_P-C of FT:mat_peptide GQ924649_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M86). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924650_LHBs_P-C Product feature CHAIN GQ924650_LHBs_P-C of FT:mat_peptide GQ924650_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M87). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILSTVPAAPPTASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924655_LHBs_P-C Product feature CHAIN GQ924655_LHBs_P-C of FT:mat_peptide GQ924655_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M92). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNFSVPNPVGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU357845_LHBs_P-C Product feature CHAIN GU357845_LHBs_P-C of FT:mat_peptide GU357845_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y1021). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWSEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTIFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGASMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU434374_LHBs_P-C Product feature CHAIN GU434374_LHBs_P-C of FT:mat_peptide GU434374_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 214-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU563561_LHBs_P-C Product feature CHAIN GU563561_LHBs_P-C of FT:mat_peptide GU563561_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BV-153). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU721029_LHBs_P-C Product feature CHAIN GU721029_LHBs_P-C of FT:mat_peptide GU721029_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CMCL107). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDLAFRANSNIPDWDFNPNKDHWREAWQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTSVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSTFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011465_LHBs_P-C Product feature CHAIN HM011465_LHBs_P-C of FT:mat_peptide HM011465_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPSAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011468_LHBs_P-C Product feature CHAIN HM011468_LHBs_P-C of FT:mat_peptide HM011468_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPALGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PXCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLYNILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011472_LHBs_P-C Product feature CHAIN HM011472_LHBs_P-C of FT:mat_peptide HM011472_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011479_LHBs_P-C Product feature CHAIN HM011479_LHBs_P-C of FT:mat_peptide HM011479_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGXLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHLPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLXVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXNILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011481_LHBs_P-C Product feature CHAIN HM011481_LHBs_P-C of FT:mat_peptide HM011481_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=399 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPXAQWNSTTFHQALLDPRVRXLYLPAGGSSSGTVNPVPTTASPI
SSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPP
TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNC
TCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011486_LHBs_P-C Product feature CHAIN HM011486_LHBs_P-C of FT:mat_peptide HM011486_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDLNPNKDPWPAAXQVGVGAFGPGFTPPHGNLLGWSPQ
AQGXLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVXWNSSTFHQALLDPXVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPKMEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPGQNLQSPTSNHSPTSCP
PXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXLNPFXPLLPIFFCLWVYI
>gnl|hbvpro|HM011488_LHBs_P-C Product feature CHAIN HM011488_LHBs_P-C of FT:mat_peptide HM011488_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGXSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAAXQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTXPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXPKCXGQNSQSPTSXHSXTSCP
PXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYXGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAXFLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGXSLXNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011489_LHBs_P-C Product feature CHAIN HM011489_LHBs_P-C of FT:mat_peptide HM011489_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011491_LHBs_P-C Product feature CHAIN HM011491_LHBs_P-C of FT:mat_peptide HM011491_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSXAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011493_LHBs_P-C Product feature CHAIN HM011493_LHBs_P-C of FT:mat_peptide HM011493_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGAGAFGPGFTPPHGXLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011495_LHBs_P-C Product feature CHAIN HM011495_LHBs_P-C of FT:mat_peptide HM011495_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSILSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PXCPGYRXMCLRRFIXFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWXSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILNPFLPLLXIFFCLWVYI
>gnl|hbvpro|HM011497_LHBs_P-C Product feature CHAIN HM011497_LHBs_P-C of FT:mat_peptide HM011497_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011500_LHBs_P-C Product feature CHAIN HM011500_LHBs_P-C of FT:mat_peptide HM011500_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGXLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750131_LHBs_P-C Product feature CHAIN HM750131_LHBs_P-C of FT:mat_peptide HM750131_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-57). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750132_LHBs_P-C Product feature CHAIN HM750132_LHBs_P-C of FT:mat_peptide HM750132_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-165). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750134_LHBs_P-C Product feature CHAIN HM750134_LHBs_P-C of FT:mat_peptide HM750134_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750135_LHBs_P-C Product feature CHAIN HM750135_LHBs_P-C of FT:mat_peptide HM750135_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750136_LHBs_P-C Product feature CHAIN HM750136_LHBs_P-C of FT:mat_peptide HM750136_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSDC-53). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750137_LHBs_P-C Product feature CHAIN HM750137_LHBs_P-C of FT:mat_peptide HM750137_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASP
ISSILSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTLPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750138_LHBs_P-C Product feature CHAIN HM750138_LHBs_P-C of FT:mat_peptide HM750138_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-100). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750139_LHBs_P-C Product feature CHAIN HM750139_LHBs_P-C of FT:mat_peptide HM750139_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750140_LHBs_P-C Product feature CHAIN HM750140_LHBs_P-C of FT:mat_peptide HM750140_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-56). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTLPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750141_LHBs_P-C Product feature CHAIN HM750141_LHBs_P-C of FT:mat_peptide HM750141_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-115). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGVLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ622095_LHBs_P-C Product feature CHAIN HQ622095_LHBs_P-C of FT:mat_peptide HQ622095_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGSGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700456_LHBs_P-C Product feature CHAIN HQ700456_LHBs_P-C of FT:mat_peptide HQ700456_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_HA121_1984). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNATTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTXSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLLFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700457_LHBs_P-C Product feature CHAIN HQ700457_LHBs_P-C of FT:mat_peptide HQ700457_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_HA71_1997). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGLTPPHGGLLGWSPQ
AQGXLTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQAXLDPRXRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700475_LHBs_P-C Product feature CHAIN HQ700475_LHBs_P-C of FT:mat_peptide HQ700475_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_PA58_1984). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDXAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTATPPASTNRQSGRQPTPISPPLRDSHPQAMQWNATTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLLFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700490_LHBs_P-C Product feature CHAIN HQ700490_LHBs_P-C of FT:mat_peptide HQ700490_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_WH23_1993). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGLTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSTFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700495_LHBs_P-C Product feature CHAIN HQ700495_LHBs_P-C of FT:mat_peptide HQ700495_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155PF_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTLPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700496_LHBs_P-C Product feature CHAIN HQ700496_LHBs_P-C of FT:mat_peptide HQ700496_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155C_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTLPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQXPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSEGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700502_LHBs_P-C Product feature CHAIN HQ700502_LHBs_P-C of FT:mat_peptide HQ700502_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Is_1991). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700504_LHBs_P-C Product feature CHAIN HQ700504_LHBs_P-C of FT:mat_peptide HQ700504_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Ve_1992). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWXSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700506_LHBs_P-C Product feature CHAIN HQ700506_LHBs_P-C of FT:mat_peptide HQ700506_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NC_TA32_2003). Complete genome. [Hepadnaviridae] (length=395 residues).
IKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIL
TTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIF
SRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPG
YRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIP
IPSSWAFVRFLWEWASVRFSWLNLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700516_LHBs_P-C Product feature CHAIN HQ700516_LHBs_P-C of FT:mat_peptide HQ700516_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_D029_2005). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPNKDRWPKANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTPLPAVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNLVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPALGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700522_LHBs_P-C Product feature CHAIN HQ700522_LHBs_P-C of FT:mat_peptide HQ700522_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_H086A_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPVFGANSNNPDWDFNPNKDRWPEANQVGTGAFGPGFTPPHGGLLGWSPL
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPALNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700529_LHBs_P-C Product feature CHAIN HQ700529_LHBs_P-C of FT:mat_peptide HQ700529_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_W083A_2004). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNPNKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTIASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPXCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGXSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700543_LHBs_P-C Product feature CHAIN HQ700543_LHBs_P-C of FT:mat_peptide HQ700543_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_P124A_2005). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPVFGANSNNPDWDFNPNKDHWPEANQVGTGAFGPGFTPPHGGLLGWSPL
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPALNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700544_LHBs_P-C Product feature CHAIN HQ700544_LHBs_P-C of FT:mat_peptide HQ700544_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_T003_2A). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700545_LHBs_P-C Product feature CHAIN HQ700545_LHBs_P-C of FT:mat_peptide HQ700545_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_T015A_). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700555_LHBs_P-C Product feature CHAIN HQ700555_LHBs_P-C of FT:mat_peptide HQ700555_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD4171_2001). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDXQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGXSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSXWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700556_LHBs_P-C Product feature CHAIN HQ700556_LHBs_P-C of FT:mat_peptide HQ700556_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BA4986_2002). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700558_LHBs_P-C Product feature CHAIN HQ700558_LHBs_P-C of FT:mat_peptide HQ700558_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5375_2001). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700559_LHBs_P-C Product feature CHAIN HQ700559_LHBs_P-C of FT:mat_peptide HQ700559_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5561_2001). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSXLSLLAPFVQWFXGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700561_LHBs_P-C Product feature CHAIN HQ700561_LHBs_P-C of FT:mat_peptide HQ700561_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BF7376_2002). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700562_LHBs_P-C Product feature CHAIN HQ700562_LHBs_P-C of FT:mat_peptide HQ700562_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tomga_BH5413_2002). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPXFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGMLTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPXGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIXLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCXTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700563_LHBs_P-C Product feature CHAIN HQ700563_LHBs_P-C of FT:mat_peptide HQ700563_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BL9389_2002). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLFPIFFCLWVYI
>gnl|hbvpro|HQ700564_LHBs_P-C Product feature CHAIN HQ700564_LHBs_P-C of FT:mat_peptide HQ700564_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BQ3589_2001). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700565_LHBs_P-C Product feature CHAIN HQ700565_LHBs_P-C of FT:mat_peptide HQ700565_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BR6895_2001). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700566_LHBs_P-C Product feature CHAIN HQ700566_LHBs_P-C of FT:mat_peptide HQ700566_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_JN1142_2004). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRXLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQSMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700567_LHBs_P-C Product feature CHAIN HQ700567_LHBs_P-C of FT:mat_peptide HQ700567_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To268_2006). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPXAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVMGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPALNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700569_LHBs_P-C Product feature CHAIN HQ700569_LHBs_P-C of FT:mat_peptide HQ700569_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To347_2006). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPEPNQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASH
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQETSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWTSVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700570_LHBs_P-C Product feature CHAIN HQ700570_LHBs_P-C of FT:mat_peptide HQ700570_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To356_2006). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAVQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVHPVPTTASP
ISSIFSRTGDPAPNMENTASGHLGPLLGLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSQTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700571_LHBs_P-C Product feature CHAIN HQ700571_LHBs_P-C of FT:mat_peptide HQ700571_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To391_2006). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGXGTNLSVPNPLGFFPDHQXDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPXFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCETCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700572_LHBs_P-C Product feature CHAIN HQ700572_LHBs_P-C of FT:mat_peptide HQ700572_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To422_2007). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLXFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICXGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700573_LHBs_P-C Product feature CHAIN HQ700573_LHBs_P-C of FT:mat_peptide HQ700573_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To426_2007). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700575_LHBs_P-C Product feature CHAIN HQ700575_LHBs_P-C of FT:mat_peptide HQ700575_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To244_2006). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANPNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFXQALLDXRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700576_LHBs_P-C Product feature CHAIN HQ700576_LHBs_P-C of FT:mat_peptide HQ700576_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To250_2006). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGXXTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPXVXGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPALNMENTTSGFXGPLLVXQAVFFLLTRILTIPQSLDSWWTSLSFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCXIPAQGTSMFPSCCCXKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700577_LHBs_P-C Product feature CHAIN HQ700577_LHBs_P-C of FT:mat_peptide HQ700577_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To293_2006). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASH
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILIIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQETSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF436920_LHBs_P-C Product feature CHAIN JF436920_LHBs_P-C of FT:mat_peptide JF436920_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SZ6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPALGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLVFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|JF828913_LHBs_P-C Product feature CHAIN JF828913_LHBs_P-C of FT:mat_peptide JF828913_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828915_LHBs_P-C Product feature CHAIN JF828915_LHBs_P-C of FT:mat_peptide JF828915_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828916_LHBs_P-C Product feature CHAIN JF828916_LHBs_P-C of FT:mat_peptide JF828916_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARLLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828917_LHBs_P-C Product feature CHAIN JF828917_LHBs_P-C of FT:mat_peptide JF828917_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828918_LHBs_P-C Product feature CHAIN JF828918_LHBs_P-C of FT:mat_peptide JF828918_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828919_LHBs_P-C Product feature CHAIN JF828919_LHBs_P-C of FT:mat_peptide JF828919_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARLLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828920_LHBs_P-C Product feature CHAIN JF828920_LHBs_P-C of FT:mat_peptide JF828920_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-14). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828921_LHBs_P-C Product feature CHAIN JF828921_LHBs_P-C of FT:mat_peptide JF828921_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|JF828922_LHBs_P-C Product feature CHAIN JF828922_LHBs_P-C of FT:mat_peptide JF828922_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828923_LHBs_P-C Product feature CHAIN JF828923_LHBs_P-C of FT:mat_peptide JF828923_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGTQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828924_LHBs_P-C Product feature CHAIN JF828924_LHBs_P-C of FT:mat_peptide JF828924_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828925_LHBs_P-C Product feature CHAIN JF828925_LHBs_P-C of FT:mat_peptide JF828925_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRIGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828926_LHBs_P-C Product feature CHAIN JF828926_LHBs_P-C of FT:mat_peptide JF828926_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828928_LHBs_P-C Product feature CHAIN JF828928_LHBs_P-C of FT:mat_peptide JF828928_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFNLLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828929_LHBs_P-C Product feature CHAIN JF828929_LHBs_P-C of FT:mat_peptide JF828929_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTRTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828930_LHBs_P-C Product feature CHAIN JF828930_LHBs_P-C of FT:mat_peptide JF828930_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828937_LHBs_P-C Product feature CHAIN JF828937_LHBs_P-C of FT:mat_peptide JF828937_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES72-12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF899336_LHBs_P-C Product feature CHAIN JF899336_LHBs_P-C of FT:mat_peptide JF899336_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10B3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGVPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN315779_LHBs_P-C Product feature CHAIN JN315779_LHBs_P-C of FT:mat_peptide JN315779_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN400087_LHBs_P-C Product feature CHAIN JN400087_LHBs_P-C of FT:mat_peptide JN400087_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-75-Mother). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN400088_LHBs_P-C Product feature CHAIN JN400088_LHBs_P-C of FT:mat_peptide JN400088_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Baby). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN400089_LHBs_P-C Product feature CHAIN JN400089_LHBs_P-C of FT:mat_peptide JN400089_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Mother). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604118_LHBs_P-C Product feature CHAIN JN604118_LHBs_P-C of FT:mat_peptide JN604118_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 476-5532-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDLAFXANSNNPDWDFNPNKDXWPXAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604121_LHBs_P-C Product feature CHAIN JN604121_LHBs_P-C of FT:mat_peptide JN604121_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 476-8046-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604129_LHBs_P-C Product feature CHAIN JN604129_LHBs_P-C of FT:mat_peptide JN604129_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-4856-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFRGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFXLLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604131_LHBs_P-C Product feature CHAIN JN604131_LHBs_P-C of FT:mat_peptide JN604131_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-9212-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604133_LHBs_P-C Product feature CHAIN JN604133_LHBs_P-C of FT:mat_peptide JN604133_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-1870-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPMCPGQNSQSQTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604135_LHBs_P-C Product feature CHAIN JN604135_LHBs_P-C of FT:mat_peptide JN604135_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-3655-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDSWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGMLTTVPAEPPPASTKRQSGRQPTPISPPLRDSHPHAMQWNYRTFHQALLDPRVRDLCFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCP
PICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDXN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILNPFLPLLLIFFCLWVYI
>gnl|hbvpro|JN604140_LHBs_P-C Product feature CHAIN JN604140_LHBs_P-C of FT:mat_peptide JN604140_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-8902-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604144_LHBs_P-C Product feature CHAIN JN604144_LHBs_P-C of FT:mat_peptide JN604144_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-2049-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604147_LHBs_P-C Product feature CHAIN JN604147_LHBs_P-C of FT:mat_peptide JN604147_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-4347-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPTANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604148_LHBs_P-C Product feature CHAIN JN604148_LHBs_P-C of FT:mat_peptide JN604148_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-5115-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGLTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604151_LHBs_P-C Product feature CHAIN JN604151_LHBs_P-C of FT:mat_peptide JN604151_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-6033-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPXPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSKGPCKXCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604153_LHBs_P-C Product feature CHAIN JN604153_LHBs_P-C of FT:mat_peptide JN604153_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-9129-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604182_LHBs_P-C Product feature CHAIN JN604182_LHBs_P-C of FT:mat_peptide JN604182_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-7600-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPTAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604215_LHBs_P-C Product feature CHAIN JN604215_LHBs_P-C of FT:mat_peptide JN604215_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-0677-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604222_LHBs_P-C Product feature CHAIN JN604222_LHBs_P-C of FT:mat_peptide JN604222_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-4649-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604226_LHBs_P-C Product feature CHAIN JN604226_LHBs_P-C of FT:mat_peptide JN604226_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-7103-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604231_LHBs_P-C Product feature CHAIN JN604231_LHBs_P-C of FT:mat_peptide JN604231_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-0073-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGXGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYIPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604232_LHBs_P-C Product feature CHAIN JN604232_LHBs_P-C of FT:mat_peptide JN604232_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-0121-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVXPTCPGQNSQSPTSNHSPTXCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604243_LHBs_P-C Product feature CHAIN JN604243_LHBs_P-C of FT:mat_peptide JN604243_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-9952-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAATPPASTTRQSGRQPTPISPPLRDSHPQVAQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCP
PICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604246_LHBs_P-C Product feature CHAIN JN604246_LHBs_P-C of FT:mat_peptide JN604246_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-0615-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604254_LHBs_P-C Product feature CHAIN JN604254_LHBs_P-C of FT:mat_peptide JN604254_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-6201-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFXIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604256_LHBs_P-C Product feature CHAIN JN604256_LHBs_P-C of FT:mat_peptide JN604256_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-7242-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPTAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604258_LHBs_P-C Product feature CHAIN JN604258_LHBs_P-C of FT:mat_peptide JN604258_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 480-1400-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGXCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604281_LHBs_P-C Product feature CHAIN JN604281_LHBs_P-C of FT:mat_peptide JN604281_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-6134-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILATVPAAPPPVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604286_LHBs_P-C Product feature CHAIN JN604286_LHBs_P-C of FT:mat_peptide JN604286_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-9392-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTLPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827414_LHBs_P-C Product feature CHAIN JN827414_LHBs_P-C of FT:mat_peptide JN827414_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0015). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSAKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPGAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|JN827415_LHBs_P-C Product feature CHAIN JN827415_LHBs_P-C of FT:mat_peptide JN827415_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0032). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGYSAKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPGAWQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827416_LHBs_P-C Product feature CHAIN JN827416_LHBs_P-C of FT:mat_peptide JN827416_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0294). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827417_LHBs_P-C Product feature CHAIN JN827417_LHBs_P-C of FT:mat_peptide JN827417_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0300). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827418_LHBs_P-C Product feature CHAIN JN827418_LHBs_P-C of FT:mat_peptide JN827418_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0904). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSKGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827420_LHBs_P-C Product feature CHAIN JN827420_LHBs_P-C of FT:mat_peptide JN827420_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4681). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827421_LHBs_P-C Product feature CHAIN JN827421_LHBs_P-C of FT:mat_peptide JN827421_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5205). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827422_LHBs_P-C Product feature CHAIN JN827422_LHBs_P-C of FT:mat_peptide JN827422_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5494). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827423_LHBs_P-C Product feature CHAIN JN827423_LHBs_P-C of FT:mat_peptide JN827423_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6359). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASSNRQSGRQPTPISPPLRDSHPQAMQWNSSIFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDSN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827424_LHBs_P-C Product feature CHAIN JN827424_LHBs_P-C of FT:mat_peptide JN827424_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2566). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFLLWVYI
>gnl|hbvpro|JN827425_LHBs_P-C Product feature CHAIN JN827425_LHBs_P-C of FT:mat_peptide JN827425_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3765). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFLLWVYI
>gnl|hbvpro|JQ027317_LHBs_P-C Product feature CHAIN JQ027317_LHBs_P-C of FT:mat_peptide JQ027317_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGXLTTVPAAPPPASTNRQSXRQPTPISPPLRDSHPQAXQWNSSTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLXXILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ027318_LHBs_P-C Product feature CHAIN JQ027318_LHBs_P-C of FT:mat_peptide JQ027318_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRRGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGAPTCRGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNXFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ027320_LHBs_P-C Product feature CHAIN JQ027320_LHBs_P-C of FT:mat_peptide JQ027320_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=401 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTIPAAPPPASTNRQSGRRPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSXTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMXPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFXPLLPIFFCLWVYI
X
>gnl|hbvpro|JQ027321_LHBs_P-C Product feature CHAIN JQ027321_LHBs_P-C of FT:mat_peptide JQ027321_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDXAFRANSNNPDWDXNPNKDPWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFXRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPXCPGQNLQSPTSNHLPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ027322_LHBs_P-C Product feature CHAIN JQ027322_LHBs_P-C of FT:mat_peptide JQ027322_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPXANQVGAGAFGPGXTPPHGGLXGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGXAPKCPGQNSQSPTSSHSXTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGXSMFPSCCCXKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWXWGPSLXNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ027323_LHBs_P-C Product feature CHAIN JQ027323_LHBs_P-C of FT:mat_peptide JQ027323_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGXSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSTFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JQ027324_LHBs_P-C Product feature CHAIN JQ027324_LHBs_P-C of FT:mat_peptide JQ027324_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGEXPKCPGQNSQSPTSNHSPTSCP
PXCPGYRWMCLRRFIXFLFILLLCLTFLLVLLDFKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASXRFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGXSLYNILXPFIPLLPIFXCLWXXI
>gnl|hbvpro|JQ027333_LHBs_P-C Product feature CHAIN JQ027333_LHBs_P-C of FT:mat_peptide JQ027333_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGXTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLBPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040131_LHBs_P-C Product feature CHAIN JQ040131_LHBs_P-C of FT:mat_peptide JQ040131_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 125). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040132_LHBs_P-C Product feature CHAIN JQ040132_LHBs_P-C of FT:mat_peptide JQ040132_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 144). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTXDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPXLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGN
CTGIPIPSSWAFARFLWEWASVRFSXXXXXXXXXQWFVGLSPTVWLSVXLMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040133_LHBs_P-C Product feature CHAIN JQ040133_LHBs_P-C of FT:mat_peptide JQ040133_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 160). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFXAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040139_LHBs_P-C Product feature CHAIN JQ040139_LHBs_P-C of FT:mat_peptide JQ040139_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 256). Non-functional genomic sequence. [Hepadnaviridae] (length=398 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLBPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLPAGGSSSGTVNPVPTTASPIS
SIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPI
CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCT
CIPIPSSWAFARFLWEWASVRFSWLSXLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040141_LHBs_P-C Product feature CHAIN JQ040141_LHBs_P-C of FT:mat_peptide JQ040141_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 260). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTAXPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040144_LHBs_P-C Product feature CHAIN JQ040144_LHBs_P-C of FT:mat_peptide JQ040144_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 272). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCXRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040145_LHBs_P-C Product feature CHAIN JQ040145_LHBs_P-C of FT:mat_peptide JQ040145_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 277). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPXCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040149_LHBs_P-C Product feature CHAIN JQ040149_LHBs_P-C of FT:mat_peptide JQ040149_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G76). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040151_LHBs_P-C Product feature CHAIN JQ040151_LHBs_P-C of FT:mat_peptide JQ040151_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G79). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ040152_LHBs_P-C Product feature CHAIN JQ040152_LHBs_P-C of FT:mat_peptide JQ040152_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G172). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040155_LHBs_P-C Product feature CHAIN JQ040155_LHBs_P-C of FT:mat_peptide JQ040155_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G182). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040161_LHBs_P-C Product feature CHAIN JQ040161_LHBs_P-C of FT:mat_peptide JQ040161_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G213). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTPVPXAPPPASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040162_LHBs_P-C Product feature CHAIN JQ040162_LHBs_P-C of FT:mat_peptide JQ040162_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G216). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040163_LHBs_P-C Product feature CHAIN JQ040163_LHBs_P-C of FT:mat_peptide JQ040163_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G217). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040165_LHBs_P-C Product feature CHAIN JQ040165_LHBs_P-C of FT:mat_peptide JQ040165_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G222). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGTGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040166_LHBs_P-C Product feature CHAIN JQ040166_LHBs_P-C of FT:mat_peptide JQ040166_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G223). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPAAPPPASTNRLSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040168_LHBs_P-C Product feature CHAIN JQ040168_LHBs_P-C of FT:mat_peptide JQ040168_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G233). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040172_LHBs_P-C Product feature CHAIN JQ040172_LHBs_P-C of FT:mat_peptide JQ040172_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G243). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGXSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRLPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341610_LHBs_P-C Product feature CHAIN JQ341610_LHBs_P-C of FT:mat_peptide JQ341610_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno01). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
XGXWXSXXXQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGILGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
XSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGAPXCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFXLWVYX
>gnl|hbvpro|JQ341611_LHBs_P-C Product feature CHAIN JQ341611_LHBs_P-C of FT:mat_peptide JQ341611_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno02). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341613_LHBs_P-C Product feature CHAIN JQ341613_LHBs_P-C of FT:mat_peptide JQ341613_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno04). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341614_LHBs_P-C Product feature CHAIN JQ341614_LHBs_P-C of FT:mat_peptide JQ341614_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno05). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRXGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
XTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341615_LHBs_P-C Product feature CHAIN JQ341615_LHBs_P-C of FT:mat_peptide JQ341615_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno06). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341616_LHBs_P-C Product feature CHAIN JQ341616_LHBs_P-C of FT:mat_peptide JQ341616_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno07). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFLRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341617_LHBs_P-C Product feature CHAIN JQ341617_LHBs_P-C of FT:mat_peptide JQ341617_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno08). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRXGMGTNLSVPNPLGFFPXHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341618_LHBs_P-C Product feature CHAIN JQ341618_LHBs_P-C of FT:mat_peptide JQ341618_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno09). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFXANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCXTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341620_LHBs_P-C Product feature CHAIN JQ341620_LHBs_P-C of FT:mat_peptide JQ341620_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFGDHQLDPTFRANSNNPDWDLNPNKDPWPAANQVGVGXFGPGFTPPHGNLLGWSPQ
AQGILTTXPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQTLLDPRVKGLYFPAGGSSSXTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLXSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341621_LHBs_P-C Product feature CHAIN JQ341621_LHBs_P-C of FT:mat_peptide JQ341621_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEAHQVGVGSFGPGFTPPHGXLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRXPTPISPPLRDSHPQAXQWNSSTFHQALLDPXVRGLYXPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPKCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLXFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341622_LHBs_P-C Product feature CHAIN JQ341622_LHBs_P-C of FT:mat_peptide JQ341622_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASP
ISSIFSRTGDPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341624_LHBs_P-C Product feature CHAIN JQ341624_LHBs_P-C of FT:mat_peptide JQ341624_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRXGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVXAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSXFPSCCCTKPSDGN
CTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341626_LHBs_P-C Product feature CHAIN JQ341626_LHBs_P-C of FT:mat_peptide JQ341626_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno17). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPIXPPLRBSHPQAMQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGXNLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341628_LHBs_P-C Product feature CHAIN JQ341628_LHBs_P-C of FT:mat_peptide JQ341628_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRXGMGTNLAVPNPLGFFPXHQLDPAFRANSNNPDWDXNPNKDXWPXAXQVGVGXXGPGFTPPHGXLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAXQWNSXTFHQALTDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGXSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341630_LHBs_P-C Product feature CHAIN JQ341630_LHBs_P-C of FT:mat_peptide JQ341630_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGPXSKPRKGMGTNLAVPNPLGFFPDHQLDLAFRANSDNPDWDFNPNKDPWPEANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPXMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTXSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341631_LHBs_P-C Product feature CHAIN JQ341631_LHBs_P-C of FT:mat_peptide JQ341631_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLXVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPEANQVGVGSFGPGFTPPHGXLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQXNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHXPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLXVLLDYXGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341632_LHBs_P-C Product feature CHAIN JQ341632_LHBs_P-C of FT:mat_peptide JQ341632_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno23). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKDPWPEAWQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMIPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVSI
>gnl|hbvpro|JQ341633_LHBs_P-C Product feature CHAIN JQ341633_LHBs_P-C of FT:mat_peptide JQ341633_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGXXSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTIPXAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNXQSPTSNHSPTSCP
PICPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTXTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341634_LHBs_P-C Product feature CHAIN JQ341634_LHBs_P-C of FT:mat_peptide JQ341634_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno25). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGRSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHXALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PXCPGYRWMCLRRFIIFLFILLLCLXFXLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPARNTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWAYI
>gnl|hbvpro|JQ341635_LHBs_P-C Product feature CHAIN JQ341635_LHBs_P-C of FT:mat_peptide JQ341635_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDSHPQAMQWXXXXXXXXXXXXXXXGPYLLAGGSSSETVNPVPTTASP
ISSTSSMTGDPAPNMESTTLGFLGPPHVLQEGFSLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCP
LICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTNSTGPCKTCTIPAQGTSMFPSCCCTKPSDRN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVFI
>gnl|hbvpro|JQ341636_LHBs_P-C Product feature CHAIN JQ341636_LHBs_P-C of FT:mat_peptide JQ341636_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341637_LHBs_P-C Product feature CHAIN JQ341637_LHBs_P-C of FT:mat_peptide JQ341637_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno28). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341639_LHBs_P-C Product feature CHAIN JQ341639_LHBs_P-C of FT:mat_peptide JQ341639_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGXXSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341641_LHBs_P-C Product feature CHAIN JQ341641_LHBs_P-C of FT:mat_peptide JQ341641_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTXASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341642_LHBs_P-C Product feature CHAIN JQ341642_LHBs_P-C of FT:mat_peptide JQ341642_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341643_LHBs_P-C Product feature CHAIN JQ341643_LHBs_P-C of FT:mat_peptide JQ341643_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLXGTSTXSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341644_LHBs_P-C Product feature CHAIN JQ341644_LHBs_P-C of FT:mat_peptide JQ341644_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno35). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341648_LHBs_P-C Product feature CHAIN JQ341648_LHBs_P-C of FT:mat_peptide JQ341648_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno39). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341649_LHBs_P-C Product feature CHAIN JQ341649_LHBs_P-C of FT:mat_peptide JQ341649_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno40). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVXVGXFGPGFTPPHGXLLGWSPX
AQGILTTXPAXPPPASTNRQSGRQPTPISPPLRDSHPXAXQWNXXTFHQALLDXKVRGLYFPAGGSSSGTVNPVPTTXSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGXPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIXFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYNILNPFLPLLPIFXCLWVYI
>gnl|hbvpro|JQ341650_LHBs_P-C Product feature CHAIN JQ341650_LHBs_P-C of FT:mat_peptide JQ341650_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNSDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPTASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALXCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILXPFXPLLPIFFCLWVYX
>gnl|hbvpro|JQ341651_LHBs_P-C Product feature CHAIN JQ341651_LHBs_P-C of FT:mat_peptide JQ341651_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAAXQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPXSPPLRDSHPQAIQWNSSTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAXFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341652_LHBs_P-C Product feature CHAIN JQ341652_LHBs_P-C of FT:mat_peptide JQ341652_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHXXXXXXXXXXXXXPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIICLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341653_LHBs_P-C Product feature CHAIN JQ341653_LHBs_P-C of FT:mat_peptide JQ341653_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno44). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQALQWXXGTFHQALLDPRGRGLYFPAGGSSSRTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNIXXPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341654_LHBs_P-C Product feature CHAIN JQ341654_LHBs_P-C of FT:mat_peptide JQ341654_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAQQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPXASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPVPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLFPIFFCLWVYI
>gnl|hbvpro|JQ341655_LHBs_P-C Product feature CHAIN JQ341655_LHBs_P-C of FT:mat_peptide JQ341655_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno46). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAXQWNSSTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLXPIFFCLWVYI
>gnl|hbvpro|JQ341657_LHBs_P-C Product feature CHAIN JQ341657_LHBs_P-C of FT:mat_peptide JQ341657_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGXLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQAXXXXXXXXXXXXAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341658_LHBs_P-C Product feature CHAIN JQ341658_LHBs_P-C of FT:mat_peptide JQ341658_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341659_LHBs_P-C Product feature CHAIN JQ341659_LHBs_P-C of FT:mat_peptide JQ341659_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPXHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGAGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341660_LHBs_P-C Product feature CHAIN JQ341660_LHBs_P-C of FT:mat_peptide JQ341660_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLXGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPISPPLRDSHPQAXQWNSSXFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PXCPGYRXMCLRRFIXFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSXGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXNTLXPXLPLLXIFFCLWVYI
>gnl|hbvpro|JQ341661_LHBs_P-C Product feature CHAIN JQ341661_LHBs_P-C of FT:mat_peptide JQ341661_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLXFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341662_LHBs_P-C Product feature CHAIN JQ341662_LHBs_P-C of FT:mat_peptide JQ341662_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno53). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKBHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341663_LHBs_P-C Product feature CHAIN JQ341663_LHBs_P-C of FT:mat_peptide JQ341663_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341664_LHBs_P-C Product feature CHAIN JQ341664_LHBs_P-C of FT:mat_peptide JQ341664_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGGLLGWSPQ
AQGILTTIPAAPPPASTNRQSGRQPTPISPPLRDSHPXAMQWNSSXFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341665_LHBs_P-C Product feature CHAIN JQ341665_LHBs_P-C of FT:mat_peptide JQ341665_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno56). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLXDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341669_LHBs_P-C Product feature CHAIN JQ341669_LHBs_P-C of FT:mat_peptide JQ341669_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno60). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGXSSKPRQGMGTNLSVPNPLGFFPXHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPGQNXQSPTSNHSPTSCP
PICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341670_LHBs_P-C Product feature CHAIN JQ341670_LHBs_P-C of FT:mat_peptide JQ341670_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCP
PIXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ412089_LHBs_P-C Product feature CHAIN JQ412089_LHBs_P-C of FT:mat_peptide JQ412089_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ688403_LHBs_P-C Product feature CHAIN JQ688403_LHBs_P-C of FT:mat_peptide JQ688403_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ688404_LHBs_P-C Product feature CHAIN JQ688404_LHBs_P-C of FT:mat_peptide JQ688404_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801470_LHBs_P-C Product feature CHAIN JQ801470_LHBs_P-C of FT:mat_peptide JQ801470_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801472_LHBs_P-C Product feature CHAIN JQ801472_LHBs_P-C of FT:mat_peptide JQ801472_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGAYSNNPDWDFNPNKDQWPAAKQVGAGAFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPISPPLRESHPQAMQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFARTGDPALNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFNILNPFLPLLPIFCCLWAYI
>gnl|hbvpro|JQ801473_LHBs_P-C Product feature CHAIN JQ801473_LHBs_P-C of FT:mat_peptide JQ801473_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFNILNPFLPLLPIFCCLWAYI
>gnl|hbvpro|JQ801475_LHBs_P-C Product feature CHAIN JQ801475_LHBs_P-C of FT:mat_peptide JQ801475_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFLRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801481_LHBs_P-C Product feature CHAIN JQ801481_LHBs_P-C of FT:mat_peptide JQ801481_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS26). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGAGAFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPAGGSSSETVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801482_LHBs_P-C Product feature CHAIN JQ801482_LHBs_P-C of FT:mat_peptide JQ801482_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS27). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRRGMGTNLAVPNPLGFFPDHQLDPAFRANSNNPDWDLNPNKDPWPEAWQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTLPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801486_LHBs_P-C Product feature CHAIN JQ801486_LHBs_P-C of FT:mat_peptide JQ801486_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS33). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801488_LHBs_P-C Product feature CHAIN JQ801488_LHBs_P-C of FT:mat_peptide JQ801488_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS35). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQTGRQPTPISPPLRDSHPQAMQWNSRTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801490_LHBs_P-C Product feature CHAIN JQ801490_LHBs_P-C of FT:mat_peptide JQ801490_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS37). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTNPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801491_LHBs_P-C Product feature CHAIN JQ801491_LHBs_P-C of FT:mat_peptide JQ801491_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS38). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPPQGMGANLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILATMTAETPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLDFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTSCP
QICPGYRWMCLRRFIIFLFILLLCLTFWWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPYCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801493_LHBs_P-C Product feature CHAIN JQ801493_LHBs_P-C of FT:mat_peptide JQ801493_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS41). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPPQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFAQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFFPLLPIFFCLWVYI
>gnl|hbvpro|JQ801495_LHBs_P-C Product feature CHAIN JQ801495_LHBs_P-C of FT:mat_peptide JQ801495_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL2). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAWKWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801496_LHBs_P-C Product feature CHAIN JQ801496_LHBs_P-C of FT:mat_peptide JQ801496_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801497_LHBs_P-C Product feature CHAIN JQ801497_LHBs_P-C of FT:mat_peptide JQ801497_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL4). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASSNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFCCLWVYI
>gnl|hbvpro|JQ801498_LHBs_P-C Product feature CHAIN JQ801498_LHBs_P-C of FT:mat_peptide JQ801498_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNPNKDQWPAANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGALTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801500_LHBs_P-C Product feature CHAIN JQ801500_LHBs_P-C of FT:mat_peptide JQ801500_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801501_LHBs_P-C Product feature CHAIN JQ801501_LHBs_P-C of FT:mat_peptide JQ801501_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801502_LHBs_P-C Product feature CHAIN JQ801502_LHBs_P-C of FT:mat_peptide JQ801502_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFRPGFTPPRGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801503_LHBs_P-C Product feature CHAIN JQ801503_LHBs_P-C of FT:mat_peptide JQ801503_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801504_LHBs_P-C Product feature CHAIN JQ801504_LHBs_P-C of FT:mat_peptide JQ801504_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWYSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSTGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801505_LHBs_P-C Product feature CHAIN JQ801505_LHBs_P-C of FT:mat_peptide JQ801505_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL12). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801511_LHBs_P-C Product feature CHAIN JQ801511_LHBs_P-C of FT:mat_peptide JQ801511_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801513_LHBs_P-C Product feature CHAIN JQ801513_LHBs_P-C of FT:mat_peptide JQ801513_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL21). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801515_LHBs_P-C Product feature CHAIN JQ801515_LHBs_P-C of FT:mat_peptide JQ801515_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL23). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVQTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801518_LHBs_P-C Product feature CHAIN JQ801518_LHBs_P-C of FT:mat_peptide JQ801518_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL26). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801519_LHBs_P-C Product feature CHAIN JQ801519_LHBs_P-C of FT:mat_peptide JQ801519_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL27). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801520_LHBs_P-C Product feature CHAIN JQ801520_LHBs_P-C of FT:mat_peptide JQ801520_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL28). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRHGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801522_LHBs_P-C Product feature CHAIN JQ801522_LHBs_P-C of FT:mat_peptide JQ801522_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL30). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPQQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801523_LHBs_P-C Product feature CHAIN JQ801523_LHBs_P-C of FT:mat_peptide JQ801523_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL31). Complete genome. [Hepadnaviridae] (length=400 residues).
MGRRSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX026877_LHBs_P-C Product feature CHAIN JX026877_LHBs_P-C of FT:mat_peptide JX026877_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPRLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGEAPACPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLALVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYTILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|JX026878_LHBs_P-C Product feature CHAIN JX026878_LHBs_P-C of FT:mat_peptide JX026878_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX026880_LHBs_P-C Product feature CHAIN JX026880_LHBs_P-C of FT:mat_peptide JX026880_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-23). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGDWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX026884_LHBs_P-C Product feature CHAIN JX026884_LHBs_P-C of FT:mat_peptide JX026884_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-60). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGVLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX026888_LHBs_P-C Product feature CHAIN JX026888_LHBs_P-C of FT:mat_peptide JX026888_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-3). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX036326_LHBs_P-C Product feature CHAIN JX036326_LHBs_P-C of FT:mat_peptide JX036326_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-6). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGTGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRLPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCIKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX036327_LHBs_P-C Product feature CHAIN JX036327_LHBs_P-C of FT:mat_peptide JX036327_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-9). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRRGTGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125365_LHBs_P-C Product feature CHAIN JX125365_LHBs_P-C of FT:mat_peptide JX125365_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I-NUK14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGRFCKPRQGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125366_LHBs_P-C Product feature CHAIN JX125366_LHBs_P-C of FT:mat_peptide JX125366_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y-KR217). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMKRFWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|JX125370_LHBs_P-C Product feature CHAIN JX125370_LHBs_P-C of FT:mat_peptide JX125370_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU540). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSISGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125371_LHBs_P-C Product feature CHAIN JX125371_LHBs_P-C of FT:mat_peptide JX125371_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU163). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTMPATPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125372_LHBs_P-C Product feature CHAIN JX125372_LHBs_P-C of FT:mat_peptide JX125372_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGEVPACPGRNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125373_LHBs_P-C Product feature CHAIN JX125373_LHBs_P-C of FT:mat_peptide JX125373_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU62). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125374_LHBs_P-C Product feature CHAIN JX125374_LHBs_P-C of FT:mat_peptide JX125374_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU70). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125375_LHBs_P-C Product feature CHAIN JX125375_LHBs_P-C of FT:mat_peptide JX125375_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU73). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAVPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429903_LHBs_P-C Product feature CHAIN JX429903_LHBs_P-C of FT:mat_peptide JX429903_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-42). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429904_LHBs_P-C Product feature CHAIN JX429904_LHBs_P-C of FT:mat_peptide JX429904_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-46). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429905_LHBs_P-C Product feature CHAIN JX429905_LHBs_P-C of FT:mat_peptide JX429905_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-47). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429906_LHBs_P-C Product feature CHAIN JX429906_LHBs_P-C of FT:mat_peptide JX429906_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-48). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGSFGPGFTPPHGGLLGWSPQ
AQGVLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429907_LHBs_P-C Product feature CHAIN JX429907_LHBs_P-C of FT:mat_peptide JX429907_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-50). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHRVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429909_LHBs_P-C Product feature CHAIN JX429909_LHBs_P-C of FT:mat_peptide JX429909_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-59). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429912_LHBs_P-C Product feature CHAIN JX429912_LHBs_P-C of FT:mat_peptide JX429912_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-6). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGLLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429913_LHBs_P-C Product feature CHAIN JX429913_LHBs_P-C of FT:mat_peptide JX429913_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLLILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPFCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|JX429914_LHBs_P-C Product feature CHAIN JX429914_LHBs_P-C of FT:mat_peptide JX429914_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-13). Non-functional genomic sequence. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASP
TSSIFSRTGDPAQNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCPIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429915_LHBs_P-C Product feature CHAIN JX429915_LHBs_P-C of FT:mat_peptide JX429915_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|JX429916_LHBs_P-C Product feature CHAIN JX429916_LHBs_P-C of FT:mat_peptide JX429916_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-35). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWSSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429917_LHBs_P-C Product feature CHAIN JX429917_LHBs_P-C of FT:mat_peptide JX429917_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-36). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429918_LHBs_P-C Product feature CHAIN JX429918_LHBs_P-C of FT:mat_peptide JX429918_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-44). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504534_LHBs_P-C Product feature CHAIN JX504534_LHBs_P-C of FT:mat_peptide JX504534_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-19). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPIAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPGVRGLYLPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504535_LHBs_P-C Product feature CHAIN JX504535_LHBs_P-C of FT:mat_peptide JX504535_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-31). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSQTSCP
PICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504536_LHBs_P-C Product feature CHAIN JX504536_LHBs_P-C of FT:mat_peptide JX504536_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-44). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPSASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGQSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504537_LHBs_P-C Product feature CHAIN JX504537_LHBs_P-C of FT:mat_peptide JX504537_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-49). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPASPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPTQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504539_LHBs_P-C Product feature CHAIN JX504539_LHBs_P-C of FT:mat_peptide JX504539_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-1). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGSSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504541_LHBs_P-C Product feature CHAIN JX504541_LHBs_P-C of FT:mat_peptide JX504541_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPLAVQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPPSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504542_LHBs_P-C Product feature CHAIN JX504542_LHBs_P-C of FT:mat_peptide JX504542_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-17). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504544_LHBs_P-C Product feature CHAIN JX504544_LHBs_P-C of FT:mat_peptide JX504544_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504545_LHBs_P-C Product feature CHAIN JX504545_LHBs_P-C of FT:mat_peptide JX504545_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-37). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504546_LHBs_P-C Product feature CHAIN JX504546_LHBs_P-C of FT:mat_peptide JX504546_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-40). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX507211_LHBs_P-C Product feature CHAIN JX507211_LHBs_P-C of FT:mat_peptide JX507211_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPXANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILXTLPXTPPTASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX507212_LHBs_P-C Product feature CHAIN JX507212_LHBs_P-C of FT:mat_peptide JX507212_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAVQWNSSTFHLALLDPRVRGLYFPAGGSSSGTXNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTXCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX507214_LHBs_P-C Product feature CHAIN JX507214_LHBs_P-C of FT:mat_peptide JX507214_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 99). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNQDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX560519_LHBs_P-C Product feature CHAIN JX560519_LHBs_P-C of FT:mat_peptide JX560519_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH76). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASP
ISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX560520_LHBs_P-C Product feature CHAIN JX560520_LHBs_P-C of FT:mat_peptide JX560520_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH139). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661488_LHBs_P-C Product feature CHAIN JX661488_LHBs_P-C of FT:mat_peptide JX661488_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1212-C5). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661489_LHBs_P-C Product feature CHAIN JX661489_LHBs_P-C of FT:mat_peptide JX661489_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1218-C9). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCHIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661490_LHBs_P-C Product feature CHAIN JX661490_LHBs_P-C of FT:mat_peptide JX661490_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1217-C8). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661491_LHBs_P-C Product feature CHAIN JX661491_LHBs_P-C of FT:mat_peptide JX661491_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1222-C10). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASP
ISSIFSRTGDPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661492_LHBs_P-C Product feature CHAIN JX661492_LHBs_P-C of FT:mat_peptide JX661492_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1215-C7). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661493_LHBs_P-C Product feature CHAIN JX661493_LHBs_P-C of FT:mat_peptide JX661493_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1226-C13). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661495_LHBs_P-C Product feature CHAIN JX661495_LHBs_P-C of FT:mat_peptide JX661495_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1223-C11). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661497_LHBs_P-C Product feature CHAIN JX661497_LHBs_P-C of FT:mat_peptide JX661497_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1228-C14). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGDLLGWSPQ
AQGILTTVPAAPPPVSTNRQSGRQPTPISPPLRDSHPQAAQWNSITFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGIPACPGQNSQSPTSNHSLTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX870000_LHBs_P-C Product feature CHAIN JX870000_LHBs_P-C of FT:mat_peptide JX870000_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 245). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPITPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC315399_LHBs_P-C Product feature CHAIN KC315399_LHBs_P-C of FT:mat_peptide KC315399_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0507). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGAFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774179_LHBs_P-C Product feature CHAIN KC774179_LHBs_P-C of FT:mat_peptide KC774179_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SX11xa1580). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSPTPRQGKGTNLSVPNPLGFFPDHQLDRAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQAPLNPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774180_LHBs_P-C Product feature CHAIN KC774180_LHBs_P-C of FT:mat_peptide KC774180_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1002). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774181_LHBs_P-C Product feature CHAIN KC774181_LHBs_P-C of FT:mat_peptide KC774181_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1012). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774182_LHBs_P-C Product feature CHAIN KC774182_LHBs_P-C of FT:mat_peptide KC774182_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1013). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774184_LHBs_P-C Product feature CHAIN KC774184_LHBs_P-C of FT:mat_peptide KC774184_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1022). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774185_LHBs_P-C Product feature CHAIN KC774185_LHBs_P-C of FT:mat_peptide KC774185_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1023). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774187_LHBs_P-C Product feature CHAIN KC774187_LHBs_P-C of FT:mat_peptide KC774187_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1027). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGVLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774189_LHBs_P-C Product feature CHAIN KC774189_LHBs_P-C of FT:mat_peptide KC774189_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1030). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNPNKDPWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774190_LHBs_P-C Product feature CHAIN KC774190_LHBs_P-C of FT:mat_peptide KC774190_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1031). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774191_LHBs_P-C Product feature CHAIN KC774191_LHBs_P-C of FT:mat_peptide KC774191_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1032). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774192_LHBs_P-C Product feature CHAIN KC774192_LHBs_P-C of FT:mat_peptide KC774192_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1034). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774194_LHBs_P-C Product feature CHAIN KC774194_LHBs_P-C of FT:mat_peptide KC774194_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1036). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTIFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774195_LHBs_P-C Product feature CHAIN KC774195_LHBs_P-C of FT:mat_peptide KC774195_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1046). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774196_LHBs_P-C Product feature CHAIN KC774196_LHBs_P-C of FT:mat_peptide KC774196_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2015). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFSPPHGGVLGWSPQ
AQGILATVPAAPPSASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASL
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774197_LHBs_P-C Product feature CHAIN KC774197_LHBs_P-C of FT:mat_peptide KC774197_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2035). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGSFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774199_LHBs_P-C Product feature CHAIN KC774199_LHBs_P-C of FT:mat_peptide KC774199_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2040). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774200_LHBs_P-C Product feature CHAIN KC774200_LHBs_P-C of FT:mat_peptide KC774200_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2044). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGVLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774202_LHBs_P-C Product feature CHAIN KC774202_LHBs_P-C of FT:mat_peptide KC774202_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2048). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774203_LHBs_P-C Product feature CHAIN KC774203_LHBs_P-C of FT:mat_peptide KC774203_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2051). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774204_LHBs_P-C Product feature CHAIN KC774204_LHBs_P-C of FT:mat_peptide KC774204_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2056). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNIWSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774205_LHBs_P-C Product feature CHAIN KC774205_LHBs_P-C of FT:mat_peptide KC774205_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2058). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNIWSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774206_LHBs_P-C Product feature CHAIN KC774206_LHBs_P-C of FT:mat_peptide KC774206_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2079). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774207_LHBs_P-C Product feature CHAIN KC774207_LHBs_P-C of FT:mat_peptide KC774207_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2084). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774208_LHBs_P-C Product feature CHAIN KC774208_LHBs_P-C of FT:mat_peptide KC774208_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2086). Complete genome. [Hepadnaviridae] (length=400 residues).
MGSWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPVRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774209_LHBs_P-C Product feature CHAIN KC774209_LHBs_P-C of FT:mat_peptide KC774209_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2087). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774210_LHBs_P-C Product feature CHAIN KC774210_LHBs_P-C of FT:mat_peptide KC774210_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2098). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTAVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774211_LHBs_P-C Product feature CHAIN KC774211_LHBs_P-C of FT:mat_peptide KC774211_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2114). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPTAPPPAFTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774213_LHBs_P-C Product feature CHAIN KC774213_LHBs_P-C of FT:mat_peptide KC774213_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2123). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAHGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774214_LHBs_P-C Product feature CHAIN KC774214_LHBs_P-C of FT:mat_peptide KC774214_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2124). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPSASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNRVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAHGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774215_LHBs_P-C Product feature CHAIN KC774215_LHBs_P-C of FT:mat_peptide KC774215_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2125). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQAGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774216_LHBs_P-C Product feature CHAIN KC774216_LHBs_P-C of FT:mat_peptide KC774216_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2126). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQAGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774217_LHBs_P-C Product feature CHAIN KC774217_LHBs_P-C of FT:mat_peptide KC774217_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2129). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQRMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774218_LHBs_P-C Product feature CHAIN KC774218_LHBs_P-C of FT:mat_peptide KC774218_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2134). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774219_LHBs_P-C Product feature CHAIN KC774219_LHBs_P-C of FT:mat_peptide KC774219_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2144). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774220_LHBs_P-C Product feature CHAIN KC774220_LHBs_P-C of FT:mat_peptide KC774220_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2152). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774221_LHBs_P-C Product feature CHAIN KC774221_LHBs_P-C of FT:mat_peptide KC774221_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2153). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPKKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774223_LHBs_P-C Product feature CHAIN KC774223_LHBs_P-C of FT:mat_peptide KC774223_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2183). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774224_LHBs_P-C Product feature CHAIN KC774224_LHBs_P-C of FT:mat_peptide KC774224_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2184). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774225_LHBs_P-C Product feature CHAIN KC774225_LHBs_P-C of FT:mat_peptide KC774225_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2188). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774226_LHBs_P-C Product feature CHAIN KC774226_LHBs_P-C of FT:mat_peptide KC774226_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2194). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774227_LHBs_P-C Product feature CHAIN KC774227_LHBs_P-C of FT:mat_peptide KC774227_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1009). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774228_LHBs_P-C Product feature CHAIN KC774228_LHBs_P-C of FT:mat_peptide KC774228_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1023). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774229_LHBs_P-C Product feature CHAIN KC774229_LHBs_P-C of FT:mat_peptide KC774229_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1024). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774231_LHBs_P-C Product feature CHAIN KC774231_LHBs_P-C of FT:mat_peptide KC774231_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1028). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSITFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774232_LHBs_P-C Product feature CHAIN KC774232_LHBs_P-C of FT:mat_peptide KC774232_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1031). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774233_LHBs_P-C Product feature CHAIN KC774233_LHBs_P-C of FT:mat_peptide KC774233_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1035). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774235_LHBs_P-C Product feature CHAIN KC774235_LHBs_P-C of FT:mat_peptide KC774235_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1041). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774236_LHBs_P-C Product feature CHAIN KC774236_LHBs_P-C of FT:mat_peptide KC774236_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1042). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDLAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774237_LHBs_P-C Product feature CHAIN KC774237_LHBs_P-C of FT:mat_peptide KC774237_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1051). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774238_LHBs_P-C Product feature CHAIN KC774238_LHBs_P-C of FT:mat_peptide KC774238_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1052). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774239_LHBs_P-C Product feature CHAIN KC774239_LHBs_P-C of FT:mat_peptide KC774239_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1063). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774240_LHBs_P-C Product feature CHAIN KC774240_LHBs_P-C of FT:mat_peptide KC774240_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1066). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774241_LHBs_P-C Product feature CHAIN KC774241_LHBs_P-C of FT:mat_peptide KC774241_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1067). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774242_LHBs_P-C Product feature CHAIN KC774242_LHBs_P-C of FT:mat_peptide KC774242_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1070). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774243_LHBs_P-C Product feature CHAIN KC774243_LHBs_P-C of FT:mat_peptide KC774243_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1007). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774244_LHBs_P-C Product feature CHAIN KC774244_LHBs_P-C of FT:mat_peptide KC774244_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1012). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774245_LHBs_P-C Product feature CHAIN KC774245_LHBs_P-C of FT:mat_peptide KC774245_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1013). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774247_LHBs_P-C Product feature CHAIN KC774247_LHBs_P-C of FT:mat_peptide KC774247_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1021). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774248_LHBs_P-C Product feature CHAIN KC774248_LHBs_P-C of FT:mat_peptide KC774248_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1026). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774249_LHBs_P-C Product feature CHAIN KC774249_LHBs_P-C of FT:mat_peptide KC774249_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1027). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774250_LHBs_P-C Product feature CHAIN KC774250_LHBs_P-C of FT:mat_peptide KC774250_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1029). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774251_LHBs_P-C Product feature CHAIN KC774251_LHBs_P-C of FT:mat_peptide KC774251_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1030). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774252_LHBs_P-C Product feature CHAIN KC774252_LHBs_P-C of FT:mat_peptide KC774252_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1031). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGGPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774253_LHBs_P-C Product feature CHAIN KC774253_LHBs_P-C of FT:mat_peptide KC774253_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1039). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSRSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAKGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774254_LHBs_P-C Product feature CHAIN KC774254_LHBs_P-C of FT:mat_peptide KC774254_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1046). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774255_LHBs_P-C Product feature CHAIN KC774255_LHBs_P-C of FT:mat_peptide KC774255_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1050). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774256_LHBs_P-C Product feature CHAIN KC774256_LHBs_P-C of FT:mat_peptide KC774256_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1053). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774257_LHBs_P-C Product feature CHAIN KC774257_LHBs_P-C of FT:mat_peptide KC774257_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1056). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774259_LHBs_P-C Product feature CHAIN KC774259_LHBs_P-C of FT:mat_peptide KC774259_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1061). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774260_LHBs_P-C Product feature CHAIN KC774260_LHBs_P-C of FT:mat_peptide KC774260_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1065). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILSTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774261_LHBs_P-C Product feature CHAIN KC774261_LHBs_P-C of FT:mat_peptide KC774261_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1067). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFSPPHGGVLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774262_LHBs_P-C Product feature CHAIN KC774262_LHBs_P-C of FT:mat_peptide KC774262_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1068). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFSPPHGGVLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774264_LHBs_P-C Product feature CHAIN KC774264_LHBs_P-C of FT:mat_peptide KC774264_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1072). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774265_LHBs_P-C Product feature CHAIN KC774265_LHBs_P-C of FT:mat_peptide KC774265_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1074). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774266_LHBs_P-C Product feature CHAIN KC774266_LHBs_P-C of FT:mat_peptide KC774266_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1075). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774267_LHBs_P-C Product feature CHAIN KC774267_LHBs_P-C of FT:mat_peptide KC774267_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1084). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILSTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIYSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774268_LHBs_P-C Product feature CHAIN KC774268_LHBs_P-C of FT:mat_peptide KC774268_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1085). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWLSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774269_LHBs_P-C Product feature CHAIN KC774269_LHBs_P-C of FT:mat_peptide KC774269_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1086). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLVGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMKWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIAANGTSMFPSCCCTKPSDRN
CTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774270_LHBs_P-C Product feature CHAIN KC774270_LHBs_P-C of FT:mat_peptide KC774270_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1093). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774271_LHBs_P-C Product feature CHAIN KC774271_LHBs_P-C of FT:mat_peptide KC774271_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1094). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774272_LHBs_P-C Product feature CHAIN KC774272_LHBs_P-C of FT:mat_peptide KC774272_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1107). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774274_LHBs_P-C Product feature CHAIN KC774274_LHBs_P-C of FT:mat_peptide KC774274_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1124). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774275_LHBs_P-C Product feature CHAIN KC774275_LHBs_P-C of FT:mat_peptide KC774275_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1126). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774276_LHBs_P-C Product feature CHAIN KC774276_LHBs_P-C of FT:mat_peptide KC774276_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1128). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGITPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774277_LHBs_P-C Product feature CHAIN KC774277_LHBs_P-C of FT:mat_peptide KC774277_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2151). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVLP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774278_LHBs_P-C Product feature CHAIN KC774278_LHBs_P-C of FT:mat_peptide KC774278_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2155). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGVLGWSPQ
AQGILATVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774279_LHBs_P-C Product feature CHAIN KC774279_LHBs_P-C of FT:mat_peptide KC774279_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2157). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774280_LHBs_P-C Product feature CHAIN KC774280_LHBs_P-C of FT:mat_peptide KC774280_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1053). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774281_LHBs_P-C Product feature CHAIN KC774281_LHBs_P-C of FT:mat_peptide KC774281_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1058). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFLPGHQLDPAFGANSNNPDWDFNPKKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFRQALLDPRVRGLYFPAGGSSSGTVNPVPITASP
ISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDAN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774282_LHBs_P-C Product feature CHAIN KC774282_LHBs_P-C of FT:mat_peptide KC774282_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1060). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774283_LHBs_P-C Product feature CHAIN KC774283_LHBs_P-C of FT:mat_peptide KC774283_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1062). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774284_LHBs_P-C Product feature CHAIN KC774284_LHBs_P-C of FT:mat_peptide KC774284_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1065). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVTPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774285_LHBs_P-C Product feature CHAIN KC774285_LHBs_P-C of FT:mat_peptide KC774285_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1067). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774286_LHBs_P-C Product feature CHAIN KC774286_LHBs_P-C of FT:mat_peptide KC774286_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1076). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774287_LHBs_P-C Product feature CHAIN KC774287_LHBs_P-C of FT:mat_peptide KC774287_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1087). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774288_LHBs_P-C Product feature CHAIN KC774288_LHBs_P-C of FT:mat_peptide KC774288_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1175). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPHASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPTLPIFFCLWVYI
>gnl|hbvpro|KC774289_LHBs_P-C Product feature CHAIN KC774289_LHBs_P-C of FT:mat_peptide KC774289_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1180). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILKTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCHIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQNTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774290_LHBs_P-C Product feature CHAIN KC774290_LHBs_P-C of FT:mat_peptide KC774290_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1183). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLILLVPFVQWFVWPSPTVWFSIIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774292_LHBs_P-C Product feature CHAIN KC774292_LHBs_P-C of FT:mat_peptide KC774292_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1196). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774293_LHBs_P-C Product feature CHAIN KC774293_LHBs_P-C of FT:mat_peptide KC774293_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1204). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774295_LHBs_P-C Product feature CHAIN KC774295_LHBs_P-C of FT:mat_peptide KC774295_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1207). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774296_LHBs_P-C Product feature CHAIN KC774296_LHBs_P-C of FT:mat_peptide KC774296_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1210). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMRWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774297_LHBs_P-C Product feature CHAIN KC774297_LHBs_P-C of FT:mat_peptide KC774297_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1580). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGKGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQAPLNPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774298_LHBs_P-C Product feature CHAIN KC774298_LHBs_P-C of FT:mat_peptide KC774298_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1586). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774299_LHBs_P-C Product feature CHAIN KC774299_LHBs_P-C of FT:mat_peptide KC774299_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1601). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774300_LHBs_P-C Product feature CHAIN KC774300_LHBs_P-C of FT:mat_peptide KC774300_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1602). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774301_LHBs_P-C Product feature CHAIN KC774301_LHBs_P-C of FT:mat_peptide KC774301_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1627). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774302_LHBs_P-C Product feature CHAIN KC774302_LHBs_P-C of FT:mat_peptide KC774302_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1650). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774303_LHBs_P-C Product feature CHAIN KC774303_LHBs_P-C of FT:mat_peptide KC774303_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1659). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGIVTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774304_LHBs_P-C Product feature CHAIN KC774304_LHBs_P-C of FT:mat_peptide KC774304_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1662). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774306_LHBs_P-C Product feature CHAIN KC774306_LHBs_P-C of FT:mat_peptide KC774306_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2006). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGSYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPGQNSRSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGSSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774308_LHBs_P-C Product feature CHAIN KC774308_LHBs_P-C of FT:mat_peptide KC774308_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2019). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPKANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774309_LHBs_P-C Product feature CHAIN KC774309_LHBs_P-C of FT:mat_peptide KC774309_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2020). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGLGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774310_LHBs_P-C Product feature CHAIN KC774310_LHBs_P-C of FT:mat_peptide KC774310_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2022). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774311_LHBs_P-C Product feature CHAIN KC774311_LHBs_P-C of FT:mat_peptide KC774311_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2026). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774312_LHBs_P-C Product feature CHAIN KC774312_LHBs_P-C of FT:mat_peptide KC774312_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2029). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774313_LHBs_P-C Product feature CHAIN KC774313_LHBs_P-C of FT:mat_peptide KC774313_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2032). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPTVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774314_LHBs_P-C Product feature CHAIN KC774314_LHBs_P-C of FT:mat_peptide KC774314_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2033). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774315_LHBs_P-C Product feature CHAIN KC774315_LHBs_P-C of FT:mat_peptide KC774315_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2039). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774316_LHBs_P-C Product feature CHAIN KC774316_LHBs_P-C of FT:mat_peptide KC774316_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2041). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774318_LHBs_P-C Product feature CHAIN KC774318_LHBs_P-C of FT:mat_peptide KC774318_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2043). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGTLTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774319_LHBs_P-C Product feature CHAIN KC774319_LHBs_P-C of FT:mat_peptide KC774319_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2044). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQVGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFVKFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774320_LHBs_P-C Product feature CHAIN KC774320_LHBs_P-C of FT:mat_peptide KC774320_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2051). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774321_LHBs_P-C Product feature CHAIN KC774321_LHBs_P-C of FT:mat_peptide KC774321_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2052). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|KC774325_LHBs_P-C Product feature CHAIN KC774325_LHBs_P-C of FT:mat_peptide KC774325_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2063). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPAANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSLFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774326_LHBs_P-C Product feature CHAIN KC774326_LHBs_P-C of FT:mat_peptide KC774326_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2067). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774327_LHBs_P-C Product feature CHAIN KC774327_LHBs_P-C of FT:mat_peptide KC774327_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2069). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774329_LHBs_P-C Product feature CHAIN KC774329_LHBs_P-C of FT:mat_peptide KC774329_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2074). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774330_LHBs_P-C Product feature CHAIN KC774330_LHBs_P-C of FT:mat_peptide KC774330_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2075). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774331_LHBs_P-C Product feature CHAIN KC774331_LHBs_P-C of FT:mat_peptide KC774331_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2077). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774333_LHBs_P-C Product feature CHAIN KC774333_LHBs_P-C of FT:mat_peptide KC774333_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1006). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPVAPPPASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774334_LHBs_P-C Product feature CHAIN KC774334_LHBs_P-C of FT:mat_peptide KC774334_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1007). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774335_LHBs_P-C Product feature CHAIN KC774335_LHBs_P-C of FT:mat_peptide KC774335_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1013). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPATPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALP
TSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGTCKTCTIPAQGPSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|KC774336_LHBs_P-C Product feature CHAIN KC774336_LHBs_P-C of FT:mat_peptide KC774336_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1015). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFSPPHGGVLGWSPQ
AQGILATVPAAPPSASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASL
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774337_LHBs_P-C Product feature CHAIN KC774337_LHBs_P-C of FT:mat_peptide KC774337_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1019). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGVLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774338_LHBs_P-C Product feature CHAIN KC774338_LHBs_P-C of FT:mat_peptide KC774338_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1027). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774339_LHBs_P-C Product feature CHAIN KC774339_LHBs_P-C of FT:mat_peptide KC774339_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1029). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774340_LHBs_P-C Product feature CHAIN KC774340_LHBs_P-C of FT:mat_peptide KC774340_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1034). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQ
AQGILTTVPAAPPPASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASP
ISSILSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774342_LHBs_P-C Product feature CHAIN KC774342_LHBs_P-C of FT:mat_peptide KC774342_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1044). Complete genome. [Hepadnaviridae] (length=400 residues).
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGVLGWSPQ
AQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASP
TSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCP
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGN
CTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774343_LHBs_P-C Product feature CHAIN KC774343_LHBs_P-C of FT:mat_peptide KC774343_LHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1046). Complete genome. [Hepadnaviridae] (length=400 residues).
MGG