HBVdb

Dataset for protein MHBs of genotype C

[Download (right click)] [Alignment] [Repertoires]

2781 sequence(s)

>gnl|hbvpro|AB014360_MHBs_P-C Product feature CHAIN AB014360_MHBs_P-C of FT:mat_peptide AB014360_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D01HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLSNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB014362_MHBs_P-C Product feature CHAIN AB014362_MHBs_P-C of FT:mat_peptide AB014362_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 03D03HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGPSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB014363_MHBs_P-C Product feature CHAIN AB014363_MHBs_P-C of FT:mat_peptide AB014363_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04D04HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASHISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLBSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSIFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|AB014364_MHBs_P-C Product feature CHAIN AB014364_MHBs_P-C of FT:mat_peptide AB014364_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 05D05HCC). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGXSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB014365_MHBs_P-C Product feature CHAIN AB014365_MHBs_P-C of FT:mat_peptide AB014365_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D06HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLNSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB014367_MHBs_P-C Product feature CHAIN AB014367_MHBs_P-C of FT:mat_peptide AB014367_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08D08HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGTCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014369_MHBs_P-C Product feature CHAIN AB014369_MHBs_P-C of FT:mat_peptide AB014369_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10D10HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPRSLDSWWTSLNFLGEAPXCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLXDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014371_MHBs_P-C Product feature CHAIN AB014371_MHBs_P-C of FT:mat_peptide AB014371_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 12D12HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLXPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014372_MHBs_P-C Product feature CHAIN AB014372_MHBs_P-C of FT:mat_peptide AB014372_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13D13HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSNSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFSLLTKI
LTIPQSLBSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGNSTIPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASARFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014374_MHBs_P-C Product feature CHAIN AB014374_MHBs_P-C of FT:mat_peptide AB014374_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 15D15HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014376_MHBs_P-C Product feature CHAIN AB014376_MHBs_P-C of FT:mat_peptide AB014376_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17T02HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014377_MHBs_P-C Product feature CHAIN AB014377_MHBs_P-C of FT:mat_peptide AB014377_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18T03HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014378_MHBs_P-C Product feature CHAIN AB014378_MHBs_P-C of FT:mat_peptide AB014378_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19Y01HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPKVRGLYLPAGGSSSGTENPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQRLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSRYNIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014379_MHBs_P-C Product feature CHAIN AB014379_MHBs_P-C of FT:mat_peptide AB014379_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 20Y02HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTXTTSTGPCKTCTSPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014380_MHBs_P-C Product feature CHAIN AB014380_MHBs_P-C of FT:mat_peptide AB014380_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 21Y03HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLNPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
RTIPQSLDSWWTSLNFLGGVPKCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB014381_MHBs_P-C Product feature CHAIN AB014381_MHBs_P-C of FT:mat_peptide AB014381_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 22Y04HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLHPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014382_MHBs_P-C Product feature CHAIN AB014382_MHBs_P-C of FT:mat_peptide AB014382_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23Y05HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPILSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPARNTSIFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014383_MHBs_P-C Product feature CHAIN AB014383_MHBs_P-C of FT:mat_peptide AB014383_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24Y06HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAQNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014384_MHBs_P-C Product feature CHAIN AB014384_MHBs_P-C of FT:mat_peptide AB014384_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 25Y07HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDXWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014385_MHBs_P-C Product feature CHAIN AB014385_MHBs_P-C of FT:mat_peptide AB014385_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26Y08HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGALKCPGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014389_MHBs_P-C Product feature CHAIN AB014389_MHBs_P-C of FT:mat_peptide AB014389_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30Y12HCC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCXPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014391_MHBs_P-C Product feature CHAIN AB014391_MHBs_P-C of FT:mat_peptide AB014391_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 32Y14HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGRNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQNNSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSXLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB014392_MHBs_P-C Product feature CHAIN AB014392_MHBs_P-C of FT:mat_peptide AB014392_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 33Y15HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLNSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB014393_MHBs_P-C Product feature CHAIN AB014393_MHBs_P-C of FT:mat_peptide AB014393_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 34Y16HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDLAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLILLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014394_MHBs_P-C Product feature CHAIN AB014394_MHBs_P-C of FT:mat_peptide AB014394_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35Y17HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDFQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014396_MHBs_P-C Product feature CHAIN AB014396_MHBs_P-C of FT:mat_peptide AB014396_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37Y19HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQSTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014399_MHBs_P-C Product feature CHAIN AB014399_MHBs_P-C of FT:mat_peptide AB014399_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 40Y22HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB026811_MHBs_P-C Product feature CHAIN AB026811_MHBs_P-C of FT:mat_peptide AB026811_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Feb.). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026812_MHBs_P-C Product feature CHAIN AB026812_MHBs_P-C of FT:mat_peptide AB026812_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;98.May). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026813_MHBs_P-C Product feature CHAIN AB026813_MHBs_P-C of FT:mat_peptide AB026813_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Sep.). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026814_MHBs_P-C Product feature CHAIN AB026814_MHBs_P-C of FT:mat_peptide AB026814_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Donor 3;98.May). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026815_MHBs_P-C Product feature CHAIN AB026815_MHBs_P-C of FT:mat_peptide AB026815_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 2:full). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB031262_MHBs_P-C Product feature CHAIN AB031262_MHBs_P-C of FT:mat_peptide AB031262_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV VietA-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSMGPCKTCTTPALGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB033550_MHBs_P-C Product feature CHAIN AB033550_MHBs_P-C of FT:mat_peptide AB033550_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NDR260). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAQNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB033551_MHBs_P-C Product feature CHAIN AB033551_MHBs_P-C of FT:mat_peptide AB033551_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK300). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKNRTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB033552_MHBs_P-C Product feature CHAIN AB033552_MHBs_P-C of FT:mat_peptide AB033552_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK494). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB033553_MHBs_P-C Product feature CHAIN AB033553_MHBs_P-C of FT:mat_peptide AB033553_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK619). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB033556_MHBs_P-C Product feature CHAIN AB033556_MHBs_P-C of FT:mat_peptide AB033556_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AK66). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB042282_MHBs_P-C Product feature CHAIN AB042282_MHBs_P-C of FT:mat_peptide AB042282_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB042283_MHBs_P-C Product feature CHAIN AB042283_MHBs_P-C of FT:mat_peptide AB042283_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB042284_MHBs_P-C Product feature CHAIN AB042284_MHBs_P-C of FT:mat_peptide AB042284_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB042285_MHBs_P-C Product feature CHAIN AB042285_MHBs_P-C of FT:mat_peptide AB042285_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MHWNSIKFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB049610_MHBs_P-C Product feature CHAIN AB049610_MHBs_P-C of FT:mat_peptide AB049610_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV AN29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPASNMESTTSGFLGPLLVLQAGFFLSTRI
LTIPQSLDSWWTSLSFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB050018_MHBs_P-C Product feature CHAIN AB050018_MHBs_P-C of FT:mat_peptide AB050018_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB074047_MHBs_P-C Product feature CHAIN AB074047_MHBs_P-C of FT:mat_peptide AB074047_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th11). Complete genome. [Hepadnaviridae] (length=280 residues).
MWNSSTFRQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRIL
TIPQSLDSWWTSLNFLREIPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLPV
CPLLPGTSTTSTGPCKTCTIPARNISMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVGL
SPTVWLSVIWMMWYWGPRLYTIVKPFLPLLPIFFYLWAYI
>gnl|hbvpro|AB074755_MHBs_P-C Product feature CHAIN AB074755_MHBs_P-C of FT:mat_peptide AB074755_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB074756_MHBs_P-C Product feature CHAIN AB074756_MHBs_P-C of FT:mat_peptide AB074756_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th55). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB105173_MHBs_P-C Product feature CHAIN AB105173_MHBs_P-C of FT:mat_peptide AB105173_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB105174_MHBs_P-C Product feature CHAIN AB105174_MHBs_P-C of FT:mat_peptide AB105174_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 60). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB106895_MHBs_P-C Product feature CHAIN AB106895_MHBs_P-C of FT:mat_peptide AB106895_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pHB4-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQRNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111114_MHBs_P-C Product feature CHAIN AB111114_MHBs_P-C of FT:mat_peptide AB111114_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRI
LTIPQRLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB111118_MHBs_P-C Product feature CHAIN AB111118_MHBs_P-C of FT:mat_peptide AB111118_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB111119_MHBs_P-C Product feature CHAIN AB111119_MHBs_P-C of FT:mat_peptide AB111119_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
VQWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLNLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111120_MHBs_P-C Product feature CHAIN AB111120_MHBs_P-C of FT:mat_peptide AB111120_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
VQWKSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111121_MHBs_P-C Product feature CHAIN AB111121_MHBs_P-C of FT:mat_peptide AB111121_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111122_MHBs_P-C Product feature CHAIN AB111122_MHBs_P-C of FT:mat_peptide AB111122_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSHTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111123_MHBs_P-C Product feature CHAIN AB111123_MHBs_P-C of FT:mat_peptide AB111123_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111124_MHBs_P-C Product feature CHAIN AB111124_MHBs_P-C of FT:mat_peptide AB111124_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMILYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111125_MHBs_P-C Product feature CHAIN AB111125_MHBs_P-C of FT:mat_peptide AB111125_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMILYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111946_MHBs_P-C Product feature CHAIN AB111946_MHBs_P-C of FT:mat_peptide AB111946_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT103). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVQTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112063_MHBs_P-C Product feature CHAIN AB112063_MHBs_P-C of FT:mat_peptide AB112063_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT101). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVQTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCSGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTQPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112065_MHBs_P-C Product feature CHAIN AB112065_MHBs_P-C of FT:mat_peptide AB112065_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT140). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTENPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMWP
VCPLLPGTSTTITGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112066_MHBs_P-C Product feature CHAIN AB112066_MHBs_P-C of FT:mat_peptide AB112066_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY624). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTITGPCKTCTNPAQGTSMFPSCCCTKPSDGNGTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112348_MHBs_P-C Product feature CHAIN AB112348_MHBs_P-C of FT:mat_peptide AB112348_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY656). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLEPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCSVQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPALGDSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112471_MHBs_P-C Product feature CHAIN AB112471_MHBs_P-C of FT:mat_peptide AB112471_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH123). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTWTNPAQGTSMFPSCWWTKPWDGKCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112472_MHBs_P-C Product feature CHAIN AB112472_MHBs_P-C of FT:mat_peptide AB112472_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH124). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB113875_MHBs_P-C Product feature CHAIN AB113875_MHBs_P-C of FT:mat_peptide AB113875_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB113876_MHBs_P-C Product feature CHAIN AB113876_MHBs_P-C of FT:mat_peptide AB113876_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB113878_MHBs_P-C Product feature CHAIN AB113878_MHBs_P-C of FT:mat_peptide AB113878_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB113879_MHBs_P-C Product feature CHAIN AB113879_MHBs_P-C of FT:mat_peptide AB113879_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB115417_MHBs_P-C Product feature CHAIN AB115417_MHBs_P-C of FT:mat_peptide AB115417_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-O47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKLRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQNLDSWWTSHSFLGGTPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLVVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQSTSMFPSWWWTKPSDGNCTCIPIPSSWAFARILWEWASVRFSWLSLLVPFVQWFVG
LPPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB117758_MHBs_P-C Product feature CHAIN AB117758_MHBs_P-C of FT:mat_peptide AB117758_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CB10). Complete genome. [Hepadnaviridae] (length=281 residues).
MLWNSATFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB176642_MHBs_P-C Product feature CHAIN AB176642_MHBs_P-C of FT:mat_peptide AB176642_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-115). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQXAFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLLNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB182589_MHBs_P-C Product feature CHAIN AB182589_MHBs_P-C of FT:mat_peptide AB182589_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CH:Mat-Ko). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTLCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195930_MHBs_P-C Product feature CHAIN AB195930_MHBs_P-C of FT:mat_peptide AB195930_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFVWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195931_MHBs_P-C Product feature CHAIN AB195931_MHBs_P-C of FT:mat_peptide AB195931_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195932_MHBs_P-C Product feature CHAIN AB195932_MHBs_P-C of FT:mat_peptide AB195932_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASFRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195936_MHBs_P-C Product feature CHAIN AB195936_MHBs_P-C of FT:mat_peptide AB195936_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195937_MHBs_P-C Product feature CHAIN AB195937_MHBs_P-C of FT:mat_peptide AB195937_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195938_MHBs_P-C Product feature CHAIN AB195938_MHBs_P-C of FT:mat_peptide AB195938_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195942_MHBs_P-C Product feature CHAIN AB195942_MHBs_P-C of FT:mat_peptide AB195942_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPISPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195943_MHBs_P-C Product feature CHAIN AB195943_MHBs_P-C of FT:mat_peptide AB195943_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195944_MHBs_P-C Product feature CHAIN AB195944_MHBs_P-C of FT:mat_peptide AB195944_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195945_MHBs_P-C Product feature CHAIN AB195945_MHBs_P-C of FT:mat_peptide AB195945_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195947_MHBs_P-C Product feature CHAIN AB195947_MHBs_P-C of FT:mat_peptide AB195947_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195948_MHBs_P-C Product feature CHAIN AB195948_MHBs_P-C of FT:mat_peptide AB195948_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195949_MHBs_P-C Product feature CHAIN AB195949_MHBs_P-C of FT:mat_peptide AB195949_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195952_MHBs_P-C Product feature CHAIN AB195952_MHBs_P-C of FT:mat_peptide AB195952_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195953_MHBs_P-C Product feature CHAIN AB195953_MHBs_P-C of FT:mat_peptide AB195953_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195954_MHBs_P-C Product feature CHAIN AB195954_MHBs_P-C of FT:mat_peptide AB195954_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198076_MHBs_P-C Product feature CHAIN AB198076_MHBs_P-C of FT:mat_peptide AB198076_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198077_MHBs_P-C Product feature CHAIN AB198077_MHBs_P-C of FT:mat_peptide AB198077_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198078_MHBs_P-C Product feature CHAIN AB198078_MHBs_P-C of FT:mat_peptide AB198078_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198079_MHBs_P-C Product feature CHAIN AB198079_MHBs_P-C of FT:mat_peptide AB198079_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198080_MHBs_P-C Product feature CHAIN AB198080_MHBs_P-C of FT:mat_peptide AB198080_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198081_MHBs_P-C Product feature CHAIN AB198081_MHBs_P-C of FT:mat_peptide AB198081_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALVDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198082_MHBs_P-C Product feature CHAIN AB198082_MHBs_P-C of FT:mat_peptide AB198082_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198083_MHBs_P-C Product feature CHAIN AB198083_MHBs_P-C of FT:mat_peptide AB198083_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB202071_MHBs_P-C Product feature CHAIN AB202071_MHBs_P-C of FT:mat_peptide AB202071_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205123_MHBs_P-C Product feature CHAIN AB205123_MHBs_P-C of FT:mat_peptide AB205123_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CN578-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MRWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTAPPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAEFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTPTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205124_MHBs_P-C Product feature CHAIN AB205124_MHBs_P-C of FT:mat_peptide AB205124_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TJ3-1-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205125_MHBs_P-C Product feature CHAIN AB205125_MHBs_P-C of FT:mat_peptide AB205125_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VH34-1). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222714_MHBs_P-C Product feature CHAIN AB222714_MHBs_P-C of FT:mat_peptide AB222714_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222715_MHBs_P-C Product feature CHAIN AB222715_MHBs_P-C of FT:mat_peptide AB222715_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7M). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB241110_MHBs_P-C Product feature CHAIN AB241110_MHBs_P-C of FT:mat_peptide AB241110_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC03). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB241111_MHBs_P-C Product feature CHAIN AB241111_MHBs_P-C of FT:mat_peptide AB241111_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB246344_MHBs_P-C Product feature CHAIN AB246344_MHBs_P-C of FT:mat_peptide AB246344_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMILYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246345_MHBs_P-C Product feature CHAIN AB246345_MHBs_P-C of FT:mat_peptide AB246345_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246346_MHBs_P-C Product feature CHAIN AB246346_MHBs_P-C of FT:mat_peptide AB246346_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLFPIFFCLWVYI
>gnl|hbvpro|AB247916_MHBs_P-C Product feature CHAIN AB247916_MHBs_P-C of FT:mat_peptide AB247916_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSLLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB288026_MHBs_P-C Product feature CHAIN AB288026_MHBs_P-C of FT:mat_peptide AB288026_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNWQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB298720_MHBs_P-C Product feature CHAIN AB298720_MHBs_P-C of FT:mat_peptide AB298720_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1S). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB298721_MHBs_P-C Product feature CHAIN AB298721_MHBs_P-C of FT:mat_peptide AB298721_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1C). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB299858_MHBs_P-C Product feature CHAIN AB299858_MHBs_P-C of FT:mat_peptide AB299858_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB300359_MHBs_P-C Product feature CHAIN AB300359_MHBs_P-C of FT:mat_peptide AB300359_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300360_MHBs_P-C Product feature CHAIN AB300360_MHBs_P-C of FT:mat_peptide AB300360_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPGLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300361_MHBs_P-C Product feature CHAIN AB300361_MHBs_P-C of FT:mat_peptide AB300361_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300362_MHBs_P-C Product feature CHAIN AB300362_MHBs_P-C of FT:mat_peptide AB300362_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300363_MHBs_P-C Product feature CHAIN AB300363_MHBs_P-C of FT:mat_peptide AB300363_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300365_MHBs_P-C Product feature CHAIN AB300365_MHBs_P-C of FT:mat_peptide AB300365_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300368_MHBs_P-C Product feature CHAIN AB300368_MHBs_P-C of FT:mat_peptide AB300368_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300372_MHBs_P-C Product feature CHAIN AB300372_MHBs_P-C of FT:mat_peptide AB300372_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient14). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWASARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB362932_MHBs_P-C Product feature CHAIN AB362932_MHBs_P-C of FT:mat_peptide AB362932_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB365451_MHBs_P-C Product feature CHAIN AB365451_MHBs_P-C of FT:mat_peptide AB365451_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL196). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTALPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLLVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367392_MHBs_P-C Product feature CHAIN AB367392_MHBs_P-C of FT:mat_peptide AB367392_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 1). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFRQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTKI
LTIPQSLDLWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWFWGRSLYNILSPFLPLLPIFFRLWVYI
>gnl|hbvpro|AB367394_MHBs_P-C Product feature CHAIN AB367394_MHBs_P-C of FT:mat_peptide AB367394_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 3/Adefovir-treated Pt. 8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367395_MHBs_P-C Product feature CHAIN AB367395_MHBs_P-C of FT:mat_peptide AB367395_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367396_MHBs_P-C Product feature CHAIN AB367396_MHBs_P-C of FT:mat_peptide AB367396_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367397_MHBs_P-C Product feature CHAIN AB367397_MHBs_P-C of FT:mat_peptide AB367397_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 6). Complete genome. [Hepadnaviridae] (length=281 residues).
MHWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAQNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367398_MHBs_P-C Product feature CHAIN AB367398_MHBs_P-C of FT:mat_peptide AB367398_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 7/Adefovir-treated Pt. 20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPITASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367399_MHBs_P-C Product feature CHAIN AB367399_MHBs_P-C of FT:mat_peptide AB367399_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 8/Adefovir-treated Pt. 29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367401_MHBs_P-C Product feature CHAIN AB367401_MHBs_P-C of FT:mat_peptide AB367401_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 10/Adefovir-treated Pt. 9). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHKAMLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB367402_MHBs_P-C Product feature CHAIN AB367402_MHBs_P-C of FT:mat_peptide AB367402_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFARFLWEWASVRFSWLSSLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367403_MHBs_P-C Product feature CHAIN AB367403_MHBs_P-C of FT:mat_peptide AB367403_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 12/Adefovir-treated Pt. 17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367404_MHBs_P-C Product feature CHAIN AB367404_MHBs_P-C of FT:mat_peptide AB367404_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 13/Adefovir-treated Pt. 22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367406_MHBs_P-C Product feature CHAIN AB367406_MHBs_P-C of FT:mat_peptide AB367406_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 15/Adefovir-treated Pt. 7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367407_MHBs_P-C Product feature CHAIN AB367407_MHBs_P-C of FT:mat_peptide AB367407_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 16/Adefovir-treated Pt. 11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367410_MHBs_P-C Product feature CHAIN AB367410_MHBs_P-C of FT:mat_peptide AB367410_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 19/Adefovir-treated Pt. 19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMWLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367411_MHBs_P-C Product feature CHAIN AB367411_MHBs_P-C of FT:mat_peptide AB367411_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWFSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB367412_MHBs_P-C Product feature CHAIN AB367412_MHBs_P-C of FT:mat_peptide AB367412_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367414_MHBs_P-C Product feature CHAIN AB367414_MHBs_P-C of FT:mat_peptide AB367414_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 23/Adefovir-treated Pt. 3). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367416_MHBs_P-C Product feature CHAIN AB367416_MHBs_P-C of FT:mat_peptide AB367416_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMWLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367417_MHBs_P-C Product feature CHAIN AB367417_MHBs_P-C of FT:mat_peptide AB367417_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|AB367418_MHBs_P-C Product feature CHAIN AB367418_MHBs_P-C of FT:mat_peptide AB367418_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 27/Adefovir-treated Pt. 21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGTCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMIWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367420_MHBs_P-C Product feature CHAIN AB367420_MHBs_P-C of FT:mat_peptide AB367420_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEVPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPNLYNILSPFLPLLPIFCLLWVYI
>gnl|hbvpro|AB367422_MHBs_P-C Product feature CHAIN AB367422_MHBs_P-C of FT:mat_peptide AB367422_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 31/Adefovir-treated Pt. 12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367423_MHBs_P-C Product feature CHAIN AB367423_MHBs_P-C of FT:mat_peptide AB367423_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 32/Adefovir-treated Pt. 28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367424_MHBs_P-C Product feature CHAIN AB367424_MHBs_P-C of FT:mat_peptide AB367424_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367427_MHBs_P-C Product feature CHAIN AB367427_MHBs_P-C of FT:mat_peptide AB367427_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 36/Adefovir-treated Pt. 18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB367431_MHBs_P-C Product feature CHAIN AB367431_MHBs_P-C of FT:mat_peptide AB367431_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367432_MHBs_P-C Product feature CHAIN AB367432_MHBs_P-C of FT:mat_peptide AB367432_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367434_MHBs_P-C Product feature CHAIN AB367434_MHBs_P-C of FT:mat_peptide AB367434_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 43/Adefovir-treated Pt. 26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDSVPNMENTASGSLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGRNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB367435_MHBs_P-C Product feature CHAIN AB367435_MHBs_P-C of FT:mat_peptide AB367435_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 44/Adefovir-treated Pt. 23). Non-functional genomic sequence. [Hepadnaviridae] (length=279 residues).
TQWNSTTFHQALLDPRVRGLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGTPACPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLS
PTVWLSVILMMWYWGPRLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367803_MHBs_P-C Product feature CHAIN AB367803_MHBs_P-C of FT:mat_peptide AB367803_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQRLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMWLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367804_MHBs_P-C Product feature CHAIN AB367804_MHBs_P-C of FT:mat_peptide AB367804_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB368297_MHBs_P-C Product feature CHAIN AB368297_MHBs_P-C of FT:mat_peptide AB368297_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB426467_MHBs_P-C Product feature CHAIN AB426467_MHBs_P-C of FT:mat_peptide AB426467_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB471848_MHBs_P-C Product feature CHAIN AB471848_MHBs_P-C of FT:mat_peptide AB471848_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-F). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471849_MHBs_P-C Product feature CHAIN AB471849_MHBs_P-C of FT:mat_peptide AB471849_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471850_MHBs_P-C Product feature CHAIN AB471850_MHBs_P-C of FT:mat_peptide AB471850_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471851_MHBs_P-C Product feature CHAIN AB471851_MHBs_P-C of FT:mat_peptide AB471851_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2NK-F). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471852_MHBs_P-C Product feature CHAIN AB471852_MHBs_P-C of FT:mat_peptide AB471852_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471853_MHBs_P-C Product feature CHAIN AB471853_MHBs_P-C of FT:mat_peptide AB471853_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB485808_MHBs_P-C Product feature CHAIN AB485808_MHBs_P-C of FT:mat_peptide AB485808_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-IT). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB485810_MHBs_P-C Product feature CHAIN AB485810_MHBs_P-C of FT:mat_peptide AB485810_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FEP2). Complete genome. [Hepadnaviridae] (length=281 residues).
VRWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB493839_MHBs_P-C Product feature CHAIN AB493839_MHBs_P-C of FT:mat_peptide AB493839_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTIASPISSIFSWTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB493844_MHBs_P-C Product feature CHAIN AB493844_MHBs_P-C of FT:mat_peptide AB493844_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 43UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB640730_MHBs_P-C Product feature CHAIN AB640730_MHBs_P-C of FT:mat_peptide AB640730_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ehime-EPCH-HBV-C1-HN). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642095_MHBs_P-C Product feature CHAIN AB642095_MHBs_P-C of FT:mat_peptide AB642095_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2000-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642097_MHBs_P-C Product feature CHAIN AB642097_MHBs_P-C of FT:mat_peptide AB642097_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2003-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGYFLLTRI
LTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGQXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642099_MHBs_P-C Product feature CHAIN AB642099_MHBs_P-C of FT:mat_peptide AB642099_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2005-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642100_MHBs_P-C Product feature CHAIN AB642100_MHBs_P-C of FT:mat_peptide AB642100_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2006-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670237_MHBs_P-C Product feature CHAIN AB670237_MHBs_P-C of FT:mat_peptide AB670237_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFWLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHXPTSCPPTXPGYRWMCLXRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQXTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFXCLWVYI
>gnl|hbvpro|AB670238_MHBs_P-C Product feature CHAIN AB670238_MHBs_P-C of FT:mat_peptide AB670238_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSLTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670239_MHBs_P-C Product feature CHAIN AB670239_MHBs_P-C of FT:mat_peptide AB670239_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.3). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB670240_MHBs_P-C Product feature CHAIN AB670240_MHBs_P-C of FT:mat_peptide AB670240_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.4). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB670241_MHBs_P-C Product feature CHAIN AB670241_MHBs_P-C of FT:mat_peptide AB670241_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.5). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSVIWMXWYWGXSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB670242_MHBs_P-C Product feature CHAIN AB670242_MHBs_P-C of FT:mat_peptide AB670242_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDXWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670243_MHBs_P-C Product feature CHAIN AB670243_MHBs_P-C of FT:mat_peptide AB670243_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.7). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670247_MHBs_P-C Product feature CHAIN AB670247_MHBs_P-C of FT:mat_peptide AB670247_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670249_MHBs_P-C Product feature CHAIN AB670249_MHBs_P-C of FT:mat_peptide AB670249_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670251_MHBs_P-C Product feature CHAIN AB670251_MHBs_P-C of FT:mat_peptide AB670251_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670252_MHBs_P-C Product feature CHAIN AB670252_MHBs_P-C of FT:mat_peptide AB670252_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670253_MHBs_P-C Product feature CHAIN AB670253_MHBs_P-C of FT:mat_peptide AB670253_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFLLTRI
LTILKNLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670256_MHBs_P-C Product feature CHAIN AB670256_MHBs_P-C of FT:mat_peptide AB670256_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670258_MHBs_P-C Product feature CHAIN AB670258_MHBs_P-C of FT:mat_peptide AB670258_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMWLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670259_MHBs_P-C Product feature CHAIN AB670259_MHBs_P-C of FT:mat_peptide AB670259_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.23). Complete genome. [Hepadnaviridae] (length=281 residues).
MHRISTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDLAQNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPKCLGQSSQSPTCNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670260_MHBs_P-C Product feature CHAIN AB670260_MHBs_P-C of FT:mat_peptide AB670260_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDHAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSGIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670261_MHBs_P-C Product feature CHAIN AB670261_MHBs_P-C of FT:mat_peptide AB670261_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670262_MHBs_P-C Product feature CHAIN AB670262_MHBs_P-C of FT:mat_peptide AB670262_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGQSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670263_MHBs_P-C Product feature CHAIN AB670263_MHBs_P-C of FT:mat_peptide AB670263_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670264_MHBs_P-C Product feature CHAIN AB670264_MHBs_P-C of FT:mat_peptide AB670264_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB670265_MHBs_P-C Product feature CHAIN AB670265_MHBs_P-C of FT:mat_peptide AB670265_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGRNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670266_MHBs_P-C Product feature CHAIN AB670266_MHBs_P-C of FT:mat_peptide AB670266_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670267_MHBs_P-C Product feature CHAIN AB670267_MHBs_P-C of FT:mat_peptide AB670267_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCXTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670269_MHBs_P-C Product feature CHAIN AB670269_MHBs_P-C of FT:mat_peptide AB670269_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB670270_MHBs_P-C Product feature CHAIN AB670270_MHBs_P-C of FT:mat_peptide AB670270_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB670272_MHBs_P-C Product feature CHAIN AB670272_MHBs_P-C of FT:mat_peptide AB670272_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.36). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAQNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVISMMWFWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670273_MHBs_P-C Product feature CHAIN AB670273_MHBs_P-C of FT:mat_peptide AB670273_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.37). Complete genome. [Hepadnaviridae] (length=281 residues).
TKWNSTTFHQVLLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670274_MHBs_P-C Product feature CHAIN AB670274_MHBs_P-C of FT:mat_peptide AB670274_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCQRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMIWYWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670275_MHBs_P-C Product feature CHAIN AB670275_MHBs_P-C of FT:mat_peptide AB670275_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|AB670276_MHBs_P-C Product feature CHAIN AB670276_MHBs_P-C of FT:mat_peptide AB670276_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670277_MHBs_P-C Product feature CHAIN AB670277_MHBs_P-C of FT:mat_peptide AB670277_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTSPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670278_MHBs_P-C Product feature CHAIN AB670278_MHBs_P-C of FT:mat_peptide AB670278_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.5). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFLQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670279_MHBs_P-C Product feature CHAIN AB670279_MHBs_P-C of FT:mat_peptide AB670279_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTAAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670281_MHBs_P-C Product feature CHAIN AB670281_MHBs_P-C of FT:mat_peptide AB670281_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670282_MHBs_P-C Product feature CHAIN AB670282_MHBs_P-C of FT:mat_peptide AB670282_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670283_MHBs_P-C Product feature CHAIN AB670283_MHBs_P-C of FT:mat_peptide AB670283_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670285_MHBs_P-C Product feature CHAIN AB670285_MHBs_P-C of FT:mat_peptide AB670285_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILXLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670287_MHBs_P-C Product feature CHAIN AB670287_MHBs_P-C of FT:mat_peptide AB670287_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670288_MHBs_P-C Product feature CHAIN AB670288_MHBs_P-C of FT:mat_peptide AB670288_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.15). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670289_MHBs_P-C Product feature CHAIN AB670289_MHBs_P-C of FT:mat_peptide AB670289_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFXXALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRX
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670290_MHBs_P-C Product feature CHAIN AB670290_MHBs_P-C of FT:mat_peptide AB670290_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPPLPIFFCLWVYI
>gnl|hbvpro|AB670291_MHBs_P-C Product feature CHAIN AB670291_MHBs_P-C of FT:mat_peptide AB670291_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.18). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQRLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670292_MHBs_P-C Product feature CHAIN AB670292_MHBs_P-C of FT:mat_peptide AB670292_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670295_MHBs_P-C Product feature CHAIN AB670295_MHBs_P-C of FT:mat_peptide AB670295_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.22). Complete genome. [Hepadnaviridae] (length=281 residues).
VCWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670297_MHBs_P-C Product feature CHAIN AB670297_MHBs_P-C of FT:mat_peptide AB670297_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670298_MHBs_P-C Product feature CHAIN AB670298_MHBs_P-C of FT:mat_peptide AB670298_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPANGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGRSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB670300_MHBs_P-C Product feature CHAIN AB670300_MHBs_P-C of FT:mat_peptide AB670300_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGRNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670301_MHBs_P-C Product feature CHAIN AB670301_MHBs_P-C of FT:mat_peptide AB670301_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670302_MHBs_P-C Product feature CHAIN AB670302_MHBs_P-C of FT:mat_peptide AB670302_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670305_MHBs_P-C Product feature CHAIN AB670305_MHBs_P-C of FT:mat_peptide AB670305_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670306_MHBs_P-C Product feature CHAIN AB670306_MHBs_P-C of FT:mat_peptide AB670306_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.33). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRRMCLRRFIIFLFILLLCLIFLWVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670307_MHBs_P-C Product feature CHAIN AB670307_MHBs_P-C of FT:mat_peptide AB670307_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.34). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670310_MHBs_P-C Product feature CHAIN AB670310_MHBs_P-C of FT:mat_peptide AB670310_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670311_MHBs_P-C Product feature CHAIN AB670311_MHBs_P-C of FT:mat_peptide AB670311_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB675674_MHBs_P-C Product feature CHAIN AB675674_MHBs_P-C of FT:mat_peptide AB675674_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTIPAQGPSMFPSCCCSKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|AB675675_MHBs_P-C Product feature CHAIN AB675675_MHBs_P-C of FT:mat_peptide AB675675_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCKTCTIPAQGPSMFPSCCCSKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|AB675677_MHBs_P-C Product feature CHAIN AB675677_MHBs_P-C of FT:mat_peptide AB675677_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A39). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697490_MHBs_P-C Product feature CHAIN AB697490_MHBs_P-C of FT:mat_peptide AB697490_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697494_MHBs_P-C Product feature CHAIN AB697494_MHBs_P-C of FT:mat_peptide AB697494_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No9). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTANPVPTTASPISSTFSRIGDLAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697500_MHBs_P-C Product feature CHAIN AB697500_MHBs_P-C of FT:mat_peptide AB697500_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697502_MHBs_P-C Product feature CHAIN AB697502_MHBs_P-C of FT:mat_peptide AB697502_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLXTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXXGPRLYTILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697510_MHBs_P-C Product feature CHAIN AB697510_MHBs_P-C of FT:mat_peptide AB697510_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGIVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB713885_MHBs_P-C Product feature CHAIN AB713885_MHBs_P-C of FT:mat_peptide AB713885_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YOGHhbv84). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLRCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRVSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB713890_MHBs_P-C Product feature CHAIN AB713890_MHBs_P-C of FT:mat_peptide AB713890_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YOGHhbv105). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB900099_MHBs_P-C Product feature CHAIN AB900099_MHBs_P-C of FT:mat_peptide AB900099_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900109_MHBs_P-C Product feature CHAIN AB900109_MHBs_P-C of FT:mat_peptide AB900109_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEAPACRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB900113_MHBs_P-C Product feature CHAIN AB900113_MHBs_P-C of FT:mat_peptide AB900113_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPRSLDSWWTSLSFLGGAPTCPGQNSQCPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900115_MHBs_P-C Product feature CHAIN AB900115_MHBs_P-C of FT:mat_peptide AB900115_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900116_MHBs_P-C Product feature CHAIN AB900116_MHBs_P-C of FT:mat_peptide AB900116_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB931170_MHBs_P-C Product feature CHAIN AB931170_MHBs_P-C of FT:mat_peptide AB931170_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2P_HB11-0921). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDWKGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB931171_MHBs_P-C Product feature CHAIN AB931171_MHBs_P-C of FT:mat_peptide AB931171_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2S_HB11-0922). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB971714_MHBs_P-C Product feature CHAIN AB971714_MHBs_P-C of FT:mat_peptide AB971714_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1026). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB971715_MHBs_P-C Product feature CHAIN AB971715_MHBs_P-C of FT:mat_peptide AB971715_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1027). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTTLVQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF068756_MHBs_P-C Product feature CHAIN AF068756_MHBs_P-C of FT:mat_peptide AF068756_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF182802_MHBs_P-C Product feature CHAIN AF182802_MHBs_P-C of FT:mat_peptide AF182802_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMQNTTSGFLGPLLALQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASIRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|AF182803_MHBs_P-C Product feature CHAIN AF182803_MHBs_P-C of FT:mat_peptide AF182803_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLVFLLVLLDYRGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASIRFSWLSLLVPFVQWVVR
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|AF182804_MHBs_P-C Product feature CHAIN AF182804_MHBs_P-C of FT:mat_peptide AF182804_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|AF223954_MHBs_P-C Product feature CHAIN AF223954_MHBs_P-C of FT:mat_peptide AF223954_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223955_MHBs_P-C Product feature CHAIN AF223955_MHBs_P-C of FT:mat_peptide AF223955_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223956_MHBs_P-C Product feature CHAIN AF223956_MHBs_P-C of FT:mat_peptide AF223956_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223957_MHBs_P-C Product feature CHAIN AF223957_MHBs_P-C of FT:mat_peptide AF223957_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223958_MHBs_P-C Product feature CHAIN AF223958_MHBs_P-C of FT:mat_peptide AF223958_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPALNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223959_MHBs_P-C Product feature CHAIN AF223959_MHBs_P-C of FT:mat_peptide AF223959_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223960_MHBs_P-C Product feature CHAIN AF223960_MHBs_P-C of FT:mat_peptide AF223960_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223961_MHBs_P-C Product feature CHAIN AF223961_MHBs_P-C of FT:mat_peptide AF223961_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF241410_MHBs_P-C Product feature CHAIN AF241410_MHBs_P-C of FT:mat_peptide AF241410_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3270). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPVPKMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF241411_MHBs_P-C Product feature CHAIN AF241411_MHBs_P-C of FT:mat_peptide AF241411_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8290). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPVPKMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNXXSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF286594_MHBs_P-C Product feature CHAIN AF286594_MHBs_P-C of FT:mat_peptide AF286594_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF363961_MHBs_P-C Product feature CHAIN AF363961_MHBs_P-C of FT:mat_peptide AF363961_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWASARFLWELASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF384371_MHBs_P-C Product feature CHAIN AF384371_MHBs_P-C of FT:mat_peptide AF384371_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|AF384372_MHBs_P-C Product feature CHAIN AF384372_MHBs_P-C of FT:mat_peptide AF384372_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-A6). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=283 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWF
VGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF411408_MHBs_P-C Product feature CHAIN AF411408_MHBs_P-C of FT:mat_peptide AF411408_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF411411_MHBs_P-C Product feature CHAIN AF411411_MHBs_P-C of FT:mat_peptide AF411411_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF411412_MHBs_P-C Product feature CHAIN AF411412_MHBs_P-C of FT:mat_peptide AF411412_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF458664_MHBs_P-C Product feature CHAIN AF458664_MHBs_P-C of FT:mat_peptide AF458664_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C84). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF458665_MHBs_P-C Product feature CHAIN AF458665_MHBs_P-C of FT:mat_peptide AF458665_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C733). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTTGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRCFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461357_MHBs_P-C Product feature CHAIN AF461357_MHBs_P-C of FT:mat_peptide AF461357_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPCLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461358_MHBs_P-C Product feature CHAIN AF461358_MHBs_P-C of FT:mat_peptide AF461358_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH8). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCAIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461359_MHBs_P-C Product feature CHAIN AF461359_MHBs_P-C of FT:mat_peptide AF461359_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate c16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCAIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461363_MHBs_P-C Product feature CHAIN AF461363_MHBs_P-C of FT:mat_peptide AF461363_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPCLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF473543_MHBs_P-C Product feature CHAIN AF473543_MHBs_P-C of FT:mat_peptide AF473543_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2e). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF533983_MHBs_P-C Product feature CHAIN AF533983_MHBs_P-C of FT:mat_peptide AF533983_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGGPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTVPQSLDSRWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWTCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ748098_MHBs_P-C Product feature CHAIN AJ748098_MHBs_P-C of FT:mat_peptide AJ748098_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient Z1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTSSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011097_MHBs_P-C Product feature CHAIN AP011097_MHBs_P-C of FT:mat_peptide AP011097_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011098_MHBs_P-C Product feature CHAIN AP011098_MHBs_P-C of FT:mat_peptide AP011098_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011099_MHBs_P-C Product feature CHAIN AP011099_MHBs_P-C of FT:mat_peptide AP011099_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011100_MHBs_P-C Product feature CHAIN AP011100_MHBs_P-C of FT:mat_peptide AP011100_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011101_MHBs_P-C Product feature CHAIN AP011101_MHBs_P-C of FT:mat_peptide AP011101_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011106_MHBs_P-C Product feature CHAIN AP011106_MHBs_P-C of FT:mat_peptide AP011106_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011107_MHBs_P-C Product feature CHAIN AP011107_MHBs_P-C of FT:mat_peptide AP011107_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY057947_MHBs_P-C Product feature CHAIN AY057947_MHBs_P-C of FT:mat_peptide AY057947_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet705). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY066028_MHBs_P-C Product feature CHAIN AY066028_MHBs_P-C of FT:mat_peptide AY066028_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH4). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY167090_MHBs_P-C Product feature CHAIN AY167090_MHBs_P-C of FT:mat_peptide AY167090_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTLHQALLDPRVRGLYFPAGGSSSGTVNPVPTIVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|AY167091_MHBs_P-C Product feature CHAIN AY167091_MHBs_P-C of FT:mat_peptide AY167091_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ic). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY167096_MHBs_P-C Product feature CHAIN AY167096_MHBs_P-C of FT:mat_peptide AY167096_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IIIa). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSKTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY167099_MHBs_P-C Product feature CHAIN AY167099_MHBs_P-C of FT:mat_peptide AY167099_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IVb). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLNSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGKCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206376_MHBs_P-C Product feature CHAIN AY206376_MHBs_P-C of FT:mat_peptide AY206376_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
LKWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKACTTPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLLVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206379_MHBs_P-C Product feature CHAIN AY206379_MHBs_P-C of FT:mat_peptide AY206379_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
LKWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKACTTPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLLVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206381_MHBs_P-C Product feature CHAIN AY206381_MHBs_P-C of FT:mat_peptide AY206381_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFLLTRI
LTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARYLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206382_MHBs_P-C Product feature CHAIN AY206382_MHBs_P-C of FT:mat_peptide AY206382_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFFWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPTFFCLWVYI
>gnl|hbvpro|AY206384_MHBs_P-C Product feature CHAIN AY206384_MHBs_P-C of FT:mat_peptide AY206384_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWKCASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206386_MHBs_P-C Product feature CHAIN AY206386_MHBs_P-C of FT:mat_peptide AY206386_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVX
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206389_MHBs_P-C Product feature CHAIN AY206389_MHBs_P-C of FT:mat_peptide AY206389_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
SGRHSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206392_MHBs_P-C Product feature CHAIN AY206392_MHBs_P-C of FT:mat_peptide AY206392_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY220699_MHBs_P-C Product feature CHAIN AY220699_MHBs_P-C of FT:mat_peptide AY220699_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLLDPRVRGLYIPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|AY247031_MHBs_P-C Product feature CHAIN AY247031_MHBs_P-C of FT:mat_peptide AY247031_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB84). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY247032_MHBs_P-C Product feature CHAIN AY247032_MHBs_P-C of FT:mat_peptide AY247032_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB95). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY306136_MHBs_P-C Product feature CHAIN AY306136_MHBs_P-C of FT:mat_peptide AY306136_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H85). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFPRTGDPALNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCRRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY582136_MHBs_P-C Product feature CHAIN AY582136_MHBs_P-C of FT:mat_peptide AY582136_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY596107_MHBs_P-C Product feature CHAIN AY596107_MHBs_P-C of FT:mat_peptide AY596107_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNFTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY596108_MHBs_P-C Product feature CHAIN AY596108_MHBs_P-C of FT:mat_peptide AY596108_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641558_MHBs_P-C Product feature CHAIN AY641558_MHBs_P-C of FT:mat_peptide AY641558_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He74). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641559_MHBs_P-C Product feature CHAIN AY641559_MHBs_P-C of FT:mat_peptide AY641559_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He53). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLNLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILRPFIPLLPIFLCLWVYI
>gnl|hbvpro|AY641560_MHBs_P-C Product feature CHAIN AY641560_MHBs_P-C of FT:mat_peptide AY641560_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He100). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641561_MHBs_P-C Product feature CHAIN AY641561_MHBs_P-C of FT:mat_peptide AY641561_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He127). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY641562_MHBs_P-C Product feature CHAIN AY641562_MHBs_P-C of FT:mat_peptide AY641562_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He82). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQNTSIFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641563_MHBs_P-C Product feature CHAIN AY641563_MHBs_P-C of FT:mat_peptide AY641563_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He52). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMIWYWGPNLYNIWSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY862869_MHBs_P-C Product feature CHAIN AY862869_MHBs_P-C of FT:mat_peptide AY862869_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H8). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|D00630_MHBs_P-C Product feature CHAIN D00630_MHBs_P-C of FT:mat_peptide D00630_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQAVLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGPNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D10055_MHBs_P-C Product feature CHAIN D10055_MHBs_P-C of FT:mat_peptide D10055_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFARFLWEWASVRFSWLNLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D12980_MHBs_P-C Product feature CHAIN D12980_MHBs_P-C of FT:mat_peptide D12980_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCWCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D23681_MHBs_P-C Product feature CHAIN D23681_MHBs_P-C of FT:mat_peptide D23681_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C4-HBVST2). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMLPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|D23682_MHBs_P-C Product feature CHAIN D23682_MHBs_P-C of FT:mat_peptide D23682_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B5-HBVKO1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFSLTRI
HTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGQSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D23683_MHBs_P-C Product feature CHAIN D23683_MHBs_P-C of FT:mat_peptide D23683_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C5-HBVKO2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFSLTRI
HTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGQGLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|D23684_MHBs_P-C Product feature CHAIN D23684_MHBs_P-C of FT:mat_peptide D23684_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C6-TKB588). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D28880_MHBs_P-C Product feature CHAIN D28880_MHBs_P-C of FT:mat_peptide D28880_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Plasma 1992-085-9434). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRI
LTIPQSLDLWWTSLNFLGGAPKCPGLNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTPTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCICIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50517_MHBs_P-C Product feature CHAIN D50517_MHBs_P-C of FT:mat_peptide D50517_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50518_MHBs_P-C Product feature CHAIN D50518_MHBs_P-C of FT:mat_peptide D50518_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50519_MHBs_P-C Product feature CHAIN D50519_MHBs_P-C of FT:mat_peptide D50519_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWVSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50520_MHBs_P-C Product feature CHAIN D50520_MHBs_P-C of FT:mat_peptide D50520_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089757_MHBs_P-C Product feature CHAIN DQ089757_MHBs_P-C of FT:mat_peptide DQ089757_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2342). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGXNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPXVWLSVIWMMWYWGPSLYNXLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089758_MHBs_P-C Product feature CHAIN DQ089758_MHBs_P-C of FT:mat_peptide DQ089758_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1733). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089760_MHBs_P-C Product feature CHAIN DQ089760_MHBs_P-C of FT:mat_peptide DQ089760_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK454). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089761_MHBs_P-C Product feature CHAIN DQ089761_MHBs_P-C of FT:mat_peptide DQ089761_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK515). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSVFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089762_MHBs_P-C Product feature CHAIN DQ089762_MHBs_P-C of FT:mat_peptide DQ089762_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1644). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSRTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089763_MHBs_P-C Product feature CHAIN DQ089763_MHBs_P-C of FT:mat_peptide DQ089763_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1048). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPTCPGYRLMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089764_MHBs_P-C Product feature CHAIN DQ089764_MHBs_P-C of FT:mat_peptide DQ089764_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK967). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089765_MHBs_P-C Product feature CHAIN DQ089765_MHBs_P-C of FT:mat_peptide DQ089765_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK428). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089766_MHBs_P-C Product feature CHAIN DQ089766_MHBs_P-C of FT:mat_peptide DQ089766_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK553). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYXGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089767_MHBs_P-C Product feature CHAIN DQ089767_MHBs_P-C of FT:mat_peptide DQ089767_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1663). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSGPPXCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPXLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089768_MHBs_P-C Product feature CHAIN DQ089768_MHBs_P-C of FT:mat_peptide DQ089768_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1814). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSSTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTFCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089769_MHBs_P-C Product feature CHAIN DQ089769_MHBs_P-C of FT:mat_peptide DQ089769_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK430). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089770_MHBs_P-C Product feature CHAIN DQ089770_MHBs_P-C of FT:mat_peptide DQ089770_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1272). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPXTASPISSIFSRXGDPAPNMESTISGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089771_MHBs_P-C Product feature CHAIN DQ089771_MHBs_P-C of FT:mat_peptide DQ089771_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1629). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089772_MHBs_P-C Product feature CHAIN DQ089772_MHBs_P-C of FT:mat_peptide DQ089772_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK910). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|DQ089773_MHBs_P-C Product feature CHAIN DQ089773_MHBs_P-C of FT:mat_peptide DQ089773_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1193). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSKTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSILSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089775_MHBs_P-C Product feature CHAIN DQ089775_MHBs_P-C of FT:mat_peptide DQ089775_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK290). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPPLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILXLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLLVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089776_MHBs_P-C Product feature CHAIN DQ089776_MHBs_P-C of FT:mat_peptide DQ089776_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK884). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGXAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089777_MHBs_P-C Product feature CHAIN DQ089777_MHBs_P-C of FT:mat_peptide DQ089777_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1159). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGVAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089778_MHBs_P-C Product feature CHAIN DQ089778_MHBs_P-C of FT:mat_peptide DQ089778_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1442). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSNTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ089779_MHBs_P-C Product feature CHAIN DQ089779_MHBs_P-C of FT:mat_peptide DQ089779_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK554). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089780_MHBs_P-C Product feature CHAIN DQ089780_MHBs_P-C of FT:mat_peptide DQ089780_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK947). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNXSTFHQALLDPRVRGXYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLVVLXDYRGMLP
VCPXLPGTSTTSXGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQXFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089781_MHBs_P-C Product feature CHAIN DQ089781_MHBs_P-C of FT:mat_peptide DQ089781_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1476). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089782_MHBs_P-C Product feature CHAIN DQ089782_MHBs_P-C of FT:mat_peptide DQ089782_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2032). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089783_MHBs_P-C Product feature CHAIN DQ089783_MHBs_P-C of FT:mat_peptide DQ089783_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1402). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089784_MHBs_P-C Product feature CHAIN DQ089784_MHBs_P-C of FT:mat_peptide DQ089784_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1285). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089785_MHBs_P-C Product feature CHAIN DQ089785_MHBs_P-C of FT:mat_peptide DQ089785_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1386). Complete genome. [Hepadnaviridae] (length=281 residues).
VRWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVXQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYTILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089786_MHBs_P-C Product feature CHAIN DQ089786_MHBs_P-C of FT:mat_peptide DQ089786_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2074). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPSTASPISSIFARTGDPAPNMESISSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089787_MHBs_P-C Product feature CHAIN DQ089787_MHBs_P-C of FT:mat_peptide DQ089787_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK352). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089788_MHBs_P-C Product feature CHAIN DQ089788_MHBs_P-C of FT:mat_peptide DQ089788_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK820). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWSWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ089789_MHBs_P-C Product feature CHAIN DQ089789_MHBs_P-C of FT:mat_peptide DQ089789_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK926). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089790_MHBs_P-C Product feature CHAIN DQ089790_MHBs_P-C of FT:mat_peptide DQ089790_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1248). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPITASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWVSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089791_MHBs_P-C Product feature CHAIN DQ089791_MHBs_P-C of FT:mat_peptide DQ089791_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1205). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSXTFHQALPDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLXNILNPFLPLLPIFFXLWVYI
>gnl|hbvpro|DQ089792_MHBs_P-C Product feature CHAIN DQ089792_MHBs_P-C of FT:mat_peptide DQ089792_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK870). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDSRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGXSLYNILNPFXPLLPIFFXLWVYI
>gnl|hbvpro|DQ089793_MHBs_P-C Product feature CHAIN DQ089793_MHBs_P-C of FT:mat_peptide DQ089793_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK343). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089795_MHBs_P-C Product feature CHAIN DQ089795_MHBs_P-C of FT:mat_peptide DQ089795_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1465). Complete genome. [Hepadnaviridae] (length=282 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSSFSRTGDPAPNMENTISXFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGNSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWXSVRFSWLSLLVPFVQWFV
GLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089796_MHBs_P-C Product feature CHAIN DQ089796_MHBs_P-C of FT:mat_peptide DQ089796_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK751). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089797_MHBs_P-C Product feature CHAIN DQ089797_MHBs_P-C of FT:mat_peptide DQ089797_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1169). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTIHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSNFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSXHSLISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWSWGPXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089799_MHBs_P-C Product feature CHAIN DQ089799_MHBs_P-C of FT:mat_peptide DQ089799_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK734). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089801_MHBs_P-C Product feature CHAIN DQ089801_MHBs_P-C of FT:mat_peptide DQ089801_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2100). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089802_MHBs_P-C Product feature CHAIN DQ089802_MHBs_P-C of FT:mat_peptide DQ089802_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1371). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYXPAGGSSSGAVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089803_MHBs_P-C Product feature CHAIN DQ089803_MHBs_P-C of FT:mat_peptide DQ089803_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK931). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGSLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089804_MHBs_P-C Product feature CHAIN DQ089804_MHBs_P-C of FT:mat_peptide DQ089804_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK262). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLXPLLALQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFSLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFLCLWVYI
>gnl|hbvpro|DQ141656_MHBs_P-C Product feature CHAIN DQ141656_MHBs_P-C of FT:mat_peptide DQ141656_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIH46AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141657_MHBs_P-C Product feature CHAIN DQ141657_MHBs_P-C of FT:mat_peptide DQ141657_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2051Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVQTSASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQGFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLIPIFFCLWVYI
>gnl|hbvpro|DQ141658_MHBs_P-C Product feature CHAIN DQ141658_MHBs_P-C of FT:mat_peptide DQ141658_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Alr016East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCWTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|DQ141659_MHBs_P-C Product feature CHAIN DQ141659_MHBs_P-C of FT:mat_peptide DQ141659_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Alr062East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCWTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPLFFCLWVYI
>gnl|hbvpro|DQ141660_MHBs_P-C Product feature CHAIN DQ141660_MHBs_P-C of FT:mat_peptide DQ141660_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Alr198East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141661_MHBs_P-C Product feature CHAIN DQ141661_MHBs_P-C of FT:mat_peptide DQ141661_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SBT35East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141662_MHBs_P-C Product feature CHAIN DQ141662_MHBs_P-C of FT:mat_peptide DQ141662_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2076Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141663_MHBs_P-C Product feature CHAIN DQ141663_MHBs_P-C of FT:mat_peptide DQ141663_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2074Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTISGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141664_MHBs_P-C Product feature CHAIN DQ141664_MHBs_P-C of FT:mat_peptide DQ141664_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIHM5Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSGWTSLNFLGGTPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141665_MHBs_P-C Product feature CHAIN DQ141665_MHBs_P-C of FT:mat_peptide DQ141665_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIH40AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141667_MHBs_P-C Product feature CHAIN DQ141667_MHBs_P-C of FT:mat_peptide DQ141667_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Alr006East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSQTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNISKPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141668_MHBs_P-C Product feature CHAIN DQ141668_MHBs_P-C of FT:mat_peptide DQ141668_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SBT47East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ246215_MHBs_P-C Product feature CHAIN DQ246215_MHBs_P-C of FT:mat_peptide DQ246215_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPYVQWFVG
LSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ370438_MHBs_P-C Product feature CHAIN DQ370438_MHBs_P-C of FT:mat_peptide DQ370438_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z6-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=282 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGTCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYIR
>gnl|hbvpro|DQ370439_MHBs_P-C Product feature CHAIN DQ370439_MHBs_P-C of FT:mat_peptide DQ370439_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z6-2). Partial genome (Contains: MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAHACPGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
DCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377161_MHBs_P-C Product feature CHAIN DQ377161_MHBs_P-C of FT:mat_peptide DQ377161_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLQGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377162_MHBs_P-C Product feature CHAIN DQ377162_MHBs_P-C of FT:mat_peptide DQ377162_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILPLRLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377163_MHBs_P-C Product feature CHAIN DQ377163_MHBs_P-C of FT:mat_peptide DQ377163_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSQTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377164_MHBs_P-C Product feature CHAIN DQ377164_MHBs_P-C of FT:mat_peptide DQ377164_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPVQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARSLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377165_MHBs_P-C Product feature CHAIN DQ377165_MHBs_P-C of FT:mat_peptide DQ377165_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNPTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTRTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRLSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478885_MHBs_P-C Product feature CHAIN DQ478885_MHBs_P-C of FT:mat_peptide DQ478885_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQSMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478899_MHBs_P-C Product feature CHAIN DQ478899_MHBs_P-C of FT:mat_peptide DQ478899_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIILLFILLLCLIFLLVLLDYRGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRSSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478900_MHBs_P-C Product feature CHAIN DQ478900_MHBs_P-C of FT:mat_peptide DQ478900_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H172). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTGI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILQLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478901_MHBs_P-C Product feature CHAIN DQ478901_MHBs_P-C of FT:mat_peptide DQ478901_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H155). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFNIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSTWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWRMWYWGPRLYNILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ536410_MHBs_P-C Product feature CHAIN DQ536410_MHBs_P-C of FT:mat_peptide DQ536410_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ536412_MHBs_P-C Product feature CHAIN DQ536412_MHBs_P-C of FT:mat_peptide DQ536412_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVRTTASPISSIFSRTGDLAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFPFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ683578_MHBs_P-C Product feature CHAIN DQ683578_MHBs_P-C of FT:mat_peptide DQ683578_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ890381_MHBs_P-C Product feature CHAIN DQ890381_MHBs_P-C of FT:mat_peptide DQ890381_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPKVRGLYLPVGGSSSGTVNPVPTIASPISSIFSKTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ922649_MHBs_P-C Product feature CHAIN DQ922649_MHBs_P-C of FT:mat_peptide DQ922649_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWALVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ922650_MHBs_P-C Product feature CHAIN DQ922650_MHBs_P-C of FT:mat_peptide DQ922650_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ922651_MHBs_P-C Product feature CHAIN DQ922651_MHBs_P-C of FT:mat_peptide DQ922651_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWTMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ975272_MHBs_P-C Product feature CHAIN DQ975272_MHBs_P-C of FT:mat_peptide DQ975272_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ975273_MHBs_P-C Product feature CHAIN DQ975273_MHBs_P-C of FT:mat_peptide DQ975273_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ980547_MHBs_P-C Product feature CHAIN DQ980547_MHBs_P-C of FT:mat_peptide DQ980547_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGACKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWALVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ986375_MHBs_P-C Product feature CHAIN DQ986375_MHBs_P-C of FT:mat_peptide DQ986375_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGISMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ993691_MHBs_P-C Product feature CHAIN DQ993691_MHBs_P-C of FT:mat_peptide DQ993691_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0803-Nature2.2-unSero). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ993692_MHBs_P-C Product feature CHAIN DQ993692_MHBs_P-C of FT:mat_peptide DQ993692_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0810-Nature2.1-unSero). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ993693_MHBs_P-C Product feature CHAIN DQ993693_MHBs_P-C of FT:mat_peptide DQ993693_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 232-1125-Nature1.1-unSero). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF137802_MHBs_P-C Product feature CHAIN EF137802_MHBs_P-C of FT:mat_peptide EF137802_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVSTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILPLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPTPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNIWSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF137803_MHBs_P-C Product feature CHAIN EF137803_MHBs_P-C of FT:mat_peptide EF137803_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFAQWFAG
LSPTVWLSVIWMMWYWGPSLYNIWSPFLPLLPIFFCLWAYI
>gnl|hbvpro|EF384200_MHBs_P-C Product feature CHAIN EF384200_MHBs_P-C of FT:mat_peptide EF384200_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF384206_MHBs_P-C Product feature CHAIN EF384206_MHBs_P-C of FT:mat_peptide EF384206_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-07). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF494379_MHBs_P-C Product feature CHAIN EF494379_MHBs_P-C of FT:mat_peptide EF494379_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW8585). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSNTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF536065_MHBs_P-C Product feature CHAIN EF536065_MHBs_P-C of FT:mat_peptide EF536065_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF536066_MHBs_P-C Product feature CHAIN EF536066_MHBs_P-C of FT:mat_peptide EF536066_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISPIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSRWTSLNFLGGAPTCPGQNSQSPTSNHSLTFCPLTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF688062_MHBs_P-C Product feature CHAIN EF688062_MHBs_P-C of FT:mat_peptide EF688062_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ28-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075315_MHBs_P-C Product feature CHAIN EU075315_MHBs_P-C of FT:mat_peptide EU075315_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S194-A11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSSFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQAMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075334_MHBs_P-C Product feature CHAIN EU075334_MHBs_P-C of FT:mat_peptide EU075334_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075335_MHBs_P-C Product feature CHAIN EU075335_MHBs_P-C of FT:mat_peptide EU075335_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075336_MHBs_P-C Product feature CHAIN EU075336_MHBs_P-C of FT:mat_peptide EU075336_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-49). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075338_MHBs_P-C Product feature CHAIN EU075338_MHBs_P-C of FT:mat_peptide EU075338_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-B9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075342_MHBs_P-C Product feature CHAIN EU075342_MHBs_P-C of FT:mat_peptide EU075342_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-C14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082428_MHBs_P-C Product feature CHAIN EU082428_MHBs_P-C of FT:mat_peptide EU082428_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-A1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082429_MHBs_P-C Product feature CHAIN EU082429_MHBs_P-C of FT:mat_peptide EU082429_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-A2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082430_MHBs_P-C Product feature CHAIN EU082430_MHBs_P-C of FT:mat_peptide EU082430_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-A3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082431_MHBs_P-C Product feature CHAIN EU082431_MHBs_P-C of FT:mat_peptide EU082431_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-B4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082432_MHBs_P-C Product feature CHAIN EU082432_MHBs_P-C of FT:mat_peptide EU082432_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-B6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFITFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082435_MHBs_P-C Product feature CHAIN EU082435_MHBs_P-C of FT:mat_peptide EU082435_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-B12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTWPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086837_MHBs_P-C Product feature CHAIN EU086837_MHBs_P-C of FT:mat_peptide EU086837_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S246-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086839_MHBs_P-C Product feature CHAIN EU086839_MHBs_P-C of FT:mat_peptide EU086839_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S246-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086840_MHBs_P-C Product feature CHAIN EU086840_MHBs_P-C of FT:mat_peptide EU086840_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=280 residues).
QWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRIL
TIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPV
CPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGL
SPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086841_MHBs_P-C Product feature CHAIN EU086841_MHBs_P-C of FT:mat_peptide EU086841_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=280 residues).
QWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRIL
TIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPV
CPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGL
SPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086842_MHBs_P-C Product feature CHAIN EU086842_MHBs_P-C of FT:mat_peptide EU086842_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
AQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086843_MHBs_P-C Product feature CHAIN EU086843_MHBs_P-C of FT:mat_peptide EU086843_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086844_MHBs_P-C Product feature CHAIN EU086844_MHBs_P-C of FT:mat_peptide EU086844_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086845_MHBs_P-C Product feature CHAIN EU086845_MHBs_P-C of FT:mat_peptide EU086845_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-B3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPPCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086846_MHBs_P-C Product feature CHAIN EU086846_MHBs_P-C of FT:mat_peptide EU086846_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-B4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086847_MHBs_P-C Product feature CHAIN EU086847_MHBs_P-C of FT:mat_peptide EU086847_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-B7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGTPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093883_MHBs_P-C Product feature CHAIN EU093883_MHBs_P-C of FT:mat_peptide EU093883_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S385-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093895_MHBs_P-C Product feature CHAIN EU093895_MHBs_P-C of FT:mat_peptide EU093895_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S402-13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093896_MHBs_P-C Product feature CHAIN EU093896_MHBs_P-C of FT:mat_peptide EU093896_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S402-14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU093898_MHBs_P-C Product feature CHAIN EU093898_MHBs_P-C of FT:mat_peptide EU093898_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S402-4). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093900_MHBs_P-C Product feature CHAIN EU093900_MHBs_P-C of FT:mat_peptide EU093900_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S403-6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRI
LTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMYLRGFIIFLFILLLCLICLLVLVDSRGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093902_MHBs_P-C Product feature CHAIN EU093902_MHBs_P-C of FT:mat_peptide EU093902_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S404-24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVTFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093903_MHBs_P-C Product feature CHAIN EU093903_MHBs_P-C of FT:mat_peptide EU093903_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S406-16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093907_MHBs_P-C Product feature CHAIN EU093907_MHBs_P-C of FT:mat_peptide EU093907_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S408-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093908_MHBs_P-C Product feature CHAIN EU093908_MHBs_P-C of FT:mat_peptide EU093908_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S410-7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093909_MHBs_P-C Product feature CHAIN EU093909_MHBs_P-C of FT:mat_peptide EU093909_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate X441-8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093910_MHBs_P-C Product feature CHAIN EU093910_MHBs_P-C of FT:mat_peptide EU093910_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S205-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093911_MHBs_P-C Product feature CHAIN EU093911_MHBs_P-C of FT:mat_peptide EU093911_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S205-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093912_MHBs_P-C Product feature CHAIN EU093912_MHBs_P-C of FT:mat_peptide EU093912_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S205-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093913_MHBs_P-C Product feature CHAIN EU093913_MHBs_P-C of FT:mat_peptide EU093913_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S259-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093914_MHBs_P-C Product feature CHAIN EU093914_MHBs_P-C of FT:mat_peptide EU093914_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S259-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSIHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093915_MHBs_P-C Product feature CHAIN EU093915_MHBs_P-C of FT:mat_peptide EU093915_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S259-12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWYSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWERASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093916_MHBs_P-C Product feature CHAIN EU093916_MHBs_P-C of FT:mat_peptide EU093916_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093917_MHBs_P-C Product feature CHAIN EU093917_MHBs_P-C of FT:mat_peptide EU093917_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILGPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093918_MHBs_P-C Product feature CHAIN EU093918_MHBs_P-C of FT:mat_peptide EU093918_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU305540_MHBs_P-C Product feature CHAIN EU305540_MHBs_P-C of FT:mat_peptide EU305540_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-123). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTTSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU305541_MHBs_P-C Product feature CHAIN EU305541_MHBs_P-C of FT:mat_peptide EU305541_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-190). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLGSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPLSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU305542_MHBs_P-C Product feature CHAIN EU305542_MHBs_P-C of FT:mat_peptide EU305542_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-1251). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVCFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306671_MHBs_P-C Product feature CHAIN EU306671_MHBs_P-C of FT:mat_peptide EU306671_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASHISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGCRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306672_MHBs_P-C Product feature CHAIN EU306672_MHBs_P-C of FT:mat_peptide EU306672_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASHISSIFSRTGDPAPNMESTTSGLLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306673_MHBs_P-C Product feature CHAIN EU306673_MHBs_P-C of FT:mat_peptide EU306673_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCPRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306674_MHBs_P-C Product feature CHAIN EU306674_MHBs_P-C of FT:mat_peptide EU306674_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVQGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQPPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306675_MHBs_P-C Product feature CHAIN EU306675_MHBs_P-C of FT:mat_peptide EU306675_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVQGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306685_MHBs_P-C Product feature CHAIN EU306685_MHBs_P-C of FT:mat_peptide EU306685_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306687_MHBs_P-C Product feature CHAIN EU306687_MHBs_P-C of FT:mat_peptide EU306687_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306688_MHBs_P-C Product feature CHAIN EU306688_MHBs_P-C of FT:mat_peptide EU306688_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306689_MHBs_P-C Product feature CHAIN EU306689_MHBs_P-C of FT:mat_peptide EU306689_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LAIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306690_MHBs_P-C Product feature CHAIN EU306690_MHBs_P-C of FT:mat_peptide EU306690_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESATSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306691_MHBs_P-C Product feature CHAIN EU306691_MHBs_P-C of FT:mat_peptide EU306691_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPISCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306694_MHBs_P-C Product feature CHAIN EU306694_MHBs_P-C of FT:mat_peptide EU306694_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306713_MHBs_P-C Product feature CHAIN EU306713_MHBs_P-C of FT:mat_peptide EU306713_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLPCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306714_MHBs_P-C Product feature CHAIN EU306714_MHBs_P-C of FT:mat_peptide EU306714_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306719_MHBs_P-C Product feature CHAIN EU306719_MHBs_P-C of FT:mat_peptide EU306719_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLS
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306720_MHBs_P-C Product feature CHAIN EU306720_MHBs_P-C of FT:mat_peptide EU306720_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSRSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306721_MHBs_P-C Product feature CHAIN EU306721_MHBs_P-C of FT:mat_peptide EU306721_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGSCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306722_MHBs_P-C Product feature CHAIN EU306722_MHBs_P-C of FT:mat_peptide EU306722_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306725_MHBs_P-C Product feature CHAIN EU306725_MHBs_P-C of FT:mat_peptide EU306725_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLPAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306726_MHBs_P-C Product feature CHAIN EU306726_MHBs_P-C of FT:mat_peptide EU306726_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306727_MHBs_P-C Product feature CHAIN EU306727_MHBs_P-C of FT:mat_peptide EU306727_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSQTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWPSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306728_MHBs_P-C Product feature CHAIN EU306728_MHBs_P-C of FT:mat_peptide EU306728_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU410079_MHBs_P-C Product feature CHAIN EU410079_MHBs_P-C of FT:mat_peptide EU410079_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph109). Complete genome. [Hepadnaviridae] (length=280 residues).
QWNSTTFHQALLDPRVRGLXFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKIL
TIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPV
CPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVGL
SPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU410080_MHBs_P-C Product feature CHAIN EU410080_MHBs_P-C of FT:mat_peptide EU410080_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph76). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU410081_MHBs_P-C Product feature CHAIN EU410081_MHBs_P-C of FT:mat_peptide EU410081_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph80). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU439015_MHBs_P-C Product feature CHAIN EU439015_MHBs_P-C of FT:mat_peptide EU439015_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU498227_MHBs_P-C Product feature CHAIN EU498227_MHBs_P-C of FT:mat_peptide EU498227_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JL). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSSTFHKALLDPRVRGPYFPAGGSSSGTVNPVPTTASPISSIFSMTGDPAPNMESTTSGLLGPLLVLQAGFFLLTRI
LKIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTTTTSRGPCRTCTTPAQGTSMFPSCCCTKLSDANCTCIPIPTSGAFAKFLWGSASVRFSWLNSLVPFVQWFEE
LSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU522068_MHBs_P-C Product feature CHAIN EU522068_MHBs_P-C of FT:mat_peptide EU522068_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5N). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDSRGMLR
VCPLLPGTSTTSTGPCKTCTIPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU522071_MHBs_P-C Product feature CHAIN EU522071_MHBs_P-C of FT:mat_peptide EU522071_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 7T). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFQQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTLPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU547562_MHBs_P-C Product feature CHAIN EU547562_MHBs_P-C of FT:mat_peptide EU547562_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MC05). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRXFIIFLFILLLCLIFLLVLVDXQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554535_MHBs_P-C Product feature CHAIN EU554535_MHBs_P-C of FT:mat_peptide EU554535_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-20). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGASMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554536_MHBs_P-C Product feature CHAIN EU554536_MHBs_P-C of FT:mat_peptide EU554536_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-24). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDLWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGASTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWAPVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554537_MHBs_P-C Product feature CHAIN EU554537_MHBs_P-C of FT:mat_peptide EU554537_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCRTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554538_MHBs_P-C Product feature CHAIN EU554538_MHBs_P-C of FT:mat_peptide EU554538_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-15). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554539_MHBs_P-C Product feature CHAIN EU554539_MHBs_P-C of FT:mat_peptide EU554539_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554540_MHBs_P-C Product feature CHAIN EU554540_MHBs_P-C of FT:mat_peptide EU554540_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S304-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554541_MHBs_P-C Product feature CHAIN EU554541_MHBs_P-C of FT:mat_peptide EU554541_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWPSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|EU554542_MHBs_P-C Product feature CHAIN EU554542_MHBs_P-C of FT:mat_peptide EU554542_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|EU560438_MHBs_P-C Product feature CHAIN EU560438_MHBs_P-C of FT:mat_peptide EU560438_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2-B74). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENAASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGVTPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU560439_MHBs_P-C Product feature CHAIN EU560439_MHBs_P-C of FT:mat_peptide EU560439_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-B74). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFPGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSAGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU560440_MHBs_P-C Product feature CHAIN EU560440_MHBs_P-C of FT:mat_peptide EU560440_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-S869). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU560441_MHBs_P-C Product feature CHAIN EU560441_MHBs_P-C of FT:mat_peptide EU560441_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4-S869). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|EU562215_MHBs_P-C Product feature CHAIN EU562215_MHBs_P-C of FT:mat_peptide EU562215_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTYTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU562217_MHBs_P-C Product feature CHAIN EU562217_MHBs_P-C of FT:mat_peptide EU562217_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU562218_MHBs_P-C Product feature CHAIN EU562218_MHBs_P-C of FT:mat_peptide EU562218_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570067_MHBs_P-C Product feature CHAIN EU570067_MHBs_P-C of FT:mat_peptide EU570067_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18-S541). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGCRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGDCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU570068_MHBs_P-C Product feature CHAIN EU570068_MHBs_P-C of FT:mat_peptide EU570068_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26-S541). Complete genome. [Hepadnaviridae] (length=281 residues).
LQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570072_MHBs_P-C Product feature CHAIN EU570072_MHBs_P-C of FT:mat_peptide EU570072_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-B74). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWTSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSSHSPTSCPPICPGYRWICLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPLSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570073_MHBs_P-C Product feature CHAIN EU570073_MHBs_P-C of FT:mat_peptide EU570073_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8-S698). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTGDPATNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCIKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570074_MHBs_P-C Product feature CHAIN EU570074_MHBs_P-C of FT:mat_peptide EU570074_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11-S698). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTGDPATNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCIKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU579442_MHBs_P-C Product feature CHAIN EU579442_MHBs_P-C of FT:mat_peptide EU579442_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|EU579443_MHBs_P-C Product feature CHAIN EU579443_MHBs_P-C of FT:mat_peptide EU579443_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU589336_MHBs_P-C Product feature CHAIN EU589336_MHBs_P-C of FT:mat_peptide EU589336_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1175-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTGDPVPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|EU670263_MHBs_P-C Product feature CHAIN EU670263_MHBs_P-C of FT:mat_peptide EU670263_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph105). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSTFSRTGDPALNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU717212_MHBs_P-C Product feature CHAIN EU717212_MHBs_P-C of FT:mat_peptide EU717212_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D26K-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU717215_MHBs_P-C Product feature CHAIN EU717215_MHBs_P-C of FT:mat_peptide EU717215_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q67K-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGLLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFPGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPANGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU796069_MHBs_P-C Product feature CHAIN EU796069_MHBs_P-C of FT:mat_peptide EU796069_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGPYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFASFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU796070_MHBs_P-C Product feature CHAIN EU796070_MHBs_P-C of FT:mat_peptide EU796070_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU796072_MHBs_P-C Product feature CHAIN EU796072_MHBs_P-C of FT:mat_peptide EU796072_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871969_MHBs_P-C Product feature CHAIN EU871969_MHBs_P-C of FT:mat_peptide EU871969_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAEFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871970_MHBs_P-C Product feature CHAIN EU871970_MHBs_P-C of FT:mat_peptide EU871970_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLP
VCPLHPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871971_MHBs_P-C Product feature CHAIN EU871971_MHBs_P-C of FT:mat_peptide EU871971_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLCFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFCCLWVYI
>gnl|hbvpro|EU871972_MHBs_P-C Product feature CHAIN EU871972_MHBs_P-C of FT:mat_peptide EU871972_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLALFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871973_MHBs_P-C Product feature CHAIN EU871973_MHBs_P-C of FT:mat_peptide EU871973_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-99-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGLLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871974_MHBs_P-C Product feature CHAIN EU871974_MHBs_P-C of FT:mat_peptide EU871974_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGRLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871975_MHBs_P-C Product feature CHAIN EU871975_MHBs_P-C of FT:mat_peptide EU871975_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871976_MHBs_P-C Product feature CHAIN EU871976_MHBs_P-C of FT:mat_peptide EU871976_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-04-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871977_MHBs_P-C Product feature CHAIN EU871977_MHBs_P-C of FT:mat_peptide EU871977_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASARFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871978_MHBs_P-C Product feature CHAIN EU871978_MHBs_P-C of FT:mat_peptide EU871978_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-2). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQTGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871979_MHBs_P-C Product feature CHAIN EU871979_MHBs_P-C of FT:mat_peptide EU871979_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-4). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSRTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871980_MHBs_P-C Product feature CHAIN EU871980_MHBs_P-C of FT:mat_peptide EU871980_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-01-5). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFHAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871982_MHBs_P-C Product feature CHAIN EU871982_MHBs_P-C of FT:mat_peptide EU871982_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-96-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871998_MHBs_P-C Product feature CHAIN EU871998_MHBs_P-C of FT:mat_peptide EU871998_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-00-5). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFHAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872000_MHBs_P-C Product feature CHAIN EU872000_MHBs_P-C of FT:mat_peptide EU872000_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-2). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTIWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872001_MHBs_P-C Product feature CHAIN EU872001_MHBs_P-C of FT:mat_peptide EU872001_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-8). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872002_MHBs_P-C Product feature CHAIN EU872002_MHBs_P-C of FT:mat_peptide EU872002_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-1). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVCI
>gnl|hbvpro|EU872003_MHBs_P-C Product feature CHAIN EU872003_MHBs_P-C of FT:mat_peptide EU872003_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-2). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872004_MHBs_P-C Product feature CHAIN EU872004_MHBs_P-C of FT:mat_peptide EU872004_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-3). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872008_MHBs_P-C Product feature CHAIN EU872008_MHBs_P-C of FT:mat_peptide EU872008_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252A-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGNSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872010_MHBs_P-C Product feature CHAIN EU872010_MHBs_P-C of FT:mat_peptide EU872010_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-92-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872012_MHBs_P-C Product feature CHAIN EU872012_MHBs_P-C of FT:mat_peptide EU872012_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-99-5). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLLGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU881996_MHBs_P-C Product feature CHAIN EU881996_MHBs_P-C of FT:mat_peptide EU881996_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGTCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|EU882005_MHBs_P-C Product feature CHAIN EU882005_MHBs_P-C of FT:mat_peptide EU882005_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient22). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916210_MHBs_P-C Product feature CHAIN EU916210_MHBs_P-C of FT:mat_peptide EU916210_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2.4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916219_MHBs_P-C Product feature CHAIN EU916219_MHBs_P-C of FT:mat_peptide EU916219_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTTPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKICTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916222_MHBs_P-C Product feature CHAIN EU916222_MHBs_P-C of FT:mat_peptide EU916222_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRAGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916223_MHBs_P-C Product feature CHAIN EU916223_MHBs_P-C of FT:mat_peptide EU916223_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916224_MHBs_P-C Product feature CHAIN EU916224_MHBs_P-C of FT:mat_peptide EU916224_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916225_MHBs_P-C Product feature CHAIN EU916225_MHBs_P-C of FT:mat_peptide EU916225_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWERASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSPYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916233_MHBs_P-C Product feature CHAIN EU916233_MHBs_P-C of FT:mat_peptide EU916233_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNRSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916234_MHBs_P-C Product feature CHAIN EU916234_MHBs_P-C of FT:mat_peptide EU916234_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.2). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTAASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPRKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916237_MHBs_P-C Product feature CHAIN EU916237_MHBs_P-C of FT:mat_peptide EU916237_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSCSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGSLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916238_MHBs_P-C Product feature CHAIN EU916238_MHBs_P-C of FT:mat_peptide EU916238_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU919168_MHBs_P-C Product feature CHAIN EU919168_MHBs_P-C of FT:mat_peptide EU919168_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU919169_MHBs_P-C Product feature CHAIN EU919169_MHBs_P-C of FT:mat_peptide EU919169_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPVPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTATTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|EU939536_MHBs_P-C Product feature CHAIN EU939536_MHBs_P-C of FT:mat_peptide EU939536_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939538_MHBs_P-C Product feature CHAIN EU939538_MHBs_P-C of FT:mat_peptide EU939538_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939539_MHBs_P-C Product feature CHAIN EU939539_MHBs_P-C of FT:mat_peptide EU939539_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRI
LTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGRSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|EU939540_MHBs_P-C Product feature CHAIN EU939540_MHBs_P-C of FT:mat_peptide EU939540_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C24). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939541_MHBs_P-C Product feature CHAIN EU939541_MHBs_P-C of FT:mat_peptide EU939541_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939542_MHBs_P-C Product feature CHAIN EU939542_MHBs_P-C of FT:mat_peptide EU939542_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVSI
>gnl|hbvpro|EU939543_MHBs_P-C Product feature CHAIN EU939543_MHBs_P-C of FT:mat_peptide EU939543_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPTVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939544_MHBs_P-C Product feature CHAIN EU939544_MHBs_P-C of FT:mat_peptide EU939544_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C39). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYT
>gnl|hbvpro|EU939545_MHBs_P-C Product feature CHAIN EU939545_MHBs_P-C of FT:mat_peptide EU939545_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C41). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939546_MHBs_P-C Product feature CHAIN EU939546_MHBs_P-C of FT:mat_peptide EU939546_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939548_MHBs_P-C Product feature CHAIN EU939548_MHBs_P-C of FT:mat_peptide EU939548_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C46). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939550_MHBs_P-C Product feature CHAIN EU939550_MHBs_P-C of FT:mat_peptide EU939550_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C55). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGALKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939552_MHBs_P-C Product feature CHAIN EU939552_MHBs_P-C of FT:mat_peptide EU939552_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C57). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939554_MHBs_P-C Product feature CHAIN EU939554_MHBs_P-C of FT:mat_peptide EU939554_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C61). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYHWMCLRHFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939561_MHBs_P-C Product feature CHAIN EU939561_MHBs_P-C of FT:mat_peptide EU939561_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C70). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPVGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939562_MHBs_P-C Product feature CHAIN EU939562_MHBs_P-C of FT:mat_peptide EU939562_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C75). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939563_MHBs_P-C Product feature CHAIN EU939563_MHBs_P-C of FT:mat_peptide EU939563_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLXIFFCLWVYI
>gnl|hbvpro|EU939564_MHBs_P-C Product feature CHAIN EU939564_MHBs_P-C of FT:mat_peptide EU939564_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C77). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTPASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939566_MHBs_P-C Product feature CHAIN EU939566_MHBs_P-C of FT:mat_peptide EU939566_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C88). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939567_MHBs_P-C Product feature CHAIN EU939567_MHBs_P-C of FT:mat_peptide EU939567_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C91). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGRSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939568_MHBs_P-C Product feature CHAIN EU939568_MHBs_P-C of FT:mat_peptide EU939568_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C93). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTITQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWICLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939570_MHBs_P-C Product feature CHAIN EU939570_MHBs_P-C of FT:mat_peptide EU939570_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C103). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939571_MHBs_P-C Product feature CHAIN EU939571_MHBs_P-C of FT:mat_peptide EU939571_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C104). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939572_MHBs_P-C Product feature CHAIN EU939572_MHBs_P-C of FT:mat_peptide EU939572_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C105). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939573_MHBs_P-C Product feature CHAIN EU939573_MHBs_P-C of FT:mat_peptide EU939573_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C106). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939578_MHBs_P-C Product feature CHAIN EU939578_MHBs_P-C of FT:mat_peptide EU939578_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C119). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939579_MHBs_P-C Product feature CHAIN EU939579_MHBs_P-C of FT:mat_peptide EU939579_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPARGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939582_MHBs_P-C Product feature CHAIN EU939582_MHBs_P-C of FT:mat_peptide EU939582_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B25). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939585_MHBs_P-C Product feature CHAIN EU939585_MHBs_P-C of FT:mat_peptide EU939585_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B126). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939586_MHBs_P-C Product feature CHAIN EU939586_MHBs_P-C of FT:mat_peptide EU939586_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B142). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
TQWNSTTVHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEVPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939587_MHBs_P-C Product feature CHAIN EU939587_MHBs_P-C of FT:mat_peptide EU939587_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|EU939588_MHBs_P-C Product feature CHAIN EU939588_MHBs_P-C of FT:mat_peptide EU939588_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939590_MHBs_P-C Product feature CHAIN EU939590_MHBs_P-C of FT:mat_peptide EU939590_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939591_MHBs_P-C Product feature CHAIN EU939591_MHBs_P-C of FT:mat_peptide EU939591_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C131). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939592_MHBs_P-C Product feature CHAIN EU939592_MHBs_P-C of FT:mat_peptide EU939592_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C141). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGTPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939593_MHBs_P-C Product feature CHAIN EU939593_MHBs_P-C of FT:mat_peptide EU939593_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C144). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939594_MHBs_P-C Product feature CHAIN EU939594_MHBs_P-C of FT:mat_peptide EU939594_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C146). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSPTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939595_MHBs_P-C Product feature CHAIN EU939595_MHBs_P-C of FT:mat_peptide EU939595_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C147). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939596_MHBs_P-C Product feature CHAIN EU939596_MHBs_P-C of FT:mat_peptide EU939596_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C149). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939597_MHBs_P-C Product feature CHAIN EU939597_MHBs_P-C of FT:mat_peptide EU939597_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C151). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939600_MHBs_P-C Product feature CHAIN EU939600_MHBs_P-C of FT:mat_peptide EU939600_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C176). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939601_MHBs_P-C Product feature CHAIN EU939601_MHBs_P-C of FT:mat_peptide EU939601_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C177). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939603_MHBs_P-C Product feature CHAIN EU939603_MHBs_P-C of FT:mat_peptide EU939603_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C183). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGXLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDXNCTCIPIPSSWAFARFLWEWASVRFSWLSLLXPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939604_MHBs_P-C Product feature CHAIN EU939604_MHBs_P-C of FT:mat_peptide EU939604_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C192). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPDGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939605_MHBs_P-C Product feature CHAIN EU939605_MHBs_P-C of FT:mat_peptide EU939605_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C200). Complete genome. [Hepadnaviridae] (length=281 residues).
SQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939607_MHBs_P-C Product feature CHAIN EU939607_MHBs_P-C of FT:mat_peptide EU939607_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQEGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWAFI
>gnl|hbvpro|EU939609_MHBs_P-C Product feature CHAIN EU939609_MHBs_P-C of FT:mat_peptide EU939609_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C209). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939610_MHBs_P-C Product feature CHAIN EU939610_MHBs_P-C of FT:mat_peptide EU939610_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C211). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939611_MHBs_P-C Product feature CHAIN EU939611_MHBs_P-C of FT:mat_peptide EU939611_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C212). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939612_MHBs_P-C Product feature CHAIN EU939612_MHBs_P-C of FT:mat_peptide EU939612_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C213). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939613_MHBs_P-C Product feature CHAIN EU939613_MHBs_P-C of FT:mat_peptide EU939613_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C214). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939614_MHBs_P-C Product feature CHAIN EU939614_MHBs_P-C of FT:mat_peptide EU939614_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C217). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939615_MHBs_P-C Product feature CHAIN EU939615_MHBs_P-C of FT:mat_peptide EU939615_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939616_MHBs_P-C Product feature CHAIN EU939616_MHBs_P-C of FT:mat_peptide EU939616_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C228). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939617_MHBs_P-C Product feature CHAIN EU939617_MHBs_P-C of FT:mat_peptide EU939617_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C229). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939618_MHBs_P-C Product feature CHAIN EU939618_MHBs_P-C of FT:mat_peptide EU939618_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C230). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939619_MHBs_P-C Product feature CHAIN EU939619_MHBs_P-C of FT:mat_peptide EU939619_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C233). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939625_MHBs_P-C Product feature CHAIN EU939625_MHBs_P-C of FT:mat_peptide EU939625_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C167). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPVPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|EU939626_MHBs_P-C Product feature CHAIN EU939626_MHBs_P-C of FT:mat_peptide EU939626_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D158). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPXFFCLWVYI
>gnl|hbvpro|EU939640_MHBs_P-C Product feature CHAIN EU939640_MHBs_P-C of FT:mat_peptide EU939640_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C239). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTXNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939642_MHBs_P-C Product feature CHAIN EU939642_MHBs_P-C of FT:mat_peptide EU939642_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D20). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYTLAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939644_MHBs_P-C Product feature CHAIN EU939644_MHBs_P-C of FT:mat_peptide EU939644_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGEVPKCPGQNSQSPTFNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939647_MHBs_P-C Product feature CHAIN EU939647_MHBs_P-C of FT:mat_peptide EU939647_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D90). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939648_MHBs_P-C Product feature CHAIN EU939648_MHBs_P-C of FT:mat_peptide EU939648_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D96). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPALNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939649_MHBs_P-C Product feature CHAIN EU939649_MHBs_P-C of FT:mat_peptide EU939649_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D98). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSITFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939651_MHBs_P-C Product feature CHAIN EU939651_MHBs_P-C of FT:mat_peptide EU939651_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D104). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPACPGQNSQSPTSNHLPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939652_MHBs_P-C Product feature CHAIN EU939652_MHBs_P-C of FT:mat_peptide EU939652_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D107). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939653_MHBs_P-C Product feature CHAIN EU939653_MHBs_P-C of FT:mat_peptide EU939653_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D109). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939654_MHBs_P-C Product feature CHAIN EU939654_MHBs_P-C of FT:mat_peptide EU939654_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D115). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939655_MHBs_P-C Product feature CHAIN EU939655_MHBs_P-C of FT:mat_peptide EU939655_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWELASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939656_MHBs_P-C Product feature CHAIN EU939656_MHBs_P-C of FT:mat_peptide EU939656_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D117). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWELASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939657_MHBs_P-C Product feature CHAIN EU939657_MHBs_P-C of FT:mat_peptide EU939657_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D139). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNTLRPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939659_MHBs_P-C Product feature CHAIN EU939659_MHBs_P-C of FT:mat_peptide EU939659_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D165). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWTSTTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLSFPGGAPRCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023639_MHBs_P-C Product feature CHAIN FJ023639_MHBs_P-C of FT:mat_peptide FJ023639_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-0968). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIXSRTGDPAPNMESTTSGFLGPLLVLXEGFFXLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023641_MHBs_P-C Product feature CHAIN FJ023641_MHBs_P-C of FT:mat_peptide FJ023641_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1237). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023642_MHBs_P-C Product feature CHAIN FJ023642_MHBs_P-C of FT:mat_peptide FJ023642_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1257). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023643_MHBs_P-C Product feature CHAIN FJ023643_MHBs_P-C of FT:mat_peptide FJ023643_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1306). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023644_MHBs_P-C Product feature CHAIN FJ023644_MHBs_P-C of FT:mat_peptide FJ023644_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1318). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023645_MHBs_P-C Product feature CHAIN FJ023645_MHBs_P-C of FT:mat_peptide FJ023645_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0071). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTLNPVPTTASPISSIFSRTGDPAPNMESTTSGFLRPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDFHGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ023646_MHBs_P-C Product feature CHAIN FJ023646_MHBs_P-C of FT:mat_peptide FJ023646_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0201). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023647_MHBs_P-C Product feature CHAIN FJ023647_MHBs_P-C of FT:mat_peptide FJ023647_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0214). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023648_MHBs_P-C Product feature CHAIN FJ023648_MHBs_P-C of FT:mat_peptide FJ023648_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0273). Complete genome. [Hepadnaviridae] (length=281 residues).
IKWNSSTFHQALLDPRVRGLYIPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023649_MHBs_P-C Product feature CHAIN FJ023649_MHBs_P-C of FT:mat_peptide FJ023649_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0289). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023650_MHBs_P-C Product feature CHAIN FJ023650_MHBs_P-C of FT:mat_peptide FJ023650_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0341). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023653_MHBs_P-C Product feature CHAIN FJ023653_MHBs_P-C of FT:mat_peptide FJ023653_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0909). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023654_MHBs_P-C Product feature CHAIN FJ023654_MHBs_P-C of FT:mat_peptide FJ023654_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1412). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023656_MHBs_P-C Product feature CHAIN FJ023656_MHBs_P-C of FT:mat_peptide FJ023656_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0938). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023657_MHBs_P-C Product feature CHAIN FJ023657_MHBs_P-C of FT:mat_peptide FJ023657_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0987). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023658_MHBs_P-C Product feature CHAIN FJ023658_MHBs_P-C of FT:mat_peptide FJ023658_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-1116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032331_MHBs_P-C Product feature CHAIN FJ032331_MHBs_P-C of FT:mat_peptide FJ032331_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S193-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032333_MHBs_P-C Product feature CHAIN FJ032333_MHBs_P-C of FT:mat_peptide FJ032333_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032334_MHBs_P-C Product feature CHAIN FJ032334_MHBs_P-C of FT:mat_peptide FJ032334_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S445-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032336_MHBs_P-C Product feature CHAIN FJ032336_MHBs_P-C of FT:mat_peptide FJ032336_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTSTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWPSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032338_MHBs_P-C Product feature CHAIN FJ032338_MHBs_P-C of FT:mat_peptide FJ032338_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032339_MHBs_P-C Product feature CHAIN FJ032339_MHBs_P-C of FT:mat_peptide FJ032339_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032340_MHBs_P-C Product feature CHAIN FJ032340_MHBs_P-C of FT:mat_peptide FJ032340_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVHI
>gnl|hbvpro|FJ032341_MHBs_P-C Product feature CHAIN FJ032341_MHBs_P-C of FT:mat_peptide FJ032341_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032345_MHBs_P-C Product feature CHAIN FJ032345_MHBs_P-C of FT:mat_peptide FJ032345_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISPIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|FJ032346_MHBs_P-C Product feature CHAIN FJ032346_MHBs_P-C of FT:mat_peptide FJ032346_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVHLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCIKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032350_MHBs_P-C Product feature CHAIN FJ032350_MHBs_P-C of FT:mat_peptide FJ032350_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPYKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVMWMMWYWGPSLYNILSPFLPLLPIFWCLWVYI
>gnl|hbvpro|FJ032351_MHBs_P-C Product feature CHAIN FJ032351_MHBs_P-C of FT:mat_peptide FJ032351_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWASARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFWCLWAYI
>gnl|hbvpro|FJ032355_MHBs_P-C Product feature CHAIN FJ032355_MHBs_P-C of FT:mat_peptide FJ032355_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPALNMENTTSGFLGPPLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASARFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032356_MHBs_P-C Product feature CHAIN FJ032356_MHBs_P-C of FT:mat_peptide FJ032356_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPTFHQALLDPRVRGLHFPAGGSGSGTVNPVPTTASPISSIFSRTGDPALNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWRTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032359_MHBs_P-C Product feature CHAIN FJ032359_MHBs_P-C of FT:mat_peptide FJ032359_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032361_MHBs_P-C Product feature CHAIN FJ032361_MHBs_P-C of FT:mat_peptide FJ032361_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFASFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349225_MHBs_P-C Product feature CHAIN FJ349225_MHBs_P-C of FT:mat_peptide FJ349225_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H94). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386574_MHBs_P-C Product feature CHAIN FJ386574_MHBs_P-C of FT:mat_peptide FJ386574_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1743). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386575_MHBs_P-C Product feature CHAIN FJ386575_MHBs_P-C of FT:mat_peptide FJ386575_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1745). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386576_MHBs_P-C Product feature CHAIN FJ386576_MHBs_P-C of FT:mat_peptide FJ386576_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1746). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386577_MHBs_P-C Product feature CHAIN FJ386577_MHBs_P-C of FT:mat_peptide FJ386577_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1747). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386579_MHBs_P-C Product feature CHAIN FJ386579_MHBs_P-C of FT:mat_peptide FJ386579_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1762). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386587_MHBs_P-C Product feature CHAIN FJ386587_MHBs_P-C of FT:mat_peptide FJ386587_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1812). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386588_MHBs_P-C Product feature CHAIN FJ386588_MHBs_P-C of FT:mat_peptide FJ386588_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1828). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386589_MHBs_P-C Product feature CHAIN FJ386589_MHBs_P-C of FT:mat_peptide FJ386589_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1830). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRV
LTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386591_MHBs_P-C Product feature CHAIN FJ386591_MHBs_P-C of FT:mat_peptide FJ386591_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1869). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386592_MHBs_P-C Product feature CHAIN FJ386592_MHBs_P-C of FT:mat_peptide FJ386592_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1870). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLXPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386595_MHBs_P-C Product feature CHAIN FJ386595_MHBs_P-C of FT:mat_peptide FJ386595_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1879). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386596_MHBs_P-C Product feature CHAIN FJ386596_MHBs_P-C of FT:mat_peptide FJ386596_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1887). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386597_MHBs_P-C Product feature CHAIN FJ386597_MHBs_P-C of FT:mat_peptide FJ386597_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1888). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386598_MHBs_P-C Product feature CHAIN FJ386598_MHBs_P-C of FT:mat_peptide FJ386598_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1889). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386601_MHBs_P-C Product feature CHAIN FJ386601_MHBs_P-C of FT:mat_peptide FJ386601_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1912). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSATFHQALLDPRVRGLYFPAGGSFSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386602_MHBs_P-C Product feature CHAIN FJ386602_MHBs_P-C of FT:mat_peptide FJ386602_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1914). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLALQAGLFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386603_MHBs_P-C Product feature CHAIN FJ386603_MHBs_P-C of FT:mat_peptide FJ386603_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1949). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHHSLLDPRVRGLYFAAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386604_MHBs_P-C Product feature CHAIN FJ386604_MHBs_P-C of FT:mat_peptide FJ386604_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1950). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFARFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386605_MHBs_P-C Product feature CHAIN FJ386605_MHBs_P-C of FT:mat_peptide FJ386605_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1965). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPXVRGLYFPAGGSSSGTXNPVPTTASPISSIFSRTGDPALNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386607_MHBs_P-C Product feature CHAIN FJ386607_MHBs_P-C of FT:mat_peptide FJ386607_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1967). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGALKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386609_MHBs_P-C Product feature CHAIN FJ386609_MHBs_P-C of FT:mat_peptide FJ386609_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1999). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386611_MHBs_P-C Product feature CHAIN FJ386611_MHBs_P-C of FT:mat_peptide FJ386611_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2018). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGALTCPGRNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386612_MHBs_P-C Product feature CHAIN FJ386612_MHBs_P-C of FT:mat_peptide FJ386612_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2019). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|FJ386613_MHBs_P-C Product feature CHAIN FJ386613_MHBs_P-C of FT:mat_peptide FJ386613_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2039). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386614_MHBs_P-C Product feature CHAIN FJ386614_MHBs_P-C of FT:mat_peptide FJ386614_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2040). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386618_MHBs_P-C Product feature CHAIN FJ386618_MHBs_P-C of FT:mat_peptide FJ386618_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2111). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTXI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386619_MHBs_P-C Product feature CHAIN FJ386619_MHBs_P-C of FT:mat_peptide FJ386619_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2119). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386620_MHBs_P-C Product feature CHAIN FJ386620_MHBs_P-C of FT:mat_peptide FJ386620_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2121). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386623_MHBs_P-C Product feature CHAIN FJ386623_MHBs_P-C of FT:mat_peptide FJ386623_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2165). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386624_MHBs_P-C Product feature CHAIN FJ386624_MHBs_P-C of FT:mat_peptide FJ386624_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2187). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386625_MHBs_P-C Product feature CHAIN FJ386625_MHBs_P-C of FT:mat_peptide FJ386625_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2190). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFARTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386626_MHBs_P-C Product feature CHAIN FJ386626_MHBs_P-C of FT:mat_peptide FJ386626_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2205). Complete genome. [Hepadnaviridae] (length=281 residues).
IHCHSTLFHQVLRDPLVAGGYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFXLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILQLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386627_MHBs_P-C Product feature CHAIN FJ386627_MHBs_P-C of FT:mat_peptide FJ386627_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2242). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386628_MHBs_P-C Product feature CHAIN FJ386628_MHBs_P-C of FT:mat_peptide FJ386628_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2255). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386630_MHBs_P-C Product feature CHAIN FJ386630_MHBs_P-C of FT:mat_peptide FJ386630_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2336). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTXSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGASMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386631_MHBs_P-C Product feature CHAIN FJ386631_MHBs_P-C of FT:mat_peptide FJ386631_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2359). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386632_MHBs_P-C Product feature CHAIN FJ386632_MHBs_P-C of FT:mat_peptide FJ386632_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2370). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDLWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386637_MHBs_P-C Product feature CHAIN FJ386637_MHBs_P-C of FT:mat_peptide FJ386637_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2151). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386639_MHBs_P-C Product feature CHAIN FJ386639_MHBs_P-C of FT:mat_peptide FJ386639_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1929). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386644_MHBs_P-C Product feature CHAIN FJ386644_MHBs_P-C of FT:mat_peptide FJ386644_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S737). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386647_MHBs_P-C Product feature CHAIN FJ386647_MHBs_P-C of FT:mat_peptide FJ386647_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2400). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTANPVPTTASPTSSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFQWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386651_MHBs_P-C Product feature CHAIN FJ386651_MHBs_P-C of FT:mat_peptide FJ386651_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2476). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MHWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386652_MHBs_P-C Product feature CHAIN FJ386652_MHBs_P-C of FT:mat_peptide FJ386652_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2518). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386653_MHBs_P-C Product feature CHAIN FJ386653_MHBs_P-C of FT:mat_peptide FJ386653_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FJ386657_MHBs_P-C Product feature CHAIN FJ386657_MHBs_P-C of FT:mat_peptide FJ386657_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S165). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386659_MHBs_P-C Product feature CHAIN FJ386659_MHBs_P-C of FT:mat_peptide FJ386659_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S219). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386661_MHBs_P-C Product feature CHAIN FJ386661_MHBs_P-C of FT:mat_peptide FJ386661_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S251). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|FJ386662_MHBs_P-C Product feature CHAIN FJ386662_MHBs_P-C of FT:mat_peptide FJ386662_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S269). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386664_MHBs_P-C Product feature CHAIN FJ386664_MHBs_P-C of FT:mat_peptide FJ386664_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S310). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386665_MHBs_P-C Product feature CHAIN FJ386665_MHBs_P-C of FT:mat_peptide FJ386665_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386670_MHBs_P-C Product feature CHAIN FJ386670_MHBs_P-C of FT:mat_peptide FJ386670_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S454). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSXWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386671_MHBs_P-C Product feature CHAIN FJ386671_MHBs_P-C of FT:mat_peptide FJ386671_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S586). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPISNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386672_MHBs_P-C Product feature CHAIN FJ386672_MHBs_P-C of FT:mat_peptide FJ386672_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S606). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ386673_MHBs_P-C Product feature CHAIN FJ386673_MHBs_P-C of FT:mat_peptide FJ386673_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S633). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSXFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILQLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386678_MHBs_P-C Product feature CHAIN FJ386678_MHBs_P-C of FT:mat_peptide FJ386678_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1147). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386679_MHBs_P-C Product feature CHAIN FJ386679_MHBs_P-C of FT:mat_peptide FJ386679_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1217). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386685_MHBs_P-C Product feature CHAIN FJ386685_MHBs_P-C of FT:mat_peptide FJ386685_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1568). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386687_MHBs_P-C Product feature CHAIN FJ386687_MHBs_P-C of FT:mat_peptide FJ386687_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1600). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386689_MHBs_P-C Product feature CHAIN FJ386689_MHBs_P-C of FT:mat_peptide FJ386689_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1649). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPKMYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ518813_MHBs_P-C Product feature CHAIN FJ518813_MHBs_P-C of FT:mat_peptide FJ518813_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FJ562218_MHBs_P-C Product feature CHAIN FJ562218_MHBs_P-C of FT:mat_peptide FJ562218_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562221_MHBs_P-C Product feature CHAIN FJ562221_MHBs_P-C of FT:mat_peptide FJ562221_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I13). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562225_MHBs_P-C Product feature CHAIN FJ562225_MHBs_P-C of FT:mat_peptide FJ562225_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562228_MHBs_P-C Product feature CHAIN FJ562228_MHBs_P-C of FT:mat_peptide FJ562228_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPRSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLSNILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|FJ562230_MHBs_P-C Product feature CHAIN FJ562230_MHBs_P-C of FT:mat_peptide FJ562230_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562232_MHBs_P-C Product feature CHAIN FJ562232_MHBs_P-C of FT:mat_peptide FJ562232_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I45). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562233_MHBs_P-C Product feature CHAIN FJ562233_MHBs_P-C of FT:mat_peptide FJ562233_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562235_MHBs_P-C Product feature CHAIN FJ562235_MHBs_P-C of FT:mat_peptide FJ562235_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I50). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562238_MHBs_P-C Product feature CHAIN FJ562238_MHBs_P-C of FT:mat_peptide FJ562238_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I62). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562239_MHBs_P-C Product feature CHAIN FJ562239_MHBs_P-C of FT:mat_peptide FJ562239_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I64). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562241_MHBs_P-C Product feature CHAIN FJ562241_MHBs_P-C of FT:mat_peptide FJ562241_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I67). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562242_MHBs_P-C Product feature CHAIN FJ562242_MHBs_P-C of FT:mat_peptide FJ562242_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I68). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562243_MHBs_P-C Product feature CHAIN FJ562243_MHBs_P-C of FT:mat_peptide FJ562243_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I71). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQGGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ562244_MHBs_P-C Product feature CHAIN FJ562244_MHBs_P-C of FT:mat_peptide FJ562244_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I72). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562248_MHBs_P-C Product feature CHAIN FJ562248_MHBs_P-C of FT:mat_peptide FJ562248_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I76). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562249_MHBs_P-C Product feature CHAIN FJ562249_MHBs_P-C of FT:mat_peptide FJ562249_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I79). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562250_MHBs_P-C Product feature CHAIN FJ562250_MHBs_P-C of FT:mat_peptide FJ562250_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I83). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLXLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPRLYNILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562251_MHBs_P-C Product feature CHAIN FJ562251_MHBs_P-C of FT:mat_peptide FJ562251_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I84). Complete genome. [Hepadnaviridae] (length=281 residues).
LQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562252_MHBs_P-C Product feature CHAIN FJ562252_MHBs_P-C of FT:mat_peptide FJ562252_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I85). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562255_MHBs_P-C Product feature CHAIN FJ562255_MHBs_P-C of FT:mat_peptide FJ562255_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I92). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFSLTRI
LTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|FJ562256_MHBs_P-C Product feature CHAIN FJ562256_MHBs_P-C of FT:mat_peptide FJ562256_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I95). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPRSPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVSI
>gnl|hbvpro|FJ562258_MHBs_P-C Product feature CHAIN FJ562258_MHBs_P-C of FT:mat_peptide FJ562258_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I97). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562261_MHBs_P-C Product feature CHAIN FJ562261_MHBs_P-C of FT:mat_peptide FJ562261_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I109). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNDSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|FJ562264_MHBs_P-C Product feature CHAIN FJ562264_MHBs_P-C of FT:mat_peptide FJ562264_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I114). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAANMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562265_MHBs_P-C Product feature CHAIN FJ562265_MHBs_P-C of FT:mat_peptide FJ562265_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562266_MHBs_P-C Product feature CHAIN FJ562266_MHBs_P-C of FT:mat_peptide FJ562266_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I118). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562268_MHBs_P-C Product feature CHAIN FJ562268_MHBs_P-C of FT:mat_peptide FJ562268_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I121). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHKALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDXAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562269_MHBs_P-C Product feature CHAIN FJ562269_MHBs_P-C of FT:mat_peptide FJ562269_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I122). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCVRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562272_MHBs_P-C Product feature CHAIN FJ562272_MHBs_P-C of FT:mat_peptide FJ562272_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I125). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562273_MHBs_P-C Product feature CHAIN FJ562273_MHBs_P-C of FT:mat_peptide FJ562273_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I127). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562274_MHBs_P-C Product feature CHAIN FJ562274_MHBs_P-C of FT:mat_peptide FJ562274_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I128). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562275_MHBs_P-C Product feature CHAIN FJ562275_MHBs_P-C of FT:mat_peptide FJ562275_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I129). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562276_MHBs_P-C Product feature CHAIN FJ562276_MHBs_P-C of FT:mat_peptide FJ562276_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I130). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPXSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSSLVPFVQWLVG
LSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562279_MHBs_P-C Product feature CHAIN FJ562279_MHBs_P-C of FT:mat_peptide FJ562279_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I140). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562280_MHBs_P-C Product feature CHAIN FJ562280_MHBs_P-C of FT:mat_peptide FJ562280_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I141). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562281_MHBs_P-C Product feature CHAIN FJ562281_MHBs_P-C of FT:mat_peptide FJ562281_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I143). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562282_MHBs_P-C Product feature CHAIN FJ562282_MHBs_P-C of FT:mat_peptide FJ562282_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I144). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562283_MHBs_P-C Product feature CHAIN FJ562283_MHBs_P-C of FT:mat_peptide FJ562283_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I145). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562284_MHBs_P-C Product feature CHAIN FJ562284_MHBs_P-C of FT:mat_peptide FJ562284_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I146). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562285_MHBs_P-C Product feature CHAIN FJ562285_MHBs_P-C of FT:mat_peptide FJ562285_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I147). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562288_MHBs_P-C Product feature CHAIN FJ562288_MHBs_P-C of FT:mat_peptide FJ562288_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I153). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562291_MHBs_P-C Product feature CHAIN FJ562291_MHBs_P-C of FT:mat_peptide FJ562291_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I163). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562292_MHBs_P-C Product feature CHAIN FJ562292_MHBs_P-C of FT:mat_peptide FJ562292_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I164). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNPTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLAPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWIYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPVQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562293_MHBs_P-C Product feature CHAIN FJ562293_MHBs_P-C of FT:mat_peptide FJ562293_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I167). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562295_MHBs_P-C Product feature CHAIN FJ562295_MHBs_P-C of FT:mat_peptide FJ562295_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I169). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MHRNSTTFHQALLDPLAGGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562298_MHBs_P-C Product feature CHAIN FJ562298_MHBs_P-C of FT:mat_peptide FJ562298_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I174). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562299_MHBs_P-C Product feature CHAIN FJ562299_MHBs_P-C of FT:mat_peptide FJ562299_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I175). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALIHAGVRGLYFPAGGSTSGTAKPAPTTATAISAIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562300_MHBs_P-C Product feature CHAIN FJ562300_MHBs_P-C of FT:mat_peptide FJ562300_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I182). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAANMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562301_MHBs_P-C Product feature CHAIN FJ562301_MHBs_P-C of FT:mat_peptide FJ562301_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I185). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562304_MHBs_P-C Product feature CHAIN FJ562304_MHBs_P-C of FT:mat_peptide FJ562304_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I190). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562306_MHBs_P-C Product feature CHAIN FJ562306_MHBs_P-C of FT:mat_peptide FJ562306_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I196). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562307_MHBs_P-C Product feature CHAIN FJ562307_MHBs_P-C of FT:mat_peptide FJ562307_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I197). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562308_MHBs_P-C Product feature CHAIN FJ562308_MHBs_P-C of FT:mat_peptide FJ562308_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I199). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPXLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562310_MHBs_P-C Product feature CHAIN FJ562310_MHBs_P-C of FT:mat_peptide FJ562310_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I201). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNFTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCSGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562313_MHBs_P-C Product feature CHAIN FJ562313_MHBs_P-C of FT:mat_peptide FJ562313_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I204). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLXFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILQLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562315_MHBs_P-C Product feature CHAIN FJ562315_MHBs_P-C of FT:mat_peptide FJ562315_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I207). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562318_MHBs_P-C Product feature CHAIN FJ562318_MHBs_P-C of FT:mat_peptide FJ562318_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I211). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562319_MHBs_P-C Product feature CHAIN FJ562319_MHBs_P-C of FT:mat_peptide FJ562319_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I212). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSKTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562320_MHBs_P-C Product feature CHAIN FJ562320_MHBs_P-C of FT:mat_peptide FJ562320_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I213). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPXVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPSMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPYVQWFVG
LSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562323_MHBs_P-C Product feature CHAIN FJ562323_MHBs_P-C of FT:mat_peptide FJ562323_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I217). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562324_MHBs_P-C Product feature CHAIN FJ562324_MHBs_P-C of FT:mat_peptide FJ562324_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I219). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562325_MHBs_P-C Product feature CHAIN FJ562325_MHBs_P-C of FT:mat_peptide FJ562325_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I223). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562327_MHBs_P-C Product feature CHAIN FJ562327_MHBs_P-C of FT:mat_peptide FJ562327_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I228). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562329_MHBs_P-C Product feature CHAIN FJ562329_MHBs_P-C of FT:mat_peptide FJ562329_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I230). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562330_MHBs_P-C Product feature CHAIN FJ562330_MHBs_P-C of FT:mat_peptide FJ562330_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I231). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562332_MHBs_P-C Product feature CHAIN FJ562332_MHBs_P-C of FT:mat_peptide FJ562332_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562333_MHBs_P-C Product feature CHAIN FJ562333_MHBs_P-C of FT:mat_peptide FJ562333_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I78). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFRGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562334_MHBs_P-C Product feature CHAIN FJ562334_MHBs_P-C of FT:mat_peptide FJ562334_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I82). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMSLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTNTAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562335_MHBs_P-C Product feature CHAIN FJ562335_MHBs_P-C of FT:mat_peptide FJ562335_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I108). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSKHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562337_MHBs_P-C Product feature CHAIN FJ562337_MHBs_P-C of FT:mat_peptide FJ562337_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I173). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLXPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562339_MHBs_P-C Product feature CHAIN FJ562339_MHBs_P-C of FT:mat_peptide FJ562339_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I205). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRDLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFQWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562340_MHBs_P-C Product feature CHAIN FJ562340_MHBs_P-C of FT:mat_peptide FJ562340_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I220). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNRTPTSCPPICPGYRWMCLRRFIIFLFILLLCLISLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ715341_MHBs_P-C Product feature CHAIN FJ715341_MHBs_P-C of FT:mat_peptide FJ715341_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC11). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDSAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFPGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ715342_MHBs_P-C Product feature CHAIN FJ715342_MHBs_P-C of FT:mat_peptide FJ715342_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715343_MHBs_P-C Product feature CHAIN FJ715343_MHBs_P-C of FT:mat_peptide FJ715343_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSSFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715344_MHBs_P-C Product feature CHAIN FJ715344_MHBs_P-C of FT:mat_peptide FJ715344_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISPIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715350_MHBs_P-C Product feature CHAIN FJ715350_MHBs_P-C of FT:mat_peptide FJ715350_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715351_MHBs_P-C Product feature CHAIN FJ715351_MHBs_P-C of FT:mat_peptide FJ715351_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715352_MHBs_P-C Product feature CHAIN FJ715352_MHBs_P-C of FT:mat_peptide FJ715352_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715353_MHBs_P-C Product feature CHAIN FJ715353_MHBs_P-C of FT:mat_peptide FJ715353_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715355_MHBs_P-C Product feature CHAIN FJ715355_MHBs_P-C of FT:mat_peptide FJ715355_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMDNTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715357_MHBs_P-C Product feature CHAIN FJ715357_MHBs_P-C of FT:mat_peptide FJ715357_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715358_MHBs_P-C Product feature CHAIN FJ715358_MHBs_P-C of FT:mat_peptide FJ715358_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715359_MHBs_P-C Product feature CHAIN FJ715359_MHBs_P-C of FT:mat_peptide FJ715359_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLGSWWTSLNFLGGAPTCPGQSSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGSCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715360_MHBs_P-C Product feature CHAIN FJ715360_MHBs_P-C of FT:mat_peptide FJ715360_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC62). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ715364_MHBs_P-C Product feature CHAIN FJ715364_MHBs_P-C of FT:mat_peptide FJ715364_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC72). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGPSMFPSRCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715365_MHBs_P-C Product feature CHAIN FJ715365_MHBs_P-C of FT:mat_peptide FJ715365_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC73). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715366_MHBs_P-C Product feature CHAIN FJ715366_MHBs_P-C of FT:mat_peptide FJ715366_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC74). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715367_MHBs_P-C Product feature CHAIN FJ715367_MHBs_P-C of FT:mat_peptide FJ715367_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC75). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715368_MHBs_P-C Product feature CHAIN FJ715368_MHBs_P-C of FT:mat_peptide FJ715368_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC81). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715370_MHBs_P-C Product feature CHAIN FJ715370_MHBs_P-C of FT:mat_peptide FJ715370_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC83). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715371_MHBs_P-C Product feature CHAIN FJ715371_MHBs_P-C of FT:mat_peptide FJ715371_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715372_MHBs_P-C Product feature CHAIN FJ715372_MHBs_P-C of FT:mat_peptide FJ715372_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSITFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPIPSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715374_MHBs_P-C Product feature CHAIN FJ715374_MHBs_P-C of FT:mat_peptide FJ715374_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715375_MHBs_P-C Product feature CHAIN FJ715375_MHBs_P-C of FT:mat_peptide FJ715375_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715376_MHBs_P-C Product feature CHAIN FJ715376_MHBs_P-C of FT:mat_peptide FJ715376_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILGPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715377_MHBs_P-C Product feature CHAIN FJ715377_MHBs_P-C of FT:mat_peptide FJ715377_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTPCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWRPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715378_MHBs_P-C Product feature CHAIN FJ715378_MHBs_P-C of FT:mat_peptide FJ715378_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715379_MHBs_P-C Product feature CHAIN FJ715379_MHBs_P-C of FT:mat_peptide FJ715379_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDENCTCIPIPSSWTIARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715380_MHBs_P-C Product feature CHAIN FJ715380_MHBs_P-C of FT:mat_peptide FJ715380_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715381_MHBs_P-C Product feature CHAIN FJ715381_MHBs_P-C of FT:mat_peptide FJ715381_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRTGDPAPNMESTTSGFLGPLLMLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VRPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715382_MHBs_P-C Product feature CHAIN FJ715382_MHBs_P-C of FT:mat_peptide FJ715382_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715383_MHBs_P-C Product feature CHAIN FJ715383_MHBs_P-C of FT:mat_peptide FJ715383_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715389_MHBs_P-C Product feature CHAIN FJ715389_MHBs_P-C of FT:mat_peptide FJ715389_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM62). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPSQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFIWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715390_MHBs_P-C Product feature CHAIN FJ715390_MHBs_P-C of FT:mat_peptide FJ715390_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM63). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715391_MHBs_P-C Product feature CHAIN FJ715391_MHBs_P-C of FT:mat_peptide FJ715391_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715392_MHBs_P-C Product feature CHAIN FJ715392_MHBs_P-C of FT:mat_peptide FJ715392_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM71). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFARTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715395_MHBs_P-C Product feature CHAIN FJ715395_MHBs_P-C of FT:mat_peptide FJ715395_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM81). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715397_MHBs_P-C Product feature CHAIN FJ715397_MHBs_P-C of FT:mat_peptide FJ715397_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVM83). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFIQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715398_MHBs_P-C Product feature CHAIN FJ715398_MHBs_P-C of FT:mat_peptide FJ715398_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715400_MHBs_P-C Product feature CHAIN FJ715400_MHBs_P-C of FT:mat_peptide FJ715400_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRCMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715402_MHBs_P-C Product feature CHAIN FJ715402_MHBs_P-C of FT:mat_peptide FJ715402_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNRTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715403_MHBs_P-C Product feature CHAIN FJ715403_MHBs_P-C of FT:mat_peptide FJ715403_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715404_MHBs_P-C Product feature CHAIN FJ715404_MHBs_P-C of FT:mat_peptide FJ715404_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVFLDYQGMLP
VCPLLPGTPTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPPVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715405_MHBs_P-C Product feature CHAIN FJ715405_MHBs_P-C of FT:mat_peptide FJ715405_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRTGDPAPNMESTTSGFLGPLLMLQAGFLLLTRV
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VRPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|FJ715406_MHBs_P-C Product feature CHAIN FJ715406_MHBs_P-C of FT:mat_peptide FJ715406_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRTGDPAPNMESTTSGFLGPLLMLQAGFLLLTRV
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VRPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|FJ715407_MHBs_P-C Product feature CHAIN FJ715407_MHBs_P-C of FT:mat_peptide FJ715407_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN41). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715409_MHBs_P-C Product feature CHAIN FJ715409_MHBs_P-C of FT:mat_peptide FJ715409_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715415_MHBs_P-C Product feature CHAIN FJ715415_MHBs_P-C of FT:mat_peptide FJ715415_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN61). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPRKTCTSPAQGTSMLPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCYLWVYI
>gnl|hbvpro|FJ715416_MHBs_P-C Product feature CHAIN FJ715416_MHBs_P-C of FT:mat_peptide FJ715416_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN62). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMLPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCYLWVYI
>gnl|hbvpro|FJ715418_MHBs_P-C Product feature CHAIN FJ715418_MHBs_P-C of FT:mat_peptide FJ715418_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPASNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVHFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715421_MHBs_P-C Product feature CHAIN FJ715421_MHBs_P-C of FT:mat_peptide FJ715421_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN71). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRTGDPAPNMESTTSGFLGPLLMLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VRPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ715422_MHBs_P-C Product feature CHAIN FJ715422_MHBs_P-C of FT:mat_peptide FJ715422_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVN72). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFARTGGPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787437_MHBs_P-C Product feature CHAIN FJ787437_MHBs_P-C of FT:mat_peptide FJ787437_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S129-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFARFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787439_MHBs_P-C Product feature CHAIN FJ787439_MHBs_P-C of FT:mat_peptide FJ787439_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-4). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787441_MHBs_P-C Product feature CHAIN FJ787441_MHBs_P-C of FT:mat_peptide FJ787441_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-9). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPIPSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSLLSLLVPFVQWFIG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787442_MHBs_P-C Product feature CHAIN FJ787442_MHBs_P-C of FT:mat_peptide FJ787442_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787443_MHBs_P-C Product feature CHAIN FJ787443_MHBs_P-C of FT:mat_peptide FJ787443_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVSQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787445_MHBs_P-C Product feature CHAIN FJ787445_MHBs_P-C of FT:mat_peptide FJ787445_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S425-2). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787447_MHBs_P-C Product feature CHAIN FJ787447_MHBs_P-C of FT:mat_peptide FJ787447_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S461-2). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|FJ787448_MHBs_P-C Product feature CHAIN FJ787448_MHBs_P-C of FT:mat_peptide FJ787448_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S461-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPGVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICLGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCRTKPSDGNCTCIPIPSFWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|FJ787449_MHBs_P-C Product feature CHAIN FJ787449_MHBs_P-C of FT:mat_peptide FJ787449_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S567-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTINPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRLIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQRFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|FJ787450_MHBs_P-C Product feature CHAIN FJ787450_MHBs_P-C of FT:mat_peptide FJ787450_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S627-2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPTSSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVE
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787452_MHBs_P-C Product feature CHAIN FJ787452_MHBs_P-C of FT:mat_peptide FJ787452_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S955-2). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFYLWAYI
>gnl|hbvpro|FJ787453_MHBs_P-C Product feature CHAIN FJ787453_MHBs_P-C of FT:mat_peptide FJ787453_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWVWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787454_MHBs_P-C Product feature CHAIN FJ787454_MHBs_P-C of FT:mat_peptide FJ787454_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWVWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787455_MHBs_P-C Product feature CHAIN FJ787455_MHBs_P-C of FT:mat_peptide FJ787455_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ787456_MHBs_P-C Product feature CHAIN FJ787456_MHBs_P-C of FT:mat_peptide FJ787456_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ787457_MHBs_P-C Product feature CHAIN FJ787457_MHBs_P-C of FT:mat_peptide FJ787457_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787458_MHBs_P-C Product feature CHAIN FJ787458_MHBs_P-C of FT:mat_peptide FJ787458_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-9). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787462_MHBs_P-C Product feature CHAIN FJ787462_MHBs_P-C of FT:mat_peptide FJ787462_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPTPSSWAFARFLWEWASVRFSSLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787464_MHBs_P-C Product feature CHAIN FJ787464_MHBs_P-C of FT:mat_peptide FJ787464_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787465_MHBs_P-C Product feature CHAIN FJ787465_MHBs_P-C of FT:mat_peptide FJ787465_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-5). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787466_MHBs_P-C Product feature CHAIN FJ787466_MHBs_P-C of FT:mat_peptide FJ787466_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPIVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGASMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPLVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787467_MHBs_P-C Product feature CHAIN FJ787467_MHBs_P-C of FT:mat_peptide FJ787467_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-16). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPIVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDLWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTIPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787468_MHBs_P-C Product feature CHAIN FJ787468_MHBs_P-C of FT:mat_peptide FJ787468_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDLWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787469_MHBs_P-C Product feature CHAIN FJ787469_MHBs_P-C of FT:mat_peptide FJ787469_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787470_MHBs_P-C Product feature CHAIN FJ787470_MHBs_P-C of FT:mat_peptide FJ787470_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSMTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLRLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYV
>gnl|hbvpro|FJ787471_MHBs_P-C Product feature CHAIN FJ787471_MHBs_P-C of FT:mat_peptide FJ787471_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
ACPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787479_MHBs_P-C Product feature CHAIN FJ787479_MHBs_P-C of FT:mat_peptide FJ787479_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-7). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
ACPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWFSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ787486_MHBs_P-C Product feature CHAIN FJ787486_MHBs_P-C of FT:mat_peptide FJ787486_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2235-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|FJ899761_MHBs_P-C Product feature CHAIN FJ899761_MHBs_P-C of FT:mat_peptide FJ899761_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-1). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899763_MHBs_P-C Product feature CHAIN FJ899763_MHBs_P-C of FT:mat_peptide FJ899763_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-4). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899764_MHBs_P-C Product feature CHAIN FJ899764_MHBs_P-C of FT:mat_peptide FJ899764_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-12). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899765_MHBs_P-C Product feature CHAIN FJ899765_MHBs_P-C of FT:mat_peptide FJ899765_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-13). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWSSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899767_MHBs_P-C Product feature CHAIN FJ899767_MHBs_P-C of FT:mat_peptide FJ899767_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26-2). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVFI
>gnl|hbvpro|FJ899769_MHBs_P-C Product feature CHAIN FJ899769_MHBs_P-C of FT:mat_peptide FJ899769_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-3). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILGPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899770_MHBs_P-C Product feature CHAIN FJ899770_MHBs_P-C of FT:mat_peptide FJ899770_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-4). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGETPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899771_MHBs_P-C Product feature CHAIN FJ899771_MHBs_P-C of FT:mat_peptide FJ899771_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-5). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPTFFCLWVYI
>gnl|hbvpro|FJ899772_MHBs_P-C Product feature CHAIN FJ899772_MHBs_P-C of FT:mat_peptide FJ899772_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C113-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|FJ899773_MHBs_P-C Product feature CHAIN FJ899773_MHBs_P-C of FT:mat_peptide FJ899773_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C113-6). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPILSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMRYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899774_MHBs_P-C Product feature CHAIN FJ899774_MHBs_P-C of FT:mat_peptide FJ899774_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-5). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGHRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPARGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ899775_MHBs_P-C Product feature CHAIN FJ899775_MHBs_P-C of FT:mat_peptide FJ899775_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-6). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899776_MHBs_P-C Product feature CHAIN FJ899776_MHBs_P-C of FT:mat_peptide FJ899776_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C122-7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|FJ899777_MHBs_P-C Product feature CHAIN FJ899777_MHBs_P-C of FT:mat_peptide FJ899777_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899778_MHBs_P-C Product feature CHAIN FJ899778_MHBs_P-C of FT:mat_peptide FJ899778_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173-1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTEPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899783_MHBs_P-C Product feature CHAIN FJ899783_MHBs_P-C of FT:mat_peptide FJ899783_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVG
LSPTVWLSVIWMMWYWGPGLYNILSPFLPLLPIFFYLWAYI
>gnl|hbvpro|FJ899788_MHBs_P-C Product feature CHAIN FJ899788_MHBs_P-C of FT:mat_peptide FJ899788_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899789_MHBs_P-C Product feature CHAIN FJ899789_MHBs_P-C of FT:mat_peptide FJ899789_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ184326_MHBs_P-C Product feature CHAIN GQ184326_MHBs_P-C of FT:mat_peptide GQ184326_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZADGM501). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPAKISQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ227692_MHBs_P-C Product feature CHAIN GQ227692_MHBs_P-C of FT:mat_peptide GQ227692_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDLAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVTWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ227693_MHBs_P-C Product feature CHAIN GQ227693_MHBs_P-C of FT:mat_peptide GQ227693_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-1). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ227694_MHBs_P-C Product feature CHAIN GQ227694_MHBs_P-C of FT:mat_peptide GQ227694_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-2). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ227695_MHBs_P-C Product feature CHAIN GQ227695_MHBs_P-C of FT:mat_peptide GQ227695_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-5). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ227696_MHBs_P-C Product feature CHAIN GQ227696_MHBs_P-C of FT:mat_peptide GQ227696_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-6). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYV
>gnl|hbvpro|GQ227697_MHBs_P-C Product feature CHAIN GQ227697_MHBs_P-C of FT:mat_peptide GQ227697_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ259588_MHBs_P-C Product feature CHAIN GQ259588_MHBs_P-C of FT:mat_peptide GQ259588_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ358153_MHBs_P-C Product feature CHAIN GQ358153_MHBs_P-C of FT:mat_peptide GQ358153_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIHB006). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQSLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLVVLQAGFFLLTKI
LTIPQNLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPIVWLSVIWMMWYWGPNLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ358154_MHBs_P-C Product feature CHAIN GQ358154_MHBs_P-C of FT:mat_peptide GQ358154_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SLK126). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ358157_MHBs_P-C Product feature CHAIN GQ358157_MHBs_P-C of FT:mat_peptide GQ358157_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M007). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ358158_MHBs_C-C Product feature CHAIN GQ358158_MHBs_C-C of FT:mat_peptide GQ358158_MHBs_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M154). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRSGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|GQ372968_MHBs_P-C Product feature CHAIN GQ372968_MHBs_P-C of FT:mat_peptide GQ372968_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6380-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQRNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377514_MHBs_P-C Product feature CHAIN GQ377514_MHBs_P-C of FT:mat_peptide GQ377514_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J8). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377515_MHBs_P-C Product feature CHAIN GQ377515_MHBs_P-C of FT:mat_peptide GQ377515_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377517_MHBs_P-C Product feature CHAIN GQ377517_MHBs_P-C of FT:mat_peptide GQ377517_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDLAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377518_MHBs_P-C Product feature CHAIN GQ377518_MHBs_P-C of FT:mat_peptide GQ377518_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPXSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377521_MHBs_P-C Product feature CHAIN GQ377521_MHBs_P-C of FT:mat_peptide GQ377521_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377523_MHBs_P-C Product feature CHAIN GQ377523_MHBs_P-C of FT:mat_peptide GQ377523_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377524_MHBs_P-C Product feature CHAIN GQ377524_MHBs_P-C of FT:mat_peptide GQ377524_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J23). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTKFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQLFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377526_MHBs_P-C Product feature CHAIN GQ377526_MHBs_P-C of FT:mat_peptide GQ377526_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAANMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377527_MHBs_P-C Product feature CHAIN GQ377527_MHBs_P-C of FT:mat_peptide GQ377527_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377528_MHBs_P-C Product feature CHAIN GQ377528_MHBs_P-C of FT:mat_peptide GQ377528_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J29). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377529_MHBs_P-C Product feature CHAIN GQ377529_MHBs_P-C of FT:mat_peptide GQ377529_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J34). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|GQ377530_MHBs_P-C Product feature CHAIN GQ377530_MHBs_P-C of FT:mat_peptide GQ377530_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J35). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQXGFXLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377533_MHBs_P-C Product feature CHAIN GQ377533_MHBs_P-C of FT:mat_peptide GQ377533_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J39). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSLSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377536_MHBs_P-C Product feature CHAIN GQ377536_MHBs_P-C of FT:mat_peptide GQ377536_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377538_MHBs_P-C Product feature CHAIN GQ377538_MHBs_P-C of FT:mat_peptide GQ377538_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J52). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVHPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377540_MHBs_P-C Product feature CHAIN GQ377540_MHBs_P-C of FT:mat_peptide GQ377540_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J57). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377541_MHBs_P-C Product feature CHAIN GQ377541_MHBs_P-C of FT:mat_peptide GQ377541_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J58). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMEXTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377543_MHBs_P-C Product feature CHAIN GQ377543_MHBs_P-C of FT:mat_peptide GQ377543_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J63). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTXGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377545_MHBs_P-C Product feature CHAIN GQ377545_MHBs_P-C of FT:mat_peptide GQ377545_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J76). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377546_MHBs_P-C Product feature CHAIN GQ377546_MHBs_P-C of FT:mat_peptide GQ377546_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J77). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377551_MHBs_P-C Product feature CHAIN GQ377551_MHBs_P-C of FT:mat_peptide GQ377551_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J82). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377552_MHBs_P-C Product feature CHAIN GQ377552_MHBs_P-C of FT:mat_peptide GQ377552_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J83). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMEXTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377553_MHBs_P-C Product feature CHAIN GQ377553_MHBs_P-C of FT:mat_peptide GQ377553_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J84). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIYLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377554_MHBs_P-C Product feature CHAIN GQ377554_MHBs_P-C of FT:mat_peptide GQ377554_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J85). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377555_MHBs_P-C Product feature CHAIN GQ377555_MHBs_P-C of FT:mat_peptide GQ377555_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J86). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377557_MHBs_P-C Product feature CHAIN GQ377557_MHBs_P-C of FT:mat_peptide GQ377557_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J88). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPSMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNIWSRFIPLLPIFLCLWVYI
>gnl|hbvpro|GQ377559_MHBs_P-C Product feature CHAIN GQ377559_MHBs_P-C of FT:mat_peptide GQ377559_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J92). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377562_MHBs_P-C Product feature CHAIN GQ377562_MHBs_P-C of FT:mat_peptide GQ377562_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J97). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377563_MHBs_P-C Product feature CHAIN GQ377563_MHBs_P-C of FT:mat_peptide GQ377563_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J98). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377570_MHBs_P-C Product feature CHAIN GQ377570_MHBs_P-C of FT:mat_peptide GQ377570_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J110). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFFWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377571_MHBs_P-C Product feature CHAIN GQ377571_MHBs_P-C of FT:mat_peptide GQ377571_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J112). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSILSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|GQ377572_MHBs_P-C Product feature CHAIN GQ377572_MHBs_P-C of FT:mat_peptide GQ377572_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J113). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377574_MHBs_P-C Product feature CHAIN GQ377574_MHBs_P-C of FT:mat_peptide GQ377574_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J115). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377575_MHBs_P-C Product feature CHAIN GQ377575_MHBs_P-C of FT:mat_peptide GQ377575_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J116). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377576_MHBs_P-C Product feature CHAIN GQ377576_MHBs_P-C of FT:mat_peptide GQ377576_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J117). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377577_MHBs_P-C Product feature CHAIN GQ377577_MHBs_P-C of FT:mat_peptide GQ377577_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J118). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377578_MHBs_P-C Product feature CHAIN GQ377578_MHBs_P-C of FT:mat_peptide GQ377578_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J125). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377579_MHBs_P-C Product feature CHAIN GQ377579_MHBs_P-C of FT:mat_peptide GQ377579_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J126). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377580_MHBs_P-C Product feature CHAIN GQ377580_MHBs_P-C of FT:mat_peptide GQ377580_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J127). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPATNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377583_MHBs_P-C Product feature CHAIN GQ377583_MHBs_P-C of FT:mat_peptide GQ377583_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J132). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377584_MHBs_P-C Product feature CHAIN GQ377584_MHBs_P-C of FT:mat_peptide GQ377584_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J133). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTENPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377585_MHBs_P-C Product feature CHAIN GQ377585_MHBs_P-C of FT:mat_peptide GQ377585_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J134). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377586_MHBs_P-C Product feature CHAIN GQ377586_MHBs_P-C of FT:mat_peptide GQ377586_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J135). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377591_MHBs_P-C Product feature CHAIN GQ377591_MHBs_P-C of FT:mat_peptide GQ377591_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J148). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377593_MHBs_P-C Product feature CHAIN GQ377593_MHBs_P-C of FT:mat_peptide GQ377593_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J150). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377597_MHBs_P-C Product feature CHAIN GQ377597_MHBs_P-C of FT:mat_peptide GQ377597_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J157). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377598_MHBs_P-C Product feature CHAIN GQ377598_MHBs_P-C of FT:mat_peptide GQ377598_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J158). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377599_MHBs_P-C Product feature CHAIN GQ377599_MHBs_P-C of FT:mat_peptide GQ377599_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J160). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFXLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|GQ377600_MHBs_P-C Product feature CHAIN GQ377600_MHBs_P-C of FT:mat_peptide GQ377600_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J161). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377601_MHBs_P-C Product feature CHAIN GQ377601_MHBs_P-C of FT:mat_peptide GQ377601_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J164). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPITASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377603_MHBs_P-C Product feature CHAIN GQ377603_MHBs_P-C of FT:mat_peptide GQ377603_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J166). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377605_MHBs_P-C Product feature CHAIN GQ377605_MHBs_P-C of FT:mat_peptide GQ377605_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J169). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377608_MHBs_P-C Product feature CHAIN GQ377608_MHBs_P-C of FT:mat_peptide GQ377608_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J174). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSSFSRTGDLAPNMENTTSGLLGPLLVLQAGFFLLTRI
LKIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377609_MHBs_P-C Product feature CHAIN GQ377609_MHBs_P-C of FT:mat_peptide GQ377609_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J176). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMEXTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|GQ377615_MHBs_P-C Product feature CHAIN GQ377615_MHBs_P-C of FT:mat_peptide GQ377615_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J186). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|GQ377616_MHBs_P-C Product feature CHAIN GQ377616_MHBs_P-C of FT:mat_peptide GQ377616_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J192). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377617_MHBs_P-C Product feature CHAIN GQ377617_MHBs_P-C of FT:mat_peptide GQ377617_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J193). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377618_MHBs_P-C Product feature CHAIN GQ377618_MHBs_P-C of FT:mat_peptide GQ377618_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J194). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFARTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377619_MHBs_P-C Product feature CHAIN GQ377619_MHBs_P-C of FT:mat_peptide GQ377619_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J195). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTPSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377620_MHBs_P-C Product feature CHAIN GQ377620_MHBs_P-C of FT:mat_peptide GQ377620_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J197). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFWWVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377621_MHBs_P-C Product feature CHAIN GQ377621_MHBs_P-C of FT:mat_peptide GQ377621_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J206). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377623_MHBs_P-C Product feature CHAIN GQ377623_MHBs_P-C of FT:mat_peptide GQ377623_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J208). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377624_MHBs_P-C Product feature CHAIN GQ377624_MHBs_P-C of FT:mat_peptide GQ377624_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J221). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPASNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377628_MHBs_P-C Product feature CHAIN GQ377628_MHBs_P-C of FT:mat_peptide GQ377628_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J232). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFXRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTXI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|GQ377631_MHBs_P-C Product feature CHAIN GQ377631_MHBs_P-C of FT:mat_peptide GQ377631_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J239). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377632_MHBs_P-C Product feature CHAIN GQ377632_MHBs_P-C of FT:mat_peptide GQ377632_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J240). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377636_MHBs_P-C Product feature CHAIN GQ377636_MHBs_P-C of FT:mat_peptide GQ377636_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J248). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ377637_MHBs_P-C Product feature CHAIN GQ377637_MHBs_P-C of FT:mat_peptide GQ377637_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J249). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377640_MHBs_P-C Product feature CHAIN GQ377640_MHBs_P-C of FT:mat_peptide GQ377640_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J253). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377642_MHBs_P-C Product feature CHAIN GQ377642_MHBs_P-C of FT:mat_peptide GQ377642_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J256). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475305_MHBs_P-C Product feature CHAIN GQ475305_MHBs_P-C of FT:mat_peptide GQ475305_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR1CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475306_MHBs_P-C Product feature CHAIN GQ475306_MHBs_P-C of FT:mat_peptide GQ475306_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR2CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475307_MHBs_P-C Product feature CHAIN GQ475307_MHBs_P-C of FT:mat_peptide GQ475307_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR3CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475308_MHBs_P-C Product feature CHAIN GQ475308_MHBs_P-C of FT:mat_peptide GQ475308_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR4CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475309_MHBs_P-C Product feature CHAIN GQ475309_MHBs_P-C of FT:mat_peptide GQ475309_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR5CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475310_MHBs_P-C Product feature CHAIN GQ475310_MHBs_P-C of FT:mat_peptide GQ475310_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR6CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475311_MHBs_P-C Product feature CHAIN GQ475311_MHBs_P-C of FT:mat_peptide GQ475311_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR7CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475312_MHBs_P-C Product feature CHAIN GQ475312_MHBs_P-C of FT:mat_peptide GQ475312_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR8CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475313_MHBs_P-C Product feature CHAIN GQ475313_MHBs_P-C of FT:mat_peptide GQ475313_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR9CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475314_MHBs_P-C Product feature CHAIN GQ475314_MHBs_P-C of FT:mat_peptide GQ475314_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR10CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475315_MHBs_P-C Product feature CHAIN GQ475315_MHBs_P-C of FT:mat_peptide GQ475315_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR11CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475316_MHBs_P-C Product feature CHAIN GQ475316_MHBs_P-C of FT:mat_peptide GQ475316_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR12CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475317_MHBs_P-C Product feature CHAIN GQ475317_MHBs_P-C of FT:mat_peptide GQ475317_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR13CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475318_MHBs_P-C Product feature CHAIN GQ475318_MHBs_P-C of FT:mat_peptide GQ475318_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR14CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475319_MHBs_P-C Product feature CHAIN GQ475319_MHBs_P-C of FT:mat_peptide GQ475319_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR15CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475320_MHBs_P-C Product feature CHAIN GQ475320_MHBs_P-C of FT:mat_peptide GQ475320_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR16CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475321_MHBs_P-C Product feature CHAIN GQ475321_MHBs_P-C of FT:mat_peptide GQ475321_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR17CHB). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475322_MHBs_P-C Product feature CHAIN GQ475322_MHBs_P-C of FT:mat_peptide GQ475322_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR18LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475323_MHBs_P-C Product feature CHAIN GQ475323_MHBs_P-C of FT:mat_peptide GQ475323_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR19LC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475324_MHBs_P-C Product feature CHAIN GQ475324_MHBs_P-C of FT:mat_peptide GQ475324_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR20LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475325_MHBs_P-C Product feature CHAIN GQ475325_MHBs_P-C of FT:mat_peptide GQ475325_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR21LC). Non-functional genomic sequence. [Hepadnaviridae] (length=279 residues).
MQWNSTTFHQALLDPRVRGLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLS
PTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475327_MHBs_P-C Product feature CHAIN GQ475327_MHBs_P-C of FT:mat_peptide GQ475327_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR23LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475328_MHBs_P-C Product feature CHAIN GQ475328_MHBs_P-C of FT:mat_peptide GQ475328_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR24LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475329_MHBs_P-C Product feature CHAIN GQ475329_MHBs_P-C of FT:mat_peptide GQ475329_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR25LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475330_MHBs_P-C Product feature CHAIN GQ475330_MHBs_P-C of FT:mat_peptide GQ475330_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR26LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475331_MHBs_P-C Product feature CHAIN GQ475331_MHBs_P-C of FT:mat_peptide GQ475331_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR27LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475332_MHBs_P-C Product feature CHAIN GQ475332_MHBs_P-C of FT:mat_peptide GQ475332_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR28LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475334_MHBs_P-C Product feature CHAIN GQ475334_MHBs_P-C of FT:mat_peptide GQ475334_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR30LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475336_MHBs_P-C Product feature CHAIN GQ475336_MHBs_P-C of FT:mat_peptide GQ475336_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR32LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ475337_MHBs_P-C Product feature CHAIN GQ475337_MHBs_P-C of FT:mat_peptide GQ475337_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR33LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475338_MHBs_P-C Product feature CHAIN GQ475338_MHBs_P-C of FT:mat_peptide GQ475338_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR34LC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ475339_MHBs_P-C Product feature CHAIN GQ475339_MHBs_P-C of FT:mat_peptide GQ475339_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR35HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475341_MHBs_P-C Product feature CHAIN GQ475341_MHBs_P-C of FT:mat_peptide GQ475341_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR37HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475342_MHBs_P-C Product feature CHAIN GQ475342_MHBs_P-C of FT:mat_peptide GQ475342_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR38HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475344_MHBs_P-C Product feature CHAIN GQ475344_MHBs_P-C of FT:mat_peptide GQ475344_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR40HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475345_MHBs_P-C Product feature CHAIN GQ475345_MHBs_P-C of FT:mat_peptide GQ475345_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR41HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475346_MHBs_P-C Product feature CHAIN GQ475346_MHBs_P-C of FT:mat_peptide GQ475346_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR42HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475347_MHBs_P-C Product feature CHAIN GQ475347_MHBs_P-C of FT:mat_peptide GQ475347_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR43HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475348_MHBs_P-C Product feature CHAIN GQ475348_MHBs_P-C of FT:mat_peptide GQ475348_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR44HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475349_MHBs_P-C Product feature CHAIN GQ475349_MHBs_P-C of FT:mat_peptide GQ475349_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR45HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475350_MHBs_P-C Product feature CHAIN GQ475350_MHBs_P-C of FT:mat_peptide GQ475350_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR46HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475351_MHBs_P-C Product feature CHAIN GQ475351_MHBs_P-C of FT:mat_peptide GQ475351_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR47HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVKGLYFPAGGSSSGTVHPVPTTALPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ475353_MHBs_P-C Product feature CHAIN GQ475353_MHBs_P-C of FT:mat_peptide GQ475353_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR49HCC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKICTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ475354_MHBs_P-C Product feature CHAIN GQ475354_MHBs_P-C of FT:mat_peptide GQ475354_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR50HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475355_MHBs_P-C Product feature CHAIN GQ475355_MHBs_P-C of FT:mat_peptide GQ475355_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR51HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQXXXDSRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFXGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCXRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475356_MHBs_P-C Product feature CHAIN GQ475356_MHBs_P-C of FT:mat_peptide GQ475356_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR52HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGXSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ475357_MHBs_P-C Product feature CHAIN GQ475357_MHBs_P-C of FT:mat_peptide GQ475357_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KOR53HCC). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWXWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ855376_MHBs_P-C Product feature CHAIN GQ855376_MHBs_P-C of FT:mat_peptide GQ855376_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 1352). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLRPLHVLQEGFFSLTRI
LTIPQSLDSWWTSLNFLEGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ855393_MHBs_P-C Product feature CHAIN GQ855393_MHBs_P-C of FT:mat_peptide GQ855393_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate migrant 2892). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ872210_MHBs_P-C Product feature CHAIN GQ872210_MHBs_P-C of FT:mat_peptide GQ872210_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ872211_MHBs_P-C Product feature CHAIN GQ872211_MHBs_P-C of FT:mat_peptide GQ872211_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMGYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924604_MHBs_P-C Product feature CHAIN GQ924604_MHBs_P-C of FT:mat_peptide GQ924604_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924609_MHBs_P-C Product feature CHAIN GQ924609_MHBs_P-C of FT:mat_peptide GQ924609_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924612_MHBs_P-C Product feature CHAIN GQ924612_MHBs_P-C of FT:mat_peptide GQ924612_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30a). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924613_MHBs_P-C Product feature CHAIN GQ924613_MHBs_P-C of FT:mat_peptide GQ924613_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M30b). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924614_MHBs_P-C Product feature CHAIN GQ924614_MHBs_P-C of FT:mat_peptide GQ924614_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924615_MHBs_P-C Product feature CHAIN GQ924615_MHBs_P-C of FT:mat_peptide GQ924615_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M32). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924616_MHBs_P-C Product feature CHAIN GQ924616_MHBs_P-C of FT:mat_peptide GQ924616_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924620_MHBs_C-C Product feature CHAIN GQ924620_MHBs_C-C of FT:mat_peptide GQ924620_MHBs_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTTNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNXQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASARFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVFI
>gnl|hbvpro|GQ924622_MHBs_P-C Product feature CHAIN GQ924622_MHBs_P-C of FT:mat_peptide GQ924622_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M40). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924629_MHBs_P-C Product feature CHAIN GQ924629_MHBs_P-C of FT:mat_peptide GQ924629_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M51). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPAQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924633_MHBs_P-C Product feature CHAIN GQ924633_MHBs_P-C of FT:mat_peptide GQ924633_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M56). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924636_MHBs_P-C Product feature CHAIN GQ924636_MHBs_P-C of FT:mat_peptide GQ924636_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M68). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924642_MHBs_P-C Product feature CHAIN GQ924642_MHBs_P-C of FT:mat_peptide GQ924642_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M77). Complete genome. [Hepadnaviridae] (length=281 residues).
VKWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTASGLLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASARFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924643_MHBs_P-C Product feature CHAIN GQ924643_MHBs_P-C of FT:mat_peptide GQ924643_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M78). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSHTFHQAVLNPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924649_MHBs_P-C Product feature CHAIN GQ924649_MHBs_P-C of FT:mat_peptide GQ924649_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M86). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924650_MHBs_P-C Product feature CHAIN GQ924650_MHBs_P-C of FT:mat_peptide GQ924650_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M87). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924655_MHBs_P-C Product feature CHAIN GQ924655_MHBs_P-C of FT:mat_peptide GQ924655_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M92). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU357845_MHBs_P-C Product feature CHAIN GU357845_MHBs_P-C of FT:mat_peptide GU357845_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y1021). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTIFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGASMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU434374_MHBs_P-C Product feature CHAIN GU434374_MHBs_P-C of FT:mat_peptide GU434374_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 214-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU563561_MHBs_P-C Product feature CHAIN GU563561_MHBs_P-C of FT:mat_peptide GU563561_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BV-153). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU721029_MHBs_P-C Product feature CHAIN GU721029_MHBs_P-C of FT:mat_peptide GU721029_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CMCL107). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011465_MHBs_P-C Product feature CHAIN HM011465_MHBs_P-C of FT:mat_peptide HM011465_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011468_MHBs_P-C Product feature CHAIN HM011468_MHBs_P-C of FT:mat_peptide HM011468_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LXIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPXCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPNLYNILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011472_MHBs_P-C Product feature CHAIN HM011472_MHBs_P-C of FT:mat_peptide HM011472_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011479_MHBs_P-C Product feature CHAIN HM011479_MHBs_P-C of FT:mat_peptide HM011479_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LIIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLX
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLXNILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011481_MHBs_P-C Product feature CHAIN HM011481_MHBs_P-C of FT:mat_peptide HM011481_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=280 residues).
QWNSTTFHQALLDPRVRXLYLPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRIL
TIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPV
CPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGL
SPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011486_MHBs_P-C Product feature CHAIN HM011486_MHBs_P-C of FT:mat_peptide HM011486_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
VXWNSSTFHQALLDPXVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPKMEXTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGXAPTCPGQNLQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNXLNPFXPLLPIFFCLWVYI
>gnl|hbvpro|HM011488_MHBs_P-C Product feature CHAIN HM011488_MHBs_P-C of FT:mat_peptide HM011488_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGXXPKCXGQNSQSPTSXHSXTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYXGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAXFLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMMWYWGXSLXNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011489_MHBs_P-C Product feature CHAIN HM011489_MHBs_P-C of FT:mat_peptide HM011489_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011491_MHBs_P-C Product feature CHAIN HM011491_MHBs_P-C of FT:mat_peptide HM011491_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSXAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011493_MHBs_P-C Product feature CHAIN HM011493_MHBs_P-C of FT:mat_peptide HM011493_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011495_MHBs_P-C Product feature CHAIN HM011495_MHBs_P-C of FT:mat_peptide HM011495_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSILSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLTXI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPXCPGYRXMCLRRFIXFLFILLLCLIFLLVLLDYHGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWXSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILNPFLPLLXIFFCLWVYI
>gnl|hbvpro|HM011497_MHBs_P-C Product feature CHAIN HM011497_MHBs_P-C of FT:mat_peptide HM011497_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM011500_MHBs_P-C Product feature CHAIN HM011500_MHBs_P-C of FT:mat_peptide HM011500_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750131_MHBs_P-C Product feature CHAIN HM750131_MHBs_P-C of FT:mat_peptide HM750131_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-57). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWFSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750132_MHBs_P-C Product feature CHAIN HM750132_MHBs_P-C of FT:mat_peptide HM750132_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-165). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750134_MHBs_P-C Product feature CHAIN HM750134_MHBs_P-C of FT:mat_peptide HM750134_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750135_MHBs_P-C Product feature CHAIN HM750135_MHBs_P-C of FT:mat_peptide HM750135_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750136_MHBs_P-C Product feature CHAIN HM750136_MHBs_P-C of FT:mat_peptide HM750136_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSDC-53). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750137_MHBs_P-C Product feature CHAIN HM750137_MHBs_P-C of FT:mat_peptide HM750137_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHN-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASPISSILSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTLPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750138_MHBs_P-C Product feature CHAIN HM750138_MHBs_P-C of FT:mat_peptide HM750138_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet-100). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750139_MHBs_P-C Product feature CHAIN HM750139_MHBs_P-C of FT:mat_peptide HM750139_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750140_MHBs_P-C Product feature CHAIN HM750140_MHBs_P-C of FT:mat_peptide HM750140_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GSD-56). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750141_MHBs_P-C Product feature CHAIN HM750141_MHBs_P-C of FT:mat_peptide HM750141_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QHX-115). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVRWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ622095_MHBs_P-C Product feature CHAIN HQ622095_MHBs_P-C of FT:mat_peptide HQ622095_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700456_MHBs_P-C Product feature CHAIN HQ700456_MHBs_P-C of FT:mat_peptide HQ700456_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_HA121_1984). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNATTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTXSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLLFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700457_MHBs_P-C Product feature CHAIN HQ700457_MHBs_P-C of FT:mat_peptide HQ700457_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_HA71_1997). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQAXLDPRXRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700475_MHBs_P-C Product feature CHAIN HQ700475_MHBs_P-C of FT:mat_peptide HQ700475_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_PA58_1984). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNATTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLLFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700476_MHBs_P-C Product feature CHAIN HQ700476_MHBs_P-C of FT:mat_peptide HQ700476_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_PA58_1999). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=281 residues).
MQWNATTFHQALLDPRVXGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILXPFIPLXPIFFCLWVYI
>gnl|hbvpro|HQ700490_MHBs_P-C Product feature CHAIN HQ700490_MHBs_P-C of FT:mat_peptide HQ700490_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NZL_WH23_1993). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTKI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700495_MHBs_P-C Product feature CHAIN HQ700495_MHBs_P-C of FT:mat_peptide HQ700495_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155PF_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700496_MHBs_P-C Product feature CHAIN HQ700496_MHBs_P-C of FT:mat_peptide HQ700496_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_F155C_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQXPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSEGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700502_MHBs_P-C Product feature CHAIN HQ700502_MHBs_P-C of FT:mat_peptide HQ700502_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Is_1991). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700504_MHBs_P-C Product feature CHAIN HQ700504_MHBs_P-C of FT:mat_peptide HQ700504_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_Ve_1992). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWXSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700506_MHBs_P-C Product feature CHAIN HQ700506_MHBs_P-C of FT:mat_peptide HQ700506_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_NC_TA32_2003). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLNLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700516_MHBs_P-C Product feature CHAIN HQ700516_MHBs_P-C of FT:mat_peptide HQ700516_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_D029_2005). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNLVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPALGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700517_MHBs_P-C Product feature CHAIN HQ700517_MHBs_P-C of FT:mat_peptide HQ700517_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_D058A_2005). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICXGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLNLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700522_MHBs_P-C Product feature CHAIN HQ700522_MHBs_P-C of FT:mat_peptide HQ700522_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_H086A_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPALNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700529_MHBs_P-C Product feature CHAIN HQ700529_MHBs_P-C of FT:mat_peptide HQ700529_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_W083A_2004). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGXSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700543_MHBs_P-C Product feature CHAIN HQ700543_MHBs_P-C of FT:mat_peptide HQ700543_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_PNG_P124A_2005). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPALNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700544_MHBs_P-C Product feature CHAIN HQ700544_MHBs_P-C of FT:mat_peptide HQ700544_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_T003_2A). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700545_MHBs_P-C Product feature CHAIN HQ700545_MHBs_P-C of FT:mat_peptide HQ700545_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_T015A_). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700555_MHBs_P-C Product feature CHAIN HQ700555_MHBs_P-C of FT:mat_peptide HQ700555_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD4171_2001). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGXSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSXWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700556_MHBs_P-C Product feature CHAIN HQ700556_MHBs_P-C of FT:mat_peptide HQ700556_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BA4986_2002). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700558_MHBs_P-C Product feature CHAIN HQ700558_MHBs_P-C of FT:mat_peptide HQ700558_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5375_2001). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700559_MHBs_P-C Product feature CHAIN HQ700559_MHBs_P-C of FT:mat_peptide HQ700559_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BD5561_2001). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSXLSLLAPFVQWFXG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700561_MHBs_P-C Product feature CHAIN HQ700561_MHBs_P-C of FT:mat_peptide HQ700561_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BF7376_2002). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700562_MHBs_P-C Product feature CHAIN HQ700562_MHBs_P-C of FT:mat_peptide HQ700562_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tomga_BH5413_2002). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPXGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIXLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCXTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700563_MHBs_P-C Product feature CHAIN HQ700563_MHBs_P-C of FT:mat_peptide HQ700563_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BL9389_2002). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLFPIFFCLWVYI
>gnl|hbvpro|HQ700564_MHBs_P-C Product feature CHAIN HQ700564_MHBs_P-C of FT:mat_peptide HQ700564_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BQ3589_2001). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700565_MHBs_P-C Product feature CHAIN HQ700565_MHBs_P-C of FT:mat_peptide HQ700565_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_BR6895_2001). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700566_MHBs_P-C Product feature CHAIN HQ700566_MHBs_P-C of FT:mat_peptide HQ700566_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_JN1142_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRXLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQSMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700567_MHBs_P-C Product feature CHAIN HQ700567_MHBs_P-C of FT:mat_peptide HQ700567_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To268_2006). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVMGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPALNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700569_MHBs_P-C Product feature CHAIN HQ700569_MHBs_P-C of FT:mat_peptide HQ700569_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To347_2006). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQETSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWTSVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700570_MHBs_P-C Product feature CHAIN HQ700570_MHBs_P-C of FT:mat_peptide HQ700570_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To356_2006). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVHPVPTTASPISSIFSRTGDPAPNMENTASGHLGPLLGLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700571_MHBs_P-C Product feature CHAIN HQ700571_MHBs_P-C of FT:mat_peptide HQ700571_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To391_2006). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCETCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700572_MHBs_P-C Product feature CHAIN HQ700572_MHBs_P-C of FT:mat_peptide HQ700572_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To422_2007). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLXFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICXGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700573_MHBs_P-C Product feature CHAIN HQ700573_MHBs_P-C of FT:mat_peptide HQ700573_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To426_2007). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700574_MHBs_P-C Product feature CHAIN HQ700574_MHBs_P-C of FT:mat_peptide HQ700574_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To400_2006). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCLPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700575_MHBs_P-C Product feature CHAIN HQ700575_MHBs_P-C of FT:mat_peptide HQ700575_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To244_2006). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFXQALLDXRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLSFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700576_MHBs_P-C Product feature CHAIN HQ700576_MHBs_P-C of FT:mat_peptide HQ700576_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To250_2006). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPXVXGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPALNMENTTSGFXGPLLVXQAVFFLLTRI
LTIPQSLDSWWTSLSFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCXIPAQGTSMFPSCCCXKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700577_MHBs_P-C Product feature CHAIN HQ700577_MHBs_P-C of FT:mat_peptide HQ700577_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To293_2006). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LIIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQETSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HQ700578_MHBs_P-C Product feature CHAIN HQ700578_MHBs_P-C of FT:mat_peptide HQ700578_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C_Tonga_To16_2004). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGYLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSRNFLGETPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYRGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF436920_MHBs_P-C Product feature CHAIN JF436920_MHBs_P-C of FT:mat_peptide JF436920_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SZ6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLVFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|JF828913_MHBs_P-C Product feature CHAIN JF828913_MHBs_P-C of FT:mat_peptide JF828913_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828915_MHBs_P-C Product feature CHAIN JF828915_MHBs_P-C of FT:mat_peptide JF828915_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828916_MHBs_P-C Product feature CHAIN JF828916_MHBs_P-C of FT:mat_peptide JF828916_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARLLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828917_MHBs_P-C Product feature CHAIN JF828917_MHBs_P-C of FT:mat_peptide JF828917_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828918_MHBs_P-C Product feature CHAIN JF828918_MHBs_P-C of FT:mat_peptide JF828918_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828919_MHBs_P-C Product feature CHAIN JF828919_MHBs_P-C of FT:mat_peptide JF828919_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARLLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828920_MHBs_P-C Product feature CHAIN JF828920_MHBs_P-C of FT:mat_peptide JF828920_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES70-14). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828921_MHBs_P-C Product feature CHAIN JF828921_MHBs_P-C of FT:mat_peptide JF828921_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|JF828922_MHBs_P-C Product feature CHAIN JF828922_MHBs_P-C of FT:mat_peptide JF828922_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLRDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828923_MHBs_P-C Product feature CHAIN JF828923_MHBs_P-C of FT:mat_peptide JF828923_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828924_MHBs_P-C Product feature CHAIN JF828924_MHBs_P-C of FT:mat_peptide JF828924_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828925_MHBs_P-C Product feature CHAIN JF828925_MHBs_P-C of FT:mat_peptide JF828925_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828926_MHBs_P-C Product feature CHAIN JF828926_MHBs_P-C of FT:mat_peptide JF828926_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828928_MHBs_P-C Product feature CHAIN JF828928_MHBs_P-C of FT:mat_peptide JF828928_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFNLLLCLIFLLVLRDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828929_MHBs_P-C Product feature CHAIN JF828929_MHBs_P-C of FT:mat_peptide JF828929_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTRTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828930_MHBs_P-C Product feature CHAIN JF828930_MHBs_P-C of FT:mat_peptide JF828930_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES71-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSFLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF828937_MHBs_P-C Product feature CHAIN JF828937_MHBs_P-C of FT:mat_peptide JF828937_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ES72-12). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVMWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF899336_MHBs_P-C Product feature CHAIN JF899336_MHBs_P-C of FT:mat_peptide JF899336_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10B3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGVPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN315779_MHBs_P-C Product feature CHAIN JN315779_MHBs_P-C of FT:mat_peptide JN315779_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN370955_MHBs_P-C Product feature CHAIN JN370955_MHBs_P-C of FT:mat_peptide JN370955_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NYX8). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQVLLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPRSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN400087_MHBs_P-C Product feature CHAIN JN400087_MHBs_P-C of FT:mat_peptide JN400087_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-75-Mother). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN400088_MHBs_P-C Product feature CHAIN JN400088_MHBs_P-C of FT:mat_peptide JN400088_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Baby). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN400089_MHBs_P-C Product feature CHAIN JN400089_MHBs_P-C of FT:mat_peptide JN400089_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-77-Mother). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604118_MHBs_P-C Product feature CHAIN JN604118_MHBs_P-C of FT:mat_peptide JN604118_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 476-5532-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604121_MHBs_P-C Product feature CHAIN JN604121_MHBs_P-C of FT:mat_peptide JN604121_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 476-8046-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604129_MHBs_P-C Product feature CHAIN JN604129_MHBs_P-C of FT:mat_peptide JN604129_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-4856-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTXI
LTIPQSLDSWWTSLNFRGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFXLLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604131_MHBs_P-C Product feature CHAIN JN604131_MHBs_P-C of FT:mat_peptide JN604131_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-9212-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604133_MHBs_P-C Product feature CHAIN JN604133_MHBs_P-C of FT:mat_peptide JN604133_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-1870-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEAPMCPGQNSQSQTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604135_MHBs_P-C Product feature CHAIN JN604135_MHBs_P-C of FT:mat_peptide JN604135_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-3655-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNYRTFHQALLDPRVRDLCFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQEGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDXNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILNPFLPLLLIFFCLWVYI
>gnl|hbvpro|JN604140_MHBs_P-C Product feature CHAIN JN604140_MHBs_P-C of FT:mat_peptide JN604140_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-8902-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604144_MHBs_P-C Product feature CHAIN JN604144_MHBs_P-C of FT:mat_peptide JN604144_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-2049-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604147_MHBs_P-C Product feature CHAIN JN604147_MHBs_P-C of FT:mat_peptide JN604147_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-4347-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604148_MHBs_P-C Product feature CHAIN JN604148_MHBs_P-C of FT:mat_peptide JN604148_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-5115-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604151_MHBs_P-C Product feature CHAIN JN604151_MHBs_P-C of FT:mat_peptide JN604151_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-6033-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSKGPCKXCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604153_MHBs_P-C Product feature CHAIN JN604153_MHBs_P-C of FT:mat_peptide JN604153_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-9129-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604182_MHBs_P-C Product feature CHAIN JN604182_MHBs_P-C of FT:mat_peptide JN604182_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-7600-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604215_MHBs_P-C Product feature CHAIN JN604215_MHBs_P-C of FT:mat_peptide JN604215_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-0677-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604222_MHBs_P-C Product feature CHAIN JN604222_MHBs_P-C of FT:mat_peptide JN604222_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-4649-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN604226_MHBs_P-C Product feature CHAIN JN604226_MHBs_P-C of FT:mat_peptide JN604226_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-7103-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604231_MHBs_P-C Product feature CHAIN JN604231_MHBs_P-C of FT:mat_peptide JN604231_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-0073-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYIPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQEGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604232_MHBs_P-C Product feature CHAIN JN604232_MHBs_P-C of FT:mat_peptide JN604232_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-0121-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGVXPTCPGQNSQSPTSNHSPTXCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604243_MHBs_P-C Product feature CHAIN JN604243_MHBs_P-C of FT:mat_peptide JN604243_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 478-9952-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
AQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604246_MHBs_P-C Product feature CHAIN JN604246_MHBs_P-C of FT:mat_peptide JN604246_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-0615-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604254_MHBs_P-C Product feature CHAIN JN604254_MHBs_P-C of FT:mat_peptide JN604254_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-6201-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604256_MHBs_P-C Product feature CHAIN JN604256_MHBs_P-C of FT:mat_peptide JN604256_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 479-7242-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604258_MHBs_P-C Product feature CHAIN JN604258_MHBs_P-C of FT:mat_peptide JN604258_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 480-1400-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLXILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGXCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604281_MHBs_P-C Product feature CHAIN JN604281_MHBs_P-C of FT:mat_peptide JN604281_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-6134-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604286_MHBs_P-C Product feature CHAIN JN604286_MHBs_P-C of FT:mat_peptide JN604286_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 477-9392-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827414_MHBs_P-C Product feature CHAIN JN827414_MHBs_P-C of FT:mat_peptide JN827414_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0015). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|JN827415_MHBs_P-C Product feature CHAIN JN827415_MHBs_P-C of FT:mat_peptide JN827415_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0032). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827416_MHBs_P-C Product feature CHAIN JN827416_MHBs_P-C of FT:mat_peptide JN827416_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0294). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827417_MHBs_P-C Product feature CHAIN JN827417_MHBs_P-C of FT:mat_peptide JN827417_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0300). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827418_MHBs_P-C Product feature CHAIN JN827418_MHBs_P-C of FT:mat_peptide JN827418_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 0904). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSNTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSKGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827420_MHBs_P-C Product feature CHAIN JN827420_MHBs_P-C of FT:mat_peptide JN827420_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4681). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827421_MHBs_P-C Product feature CHAIN JN827421_MHBs_P-C of FT:mat_peptide JN827421_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5205). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827422_MHBs_P-C Product feature CHAIN JN827422_MHBs_P-C of FT:mat_peptide JN827422_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5494). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827423_MHBs_P-C Product feature CHAIN JN827423_MHBs_P-C of FT:mat_peptide JN827423_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6359). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSIFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDSNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN827424_MHBs_P-C Product feature CHAIN JN827424_MHBs_P-C of FT:mat_peptide JN827424_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2566). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTSSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFLLWVYI
>gnl|hbvpro|JN827425_MHBs_P-C Product feature CHAIN JN827425_MHBs_P-C of FT:mat_peptide JN827425_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3765). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTSSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFLLWVYI
>gnl|hbvpro|JQ027317_MHBs_P-C Product feature CHAIN JQ027317_MHBs_P-C of FT:mat_peptide JQ027317_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSSTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLXXILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ027318_MHBs_P-C Product feature CHAIN JQ027318_MHBs_P-C of FT:mat_peptide JQ027318_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPRSLDSWWTSLSFLGGAPTCRGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNXFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ027320_MHBs_P-C Product feature CHAIN JQ027320_MHBs_P-C of FT:mat_peptide JQ027320_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=282 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFXPLLPIFFCLWVYIX
>gnl|hbvpro|JQ027321_MHBs_P-C Product feature CHAIN JQ027321_MHBs_P-C of FT:mat_peptide JQ027321_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFXRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGVPXCPGQNLQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ027322_MHBs_P-C Product feature CHAIN JQ027322_MHBs_P-C of FT:mat_peptide JQ027322_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQRLDSWWTSLNFLGXAPKCPGQNSQSPTSSHSXTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGXSMFPSCCCXKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWXWGPSLXNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ027323_MHBs_P-C Product feature CHAIN JQ027323_MHBs_P-C of FT:mat_peptide JQ027323_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSTFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JQ027324_MHBs_P-C Product feature CHAIN JQ027324_MHBs_P-C of FT:mat_peptide JQ027324_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPRSLDSWWTSLNFLGEXPKCPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIXFLFILLLCLTFLLVLLDFKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASXRFSWLSLLVPFVQWFVG
LSPTVWLXVIWMMWYWGXSLYNILXPFIPLLPIFXCLWXXI
>gnl|hbvpro|JQ027333_MHBs_P-C Product feature CHAIN JQ027333_MHBs_P-C of FT:mat_peptide JQ027333_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQALLBPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040131_MHBs_P-C Product feature CHAIN JQ040131_MHBs_P-C of FT:mat_peptide JQ040131_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 125). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040132_MHBs_P-C Product feature CHAIN JQ040132_MHBs_P-C of FT:mat_peptide JQ040132_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 144). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTXDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPXLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTGIPIPSSWAFARFLWEWASVRFSXXXXXXXXXQWFVG
LSPTVWLSVXLMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040133_MHBs_P-C Product feature CHAIN JQ040133_MHBs_P-C of FT:mat_peptide JQ040133_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 160). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFXAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040139_MHBs_P-C Product feature CHAIN JQ040139_MHBs_P-C of FT:mat_peptide JQ040139_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 256). Non-functional genomic sequence. [Hepadnaviridae] (length=279 residues).
MQWNSTTFHQALLDPRVRGLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSXLVPFVQWFVGLS
PTVWLSVIWMMWYWGXSLYNILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040141_MHBs_P-C Product feature CHAIN JQ040141_MHBs_P-C of FT:mat_peptide JQ040141_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 260). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040144_MHBs_P-C Product feature CHAIN JQ040144_MHBs_P-C of FT:mat_peptide JQ040144_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 272). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCXRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040145_MHBs_P-C Product feature CHAIN JQ040145_MHBs_P-C of FT:mat_peptide JQ040145_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 277). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGXAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040149_MHBs_P-C Product feature CHAIN JQ040149_MHBs_P-C of FT:mat_peptide JQ040149_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G76). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040151_MHBs_P-C Product feature CHAIN JQ040151_MHBs_P-C of FT:mat_peptide JQ040151_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G79). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ040152_MHBs_P-C Product feature CHAIN JQ040152_MHBs_P-C of FT:mat_peptide JQ040152_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G172). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040155_MHBs_P-C Product feature CHAIN JQ040155_MHBs_P-C of FT:mat_peptide JQ040155_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G182). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFXLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040161_MHBs_P-C Product feature CHAIN JQ040161_MHBs_P-C of FT:mat_peptide JQ040161_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G213). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040162_MHBs_P-C Product feature CHAIN JQ040162_MHBs_P-C of FT:mat_peptide JQ040162_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G216). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040163_MHBs_P-C Product feature CHAIN JQ040163_MHBs_P-C of FT:mat_peptide JQ040163_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G217). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040165_MHBs_P-C Product feature CHAIN JQ040165_MHBs_P-C of FT:mat_peptide JQ040165_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G222). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040166_MHBs_P-C Product feature CHAIN JQ040166_MHBs_P-C of FT:mat_peptide JQ040166_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G223). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040168_MHBs_P-C Product feature CHAIN JQ040168_MHBs_P-C of FT:mat_peptide JQ040168_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G233). Complete genome. [Hepadnaviridae] (length=281 residues).
TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ040172_MHBs_P-C Product feature CHAIN JQ040172_MHBs_P-C of FT:mat_peptide JQ040172_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G243). Complete genome. [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281112_MHBs_P-C Product feature CHAIN JQ281112_MHBs_P-C of FT:mat_peptide JQ281112_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08/IVVI/0053). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281113_MHBs_P-C Product feature CHAIN JQ281113_MHBs_P-C of FT:mat_peptide JQ281113_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08/IVVI/0880). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281114_MHBs_P-C Product feature CHAIN JQ281114_MHBs_P-C of FT:mat_peptide JQ281114_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08/IVVI/2007). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281116_MHBs_P-C Product feature CHAIN JQ281116_MHBs_P-C of FT:mat_peptide JQ281116_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08/IVVI/3792). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281117_MHBs_P-C Product feature CHAIN JQ281117_MHBs_P-C of FT:mat_peptide JQ281117_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08/IVVI/3825). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281118_MHBs_P-C Product feature CHAIN JQ281118_MHBs_P-C of FT:mat_peptide JQ281118_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08/IVVI/4428). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281119_MHBs_P-C Product feature CHAIN JQ281119_MHBs_P-C of FT:mat_peptide JQ281119_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08/IVVI/4591). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281120_MHBs_P-C Product feature CHAIN JQ281120_MHBs_P-C of FT:mat_peptide JQ281120_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09/IVVI/5493). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281121_MHBs_P-C Product feature CHAIN JQ281121_MHBs_P-C of FT:mat_peptide JQ281121_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09/IVVI/6492). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281122_MHBs_P-C Product feature CHAIN JQ281122_MHBs_P-C of FT:mat_peptide JQ281122_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09/IVVI/6618). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFTRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281123_MHBs_P-C Product feature CHAIN JQ281123_MHBs_P-C of FT:mat_peptide JQ281123_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09/IVVI/6657). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQXGFFXLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLXLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILTPFLPLLPIFFCLWVFI
>gnl|hbvpro|JQ281124_MHBs_P-C Product feature CHAIN JQ281124_MHBs_P-C of FT:mat_peptide JQ281124_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09/IVVI/7143). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281125_MHBs_P-C Product feature CHAIN JQ281125_MHBs_P-C of FT:mat_peptide JQ281125_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09/IVVI/7272). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGXSXFPSCCCXKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFLCLWVYI
>gnl|hbvpro|JQ281126_MHBs_P-C Product feature CHAIN JQ281126_MHBs_P-C of FT:mat_peptide JQ281126_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09/IVVI/7390). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDCKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ281127_MHBs_P-C Product feature CHAIN JQ281127_MHBs_P-C of FT:mat_peptide JQ281127_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09/IVVI/7396). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWAYI
>gnl|hbvpro|JQ281128_MHBs_P-C Product feature CHAIN JQ281128_MHBs_P-C of FT:mat_peptide JQ281128_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09/IVVI/8207). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPVPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341610_MHBs_P-C Product feature CHAIN JQ341610_MHBs_P-C of FT:mat_peptide JQ341610_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno01). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPXSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWXTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFXLWVYX
>gnl|hbvpro|JQ341611_MHBs_P-C Product feature CHAIN JQ341611_MHBs_P-C of FT:mat_peptide JQ341611_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno02). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341612_MHBs_P-C Product feature CHAIN JQ341612_MHBs_P-C of FT:mat_peptide JQ341612_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno03). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSNTFHQALLDPRMRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNIVKPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341613_MHBs_P-C Product feature CHAIN JQ341613_MHBs_P-C of FT:mat_peptide JQ341613_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno04). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341614_MHBs_P-C Product feature CHAIN JQ341614_MHBs_P-C of FT:mat_peptide JQ341614_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno05). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRXGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNXTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341615_MHBs_P-C Product feature CHAIN JQ341615_MHBs_P-C of FT:mat_peptide JQ341615_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno06). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSMGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341616_MHBs_P-C Product feature CHAIN JQ341616_MHBs_P-C of FT:mat_peptide JQ341616_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno07). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341617_MHBs_P-C Product feature CHAIN JQ341617_MHBs_P-C of FT:mat_peptide JQ341617_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno08). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341618_MHBs_P-C Product feature CHAIN JQ341618_MHBs_P-C of FT:mat_peptide JQ341618_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno09). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCXTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341620_MHBs_P-C Product feature CHAIN JQ341620_MHBs_P-C of FT:mat_peptide JQ341620_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQTLLDPRVKGLYFPAGGSSSXTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLXSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341621_MHBs_P-C Product feature CHAIN JQ341621_MHBs_P-C of FT:mat_peptide JQ341621_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSSTFHQALLDPXVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLXLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGXPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLXFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341622_MHBs_P-C Product feature CHAIN JQ341622_MHBs_P-C of FT:mat_peptide JQ341622_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRTGDPATNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341624_MHBs_P-C Product feature CHAIN JQ341624_MHBs_P-C of FT:mat_peptide JQ341624_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDYHGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSXFPSCCCTKPSDGNCTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341626_MHBs_P-C Product feature CHAIN JQ341626_MHBs_P-C of FT:mat_peptide JQ341626_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno17). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGXNLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341628_MHBs_P-C Product feature CHAIN JQ341628_MHBs_P-C of FT:mat_peptide JQ341628_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSXTFHQALTDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLXLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGXSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341630_MHBs_P-C Product feature CHAIN JQ341630_MHBs_P-C of FT:mat_peptide JQ341630_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPXMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTXSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341631_MHBs_P-C Product feature CHAIN JQ341631_MHBs_P-C of FT:mat_peptide JQ341631_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQXNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHXPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLXVLLDYXGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341632_MHBs_P-C Product feature CHAIN JQ341632_MHBs_P-C of FT:mat_peptide JQ341632_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno23). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMIPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVSI
>gnl|hbvpro|JQ341633_MHBs_P-C Product feature CHAIN JQ341633_MHBs_P-C of FT:mat_peptide JQ341633_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNXQSPTSNHSPTSCPPICPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTXTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341634_MHBs_P-C Product feature CHAIN JQ341634_MHBs_P-C of FT:mat_peptide JQ341634_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno25). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHXALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLXFXLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWAYI
>gnl|hbvpro|JQ341636_MHBs_P-C Product feature CHAIN JQ341636_MHBs_P-C of FT:mat_peptide JQ341636_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341637_MHBs_P-C Product feature CHAIN JQ341637_MHBs_P-C of FT:mat_peptide JQ341637_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno28). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341639_MHBs_P-C Product feature CHAIN JQ341639_MHBs_P-C of FT:mat_peptide JQ341639_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341641_MHBs_P-C Product feature CHAIN JQ341641_MHBs_P-C of FT:mat_peptide JQ341641_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTXASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341642_MHBs_P-C Product feature CHAIN JQ341642_MHBs_P-C of FT:mat_peptide JQ341642_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGILP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341643_MHBs_P-C Product feature CHAIN JQ341643_MHBs_P-C of FT:mat_peptide JQ341643_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTLGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLXGTSTXSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341644_MHBs_P-C Product feature CHAIN JQ341644_MHBs_P-C of FT:mat_peptide JQ341644_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno35). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341648_MHBs_P-C Product feature CHAIN JQ341648_MHBs_P-C of FT:mat_peptide JQ341648_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno39). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341649_MHBs_P-C Product feature CHAIN JQ341649_MHBs_P-C of FT:mat_peptide JQ341649_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno40). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNXXTFHQALLDXKVRGLYFPAGGSSSGTVNPVPTTXSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFXLTRI
LTIPQSLDSWWTSLNFLGGXPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPXVWLSVIWMMWYWGPSLYNILNPFLPLLPIFXCLWVYI
>gnl|hbvpro|JQ341650_MHBs_P-C Product feature CHAIN JQ341650_MHBs_P-C of FT:mat_peptide JQ341650_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGALXCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILXPFXPLLPIFFCLWVYX
>gnl|hbvpro|JQ341651_MHBs_P-C Product feature CHAIN JQ341651_MHBs_P-C of FT:mat_peptide JQ341651_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAXFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341652_MHBs_P-C Product feature CHAIN JQ341652_MHBs_P-C of FT:mat_peptide JQ341652_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHXXXXXXXXXXXXXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPKMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIICLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341653_MHBs_P-C Product feature CHAIN JQ341653_MHBs_P-C of FT:mat_peptide JQ341653_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno44). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
LQWXXGTFHQALLDPRGRGLYFPAGGSSSRTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNIXXPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341654_MHBs_P-C Product feature CHAIN JQ341654_MHBs_P-C of FT:mat_peptide JQ341654_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPVPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLFPIFFCLWVYI
>gnl|hbvpro|JQ341655_MHBs_P-C Product feature CHAIN JQ341655_MHBs_P-C of FT:mat_peptide JQ341655_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno46). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSSTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPXSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLXPIFFCLWVYI
>gnl|hbvpro|JQ341656_MHBs_P-C Product feature CHAIN JQ341656_MHBs_P-C of FT:mat_peptide JQ341656_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno47). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=280 residues).
QWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRIL
TIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPXCPGYRWMXLRRFIIFLFILLLCLIFLXVLLDYQGMLPV
CPLLPGTSTXSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGL
SPTVWLSVIWMMWYWGPSLYNILNPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ341657_MHBs_P-C Product feature CHAIN JQ341657_MHBs_P-C of FT:mat_peptide JQ341657_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQAXXXXXXXXXXXXAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341658_MHBs_P-C Product feature CHAIN JQ341658_MHBs_P-C of FT:mat_peptide JQ341658_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341659_MHBs_P-C Product feature CHAIN JQ341659_MHBs_P-C of FT:mat_peptide JQ341659_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341660_MHBs_P-C Product feature CHAIN JQ341660_MHBs_P-C of FT:mat_peptide JQ341660_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSSXFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPXCPGYRXMCLRRFIXFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSXGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLXNTLXPXLPLLXIFFCLWVYI
>gnl|hbvpro|JQ341661_MHBs_P-C Product feature CHAIN JQ341661_MHBs_P-C of FT:mat_peptide JQ341661_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLXFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341662_MHBs_P-C Product feature CHAIN JQ341662_MHBs_P-C of FT:mat_peptide JQ341662_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno53). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341663_MHBs_P-C Product feature CHAIN JQ341663_MHBs_P-C of FT:mat_peptide JQ341663_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341664_MHBs_P-C Product feature CHAIN JQ341664_MHBs_P-C of FT:mat_peptide JQ341664_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSXFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILKPFIPLLPIFFCLWVYI
>gnl|hbvpro|JQ341665_MHBs_P-C Product feature CHAIN JQ341665_MHBs_P-C of FT:mat_peptide JQ341665_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno56). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLXDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341668_MHBs_P-C Product feature CHAIN JQ341668_MHBs_P-C of FT:mat_peptide JQ341668_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno59). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSSXFHQVLLDPRVRGLYFPAGGSSSGTVNPVPTTASPIXSIXSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341669_MHBs_P-C Product feature CHAIN JQ341669_MHBs_P-C of FT:mat_peptide JQ341669_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno60). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGXAPTCPGQNXQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341670_MHBs_P-C Product feature CHAIN JQ341670_MHBs_P-C of FT:mat_peptide JQ341670_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPIXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ341778_MHBs_P-C Product feature CHAIN JQ341778_MHBs_P-C of FT:mat_peptide JQ341778_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno47). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=280 residues).
QWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRIL
TIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPXCPGYRWMXLRRFIIFLFILLLCLIFLXVLLDYQGMLPV
CPLLPGTSTXSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGL
SPTVWLSVIWMMWYWGPSLYNILNPFXPLLPIFFCLWVYI
>gnl|hbvpro|JQ341790_MHBs_P-C Product feature CHAIN JQ341790_MHBs_P-C of FT:mat_peptide JQ341790_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Cgeno59). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSSXFHQVLLDPRVRGLYFPAGGSSSGTVNPVPTTASPIXSIXSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ412089_MHBs_P-C Product feature CHAIN JQ412089_MHBs_P-C of FT:mat_peptide JQ412089_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ429078_MHBs_P-C Product feature CHAIN JQ429078_MHBs_P-C of FT:mat_peptide JQ429078_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08.40.117). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMRYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ688403_MHBs_P-C Product feature CHAIN JQ688403_MHBs_P-C of FT:mat_peptide JQ688403_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ688404_MHBs_P-C Product feature CHAIN JQ688404_MHBs_P-C of FT:mat_peptide JQ688404_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBVC2). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801470_MHBs_P-C Product feature CHAIN JQ801470_MHBs_P-C of FT:mat_peptide JQ801470_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801472_MHBs_P-C Product feature CHAIN JQ801472_MHBs_P-C of FT:mat_peptide JQ801472_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFARTGDPALNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFNILNPFLPLLPIFCCLWAYI
>gnl|hbvpro|JQ801473_MHBs_P-C Product feature CHAIN JQ801473_MHBs_P-C of FT:mat_peptide JQ801473_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLFNILNPFLPLLPIFCCLWAYI
>gnl|hbvpro|JQ801475_MHBs_P-C Product feature CHAIN JQ801475_MHBs_P-C of FT:mat_peptide JQ801475_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801481_MHBs_P-C Product feature CHAIN JQ801481_MHBs_P-C of FT:mat_peptide JQ801481_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPKVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801482_MHBs_P-C Product feature CHAIN JQ801482_MHBs_P-C of FT:mat_peptide JQ801482_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801486_MHBs_P-C Product feature CHAIN JQ801486_MHBs_P-C of FT:mat_peptide JQ801486_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801488_MHBs_P-C Product feature CHAIN JQ801488_MHBs_P-C of FT:mat_peptide JQ801488_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSRTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801490_MHBs_P-C Product feature CHAIN JQ801490_MHBs_P-C of FT:mat_peptide JQ801490_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCRTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801491_MHBs_P-C Product feature CHAIN JQ801491_MHBs_P-C of FT:mat_peptide JQ801491_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS38). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLDFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLPVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLTFWWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPYCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801493_MHBs_P-C Product feature CHAIN JQ801493_MHBs_P-C of FT:mat_peptide JQ801493_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AIDS41). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFAQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFFPLLPIFFCLWVYI
>gnl|hbvpro|JQ801495_MHBs_P-C Product feature CHAIN JQ801495_MHBs_P-C of FT:mat_peptide JQ801495_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL2). Complete genome. [Hepadnaviridae] (length=281 residues).
WKWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801496_MHBs_P-C Product feature CHAIN JQ801496_MHBs_P-C of FT:mat_peptide JQ801496_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801497_MHBs_P-C Product feature CHAIN JQ801497_MHBs_P-C of FT:mat_peptide JQ801497_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFCCLWVYI
>gnl|hbvpro|JQ801498_MHBs_P-C Product feature CHAIN JQ801498_MHBs_P-C of FT:mat_peptide JQ801498_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL5). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801500_MHBs_P-C Product feature CHAIN JQ801500_MHBs_P-C of FT:mat_peptide JQ801500_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801501_MHBs_P-C Product feature CHAIN JQ801501_MHBs_P-C of FT:mat_peptide JQ801501_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801502_MHBs_P-C Product feature CHAIN JQ801502_MHBs_P-C of FT:mat_peptide JQ801502_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801503_MHBs_P-C Product feature CHAIN JQ801503_MHBs_P-C of FT:mat_peptide JQ801503_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801504_MHBs_P-C Product feature CHAIN JQ801504_MHBs_P-C of FT:mat_peptide JQ801504_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSTGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801505_MHBs_P-C Product feature CHAIN JQ801505_MHBs_P-C of FT:mat_peptide JQ801505_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801509_MHBs_P-C Product feature CHAIN JQ801509_MHBs_P-C of FT:mat_peptide JQ801509_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL17). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801511_MHBs_P-C Product feature CHAIN JQ801511_MHBs_P-C of FT:mat_peptide JQ801511_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801513_MHBs_P-C Product feature CHAIN JQ801513_MHBs_P-C of FT:mat_peptide JQ801513_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL21). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801515_MHBs_P-C Product feature CHAIN JQ801515_MHBs_P-C of FT:mat_peptide JQ801515_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL23). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVQTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801518_MHBs_P-C Product feature CHAIN JQ801518_MHBs_P-C of FT:mat_peptide JQ801518_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL26). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801519_MHBs_P-C Product feature CHAIN JQ801519_MHBs_P-C of FT:mat_peptide JQ801519_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL27). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801520_MHBs_P-C Product feature CHAIN JQ801520_MHBs_P-C of FT:mat_peptide JQ801520_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL28). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801521_MHBs_P-C Product feature CHAIN JQ801521_MHBs_P-C of FT:mat_peptide JQ801521_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL29). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801522_MHBs_P-C Product feature CHAIN JQ801522_MHBs_P-C of FT:mat_peptide JQ801522_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ801523_MHBs_P-C Product feature CHAIN JQ801523_MHBs_P-C of FT:mat_peptide JQ801523_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CONTROL31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX026877_MHBs_P-C Product feature CHAIN JX026877_MHBs_P-C of FT:mat_peptide JX026877_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-11). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPRLVLQAGFFSLTRI
LTIPQSLDSWLTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYTILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|JX026878_MHBs_P-C Product feature CHAIN JX026878_MHBs_P-C of FT:mat_peptide JX026878_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX026880_MHBs_P-C Product feature CHAIN JX026880_MHBs_P-C of FT:mat_peptide JX026880_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-23). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX026884_MHBs_P-C Product feature CHAIN JX026884_MHBs_P-C of FT:mat_peptide JX026884_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-60). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX026888_MHBs_P-C Product feature CHAIN JX026888_MHBs_P-C of FT:mat_peptide JX026888_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NJ-3). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX036326_MHBs_P-C Product feature CHAIN JX036326_MHBs_P-C of FT:mat_peptide JX036326_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-6). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCIKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX036327_MHBs_P-C Product feature CHAIN JX036327_MHBs_P-C of FT:mat_peptide JX036327_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y2-9). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLGSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125365_MHBs_P-C Product feature CHAIN JX125365_MHBs_P-C of FT:mat_peptide JX125365_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I-NUK14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125366_MHBs_P-C Product feature CHAIN JX125366_MHBs_P-C of FT:mat_peptide JX125366_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Y-KR217). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMKRFWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|JX125370_MHBs_P-C Product feature CHAIN JX125370_MHBs_P-C of FT:mat_peptide JX125370_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU540). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSISGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125371_MHBs_P-C Product feature CHAIN JX125371_MHBs_P-C of FT:mat_peptide JX125371_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU163). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125372_MHBs_P-C Product feature CHAIN JX125372_MHBs_P-C of FT:mat_peptide JX125372_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGEVPACPGRNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125373_MHBs_P-C Product feature CHAIN JX125373_MHBs_P-C of FT:mat_peptide JX125373_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU62). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125374_MHBs_P-C Product feature CHAIN JX125374_MHBs_P-C of FT:mat_peptide JX125374_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU70). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX125375_MHBs_P-C Product feature CHAIN JX125375_MHBs_P-C of FT:mat_peptide JX125375_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KR-DU73). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429903_MHBs_P-C Product feature CHAIN JX429903_MHBs_P-C of FT:mat_peptide JX429903_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-42). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429904_MHBs_P-C Product feature CHAIN JX429904_MHBs_P-C of FT:mat_peptide JX429904_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-46). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429905_MHBs_P-C Product feature CHAIN JX429905_MHBs_P-C of FT:mat_peptide JX429905_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-47). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429906_MHBs_P-C Product feature CHAIN JX429906_MHBs_P-C of FT:mat_peptide JX429906_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-48). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429907_MHBs_P-C Product feature CHAIN JX429907_MHBs_P-C of FT:mat_peptide JX429907_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-50). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429909_MHBs_P-C Product feature CHAIN JX429909_MHBs_P-C of FT:mat_peptide JX429909_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-59). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429912_MHBs_P-C Product feature CHAIN JX429912_MHBs_P-C of FT:mat_peptide JX429912_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-6). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429913_MHBs_P-C Product feature CHAIN JX429913_MHBs_P-C of FT:mat_peptide JX429913_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWRTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLLILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPFCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|JX429914_MHBs_P-C Product feature CHAIN JX429914_MHBs_P-C of FT:mat_peptide JX429914_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-13). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTGDPAQNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCPIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429915_MHBs_P-C Product feature CHAIN JX429915_MHBs_P-C of FT:mat_peptide JX429915_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|JX429916_MHBs_P-C Product feature CHAIN JX429916_MHBs_P-C of FT:mat_peptide JX429916_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-35). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWSSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429917_MHBs_P-C Product feature CHAIN JX429917_MHBs_P-C of FT:mat_peptide JX429917_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX429918_MHBs_P-C Product feature CHAIN JX429918_MHBs_P-C of FT:mat_peptide JX429918_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504534_MHBs_P-C Product feature CHAIN JX504534_MHBs_P-C of FT:mat_peptide JX504534_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-19). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPGVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLNLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504535_MHBs_P-C Product feature CHAIN JX504535_MHBs_P-C of FT:mat_peptide JX504535_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-31). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSQTSCPPICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504536_MHBs_P-C Product feature CHAIN JX504536_MHBs_P-C of FT:mat_peptide JX504536_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-44). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGQSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504537_MHBs_P-C Product feature CHAIN JX504537_MHBs_P-C of FT:mat_peptide JX504537_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-HZ-49). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPTQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504539_MHBs_P-C Product feature CHAIN JX504539_MHBs_P-C of FT:mat_peptide JX504539_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-1). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504541_MHBs_P-C Product feature CHAIN JX504541_MHBs_P-C of FT:mat_peptide JX504541_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-14). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPPSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504542_MHBs_P-C Product feature CHAIN JX504542_MHBs_P-C of FT:mat_peptide JX504542_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-NNJ-17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504544_MHBs_P-C Product feature CHAIN JX504544_MHBs_P-C of FT:mat_peptide JX504544_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-14). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504545_MHBs_P-C Product feature CHAIN JX504545_MHBs_P-C of FT:mat_peptide JX504545_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-37). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX504546_MHBs_P-C Product feature CHAIN JX504546_MHBs_P-C of FT:mat_peptide JX504546_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WY-SD-40). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX507211_MHBs_P-C Product feature CHAIN JX507211_MHBs_P-C of FT:mat_peptide JX507211_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFXRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX507212_MHBs_P-C Product feature CHAIN JX507212_MHBs_P-C of FT:mat_peptide JX507212_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSSTFHLALLDPRVRGLYFPAGGSSSGTXNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTXCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX507214_MHBs_P-C Product feature CHAIN JX507214_MHBs_P-C of FT:mat_peptide JX507214_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 99). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX560519_MHBs_P-C Product feature CHAIN JX560519_MHBs_P-C of FT:mat_peptide JX560519_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH76). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX560520_MHBs_P-C Product feature CHAIN JX560520_MHBs_P-C of FT:mat_peptide JX560520_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHH139). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWDWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661488_MHBs_P-C Product feature CHAIN JX661488_MHBs_P-C of FT:mat_peptide JX661488_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1212-C5). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661489_MHBs_P-C Product feature CHAIN JX661489_MHBs_P-C of FT:mat_peptide JX661489_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1218-C9). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCHIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661490_MHBs_P-C Product feature CHAIN JX661490_MHBs_P-C of FT:mat_peptide JX661490_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1217-C8). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661491_MHBs_P-C Product feature CHAIN JX661491_MHBs_P-C of FT:mat_peptide JX661491_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1222-C10). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTGDPAPNMESTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661492_MHBs_P-C Product feature CHAIN JX661492_MHBs_P-C of FT:mat_peptide JX661492_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1215-C7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661493_MHBs_P-C Product feature CHAIN JX661493_MHBs_P-C of FT:mat_peptide JX661493_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1226-C13). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661495_MHBs_P-C Product feature CHAIN JX661495_MHBs_P-C of FT:mat_peptide JX661495_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1223-C11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661496_MHBs_P-C Product feature CHAIN JX661496_MHBs_P-C of FT:mat_peptide JX661496_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1208-C4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX661497_MHBs_P-C Product feature CHAIN JX661497_MHBs_P-C of FT:mat_peptide JX661497_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SH1228-C14). Complete genome. [Hepadnaviridae] (length=281 residues).
AQWNSITFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGIPACPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX870000_MHBs_P-C Product feature CHAIN JX870000_MHBs_P-C of FT:mat_peptide JX870000_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 245). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC315399_MHBs_P-C Product feature CHAIN KC315399_MHBs_P-C of FT:mat_peptide KC315399_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M0507). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774179_MHBs_P-C Product feature CHAIN KC774179_MHBs_P-C of FT:mat_peptide KC774179_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SX11xa1580). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPTFHQAPLNPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774180_MHBs_P-C Product feature CHAIN KC774180_MHBs_P-C of FT:mat_peptide KC774180_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1002). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774181_MHBs_P-C Product feature CHAIN KC774181_MHBs_P-C of FT:mat_peptide KC774181_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1012). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774182_MHBs_P-C Product feature CHAIN KC774182_MHBs_P-C of FT:mat_peptide KC774182_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1013). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774184_MHBs_P-C Product feature CHAIN KC774184_MHBs_P-C of FT:mat_peptide KC774184_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1022). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774185_MHBs_P-C Product feature CHAIN KC774185_MHBs_P-C of FT:mat_peptide KC774185_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1023). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774187_MHBs_P-C Product feature CHAIN KC774187_MHBs_P-C of FT:mat_peptide KC774187_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1027). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774189_MHBs_P-C Product feature CHAIN KC774189_MHBs_P-C of FT:mat_peptide KC774189_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1030). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774190_MHBs_P-C Product feature CHAIN KC774190_MHBs_P-C of FT:mat_peptide KC774190_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1031). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774191_MHBs_P-C Product feature CHAIN KC774191_MHBs_P-C of FT:mat_peptide KC774191_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1032). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774192_MHBs_P-C Product feature CHAIN KC774192_MHBs_P-C of FT:mat_peptide KC774192_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1034). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774194_MHBs_P-C Product feature CHAIN KC774194_MHBs_P-C of FT:mat_peptide KC774194_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1036). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTIFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774195_MHBs_P-C Product feature CHAIN KC774195_MHBs_P-C of FT:mat_peptide KC774195_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz1046). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774196_MHBs_P-C Product feature CHAIN KC774196_MHBs_P-C of FT:mat_peptide KC774196_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2015). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASLTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774197_MHBs_P-C Product feature CHAIN KC774197_MHBs_P-C of FT:mat_peptide KC774197_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2035). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774199_MHBs_P-C Product feature CHAIN KC774199_MHBs_P-C of FT:mat_peptide KC774199_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2040). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774200_MHBs_P-C Product feature CHAIN KC774200_MHBs_P-C of FT:mat_peptide KC774200_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2044). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774202_MHBs_P-C Product feature CHAIN KC774202_MHBs_P-C of FT:mat_peptide KC774202_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2048). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774203_MHBs_P-C Product feature CHAIN KC774203_MHBs_P-C of FT:mat_peptide KC774203_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2051). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWIMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774204_MHBs_P-C Product feature CHAIN KC774204_MHBs_P-C of FT:mat_peptide KC774204_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2056). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNIWSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774205_MHBs_P-C Product feature CHAIN KC774205_MHBs_P-C of FT:mat_peptide KC774205_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2058). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNIWSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774206_MHBs_P-C Product feature CHAIN KC774206_MHBs_P-C of FT:mat_peptide KC774206_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2079). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774207_MHBs_P-C Product feature CHAIN KC774207_MHBs_P-C of FT:mat_peptide KC774207_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2084). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774208_MHBs_P-C Product feature CHAIN KC774208_MHBs_P-C of FT:mat_peptide KC774208_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2086). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774209_MHBs_P-C Product feature CHAIN KC774209_MHBs_P-C of FT:mat_peptide KC774209_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2087). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774210_MHBs_P-C Product feature CHAIN KC774210_MHBs_P-C of FT:mat_peptide KC774210_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2098). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774211_MHBs_P-C Product feature CHAIN KC774211_MHBs_P-C of FT:mat_peptide KC774211_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2114). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774213_MHBs_P-C Product feature CHAIN KC774213_MHBs_P-C of FT:mat_peptide KC774213_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2123). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAHGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774214_MHBs_P-C Product feature CHAIN KC774214_MHBs_P-C of FT:mat_peptide KC774214_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2124). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNRVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAHGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774215_MHBs_P-C Product feature CHAIN KC774215_MHBs_P-C of FT:mat_peptide KC774215_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2125). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774216_MHBs_P-C Product feature CHAIN KC774216_MHBs_P-C of FT:mat_peptide KC774216_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2126). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774217_MHBs_P-C Product feature CHAIN KC774217_MHBs_P-C of FT:mat_peptide KC774217_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2129). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774218_MHBs_P-C Product feature CHAIN KC774218_MHBs_P-C of FT:mat_peptide KC774218_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2134). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPASNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774219_MHBs_P-C Product feature CHAIN KC774219_MHBs_P-C of FT:mat_peptide KC774219_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2144). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774220_MHBs_P-C Product feature CHAIN KC774220_MHBs_P-C of FT:mat_peptide KC774220_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2152). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774221_MHBs_P-C Product feature CHAIN KC774221_MHBs_P-C of FT:mat_peptide KC774221_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2153). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774223_MHBs_P-C Product feature CHAIN KC774223_MHBs_P-C of FT:mat_peptide KC774223_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2183). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774224_MHBs_P-C Product feature CHAIN KC774224_MHBs_P-C of FT:mat_peptide KC774224_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2184). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774225_MHBs_P-C Product feature CHAIN KC774225_MHBs_P-C of FT:mat_peptide KC774225_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2188). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774226_MHBs_P-C Product feature CHAIN KC774226_MHBs_P-C of FT:mat_peptide KC774226_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate clz2194). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774227_MHBs_P-C Product feature CHAIN KC774227_MHBs_P-C of FT:mat_peptide KC774227_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1009). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAQNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774228_MHBs_P-C Product feature CHAIN KC774228_MHBs_P-C of FT:mat_peptide KC774228_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1023). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774229_MHBs_P-C Product feature CHAIN KC774229_MHBs_P-C of FT:mat_peptide KC774229_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1024). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774231_MHBs_P-C Product feature CHAIN KC774231_MHBs_P-C of FT:mat_peptide KC774231_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1028). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSITFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774232_MHBs_P-C Product feature CHAIN KC774232_MHBs_P-C of FT:mat_peptide KC774232_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1031). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774233_MHBs_P-C Product feature CHAIN KC774233_MHBs_P-C of FT:mat_peptide KC774233_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1035). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774235_MHBs_P-C Product feature CHAIN KC774235_MHBs_P-C of FT:mat_peptide KC774235_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1041). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774236_MHBs_P-C Product feature CHAIN KC774236_MHBs_P-C of FT:mat_peptide KC774236_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1042). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDLAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774237_MHBs_P-C Product feature CHAIN KC774237_MHBs_P-C of FT:mat_peptide KC774237_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1051). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774238_MHBs_P-C Product feature CHAIN KC774238_MHBs_P-C of FT:mat_peptide KC774238_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1052). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774239_MHBs_P-C Product feature CHAIN KC774239_MHBs_P-C of FT:mat_peptide KC774239_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1063). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774240_MHBs_P-C Product feature CHAIN KC774240_MHBs_P-C of FT:mat_peptide KC774240_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1066). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774241_MHBs_P-C Product feature CHAIN KC774241_MHBs_P-C of FT:mat_peptide KC774241_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1067). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774242_MHBs_P-C Product feature CHAIN KC774242_MHBs_P-C of FT:mat_peptide KC774242_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cur1070). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWIMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774243_MHBs_P-C Product feature CHAIN KC774243_MHBs_P-C of FT:mat_peptide KC774243_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1007). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774244_MHBs_P-C Product feature CHAIN KC774244_MHBs_P-C of FT:mat_peptide KC774244_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1012). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774245_MHBs_P-C Product feature CHAIN KC774245_MHBs_P-C of FT:mat_peptide KC774245_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1013). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774247_MHBs_P-C Product feature CHAIN KC774247_MHBs_P-C of FT:mat_peptide KC774247_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1021). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774248_MHBs_P-C Product feature CHAIN KC774248_MHBs_P-C of FT:mat_peptide KC774248_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1026). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774249_MHBs_P-C Product feature CHAIN KC774249_MHBs_P-C of FT:mat_peptide KC774249_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1027). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774250_MHBs_P-C Product feature CHAIN KC774250_MHBs_P-C of FT:mat_peptide KC774250_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1029). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774251_MHBs_P-C Product feature CHAIN KC774251_MHBs_P-C of FT:mat_peptide KC774251_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1030). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774252_MHBs_P-C Product feature CHAIN KC774252_MHBs_P-C of FT:mat_peptide KC774252_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1031). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGGPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774253_MHBs_P-C Product feature CHAIN KC774253_MHBs_P-C of FT:mat_peptide KC774253_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1039). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMETTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAKGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774254_MHBs_P-C Product feature CHAIN KC774254_MHBs_P-C of FT:mat_peptide KC774254_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1046). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774255_MHBs_P-C Product feature CHAIN KC774255_MHBs_P-C of FT:mat_peptide KC774255_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1050). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774256_MHBs_P-C Product feature CHAIN KC774256_MHBs_P-C of FT:mat_peptide KC774256_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1053). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774257_MHBs_P-C Product feature CHAIN KC774257_MHBs_P-C of FT:mat_peptide KC774257_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1056). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774259_MHBs_P-C Product feature CHAIN KC774259_MHBs_P-C of FT:mat_peptide KC774259_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1061). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774260_MHBs_P-C Product feature CHAIN KC774260_MHBs_P-C of FT:mat_peptide KC774260_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1065). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774261_MHBs_P-C Product feature CHAIN KC774261_MHBs_P-C of FT:mat_peptide KC774261_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1067). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774262_MHBs_P-C Product feature CHAIN KC774262_MHBs_P-C of FT:mat_peptide KC774262_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1068). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774264_MHBs_P-C Product feature CHAIN KC774264_MHBs_P-C of FT:mat_peptide KC774264_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1072). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774265_MHBs_P-C Product feature CHAIN KC774265_MHBs_P-C of FT:mat_peptide KC774265_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1074). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774266_MHBs_P-C Product feature CHAIN KC774266_MHBs_P-C of FT:mat_peptide KC774266_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1075). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774267_MHBs_P-C Product feature CHAIN KC774267_MHBs_P-C of FT:mat_peptide KC774267_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1084). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774268_MHBs_P-C Product feature CHAIN KC774268_MHBs_P-C of FT:mat_peptide KC774268_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1085). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774269_MHBs_P-C Product feature CHAIN KC774269_MHBs_P-C of FT:mat_peptide KC774269_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1086). Complete genome. [Hepadnaviridae] (length=281 residues).
MKWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIAANGTSMFPSCCCTKPSDRNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774270_MHBs_P-C Product feature CHAIN KC774270_MHBs_P-C of FT:mat_peptide KC774270_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1093). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPASNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774271_MHBs_P-C Product feature CHAIN KC774271_MHBs_P-C of FT:mat_peptide KC774271_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1094). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774272_MHBs_P-C Product feature CHAIN KC774272_MHBs_P-C of FT:mat_peptide KC774272_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1107). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774274_MHBs_P-C Product feature CHAIN KC774274_MHBs_P-C of FT:mat_peptide KC774274_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1124). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774275_MHBs_P-C Product feature CHAIN KC774275_MHBs_P-C of FT:mat_peptide KC774275_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1126). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774276_MHBs_P-C Product feature CHAIN KC774276_MHBs_P-C of FT:mat_peptide KC774276_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww1128). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774277_MHBs_P-C Product feature CHAIN KC774277_MHBs_P-C of FT:mat_peptide KC774277_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2151). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVLPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774278_MHBs_P-C Product feature CHAIN KC774278_MHBs_P-C of FT:mat_peptide KC774278_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2155). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774279_MHBs_P-C Product feature CHAIN KC774279_MHBs_P-C of FT:mat_peptide KC774279_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cww2157). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774280_MHBs_P-C Product feature CHAIN KC774280_MHBs_P-C of FT:mat_peptide KC774280_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1053). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774281_MHBs_P-C Product feature CHAIN KC774281_MHBs_P-C of FT:mat_peptide KC774281_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1058). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFRQALLDPRVRGLYFPAGGSSSGTVNPVPITASPISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWIMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774282_MHBs_P-C Product feature CHAIN KC774282_MHBs_P-C of FT:mat_peptide KC774282_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1060). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774283_MHBs_P-C Product feature CHAIN KC774283_MHBs_P-C of FT:mat_peptide KC774283_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1062). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774284_MHBs_P-C Product feature CHAIN KC774284_MHBs_P-C of FT:mat_peptide KC774284_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1065). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774285_MHBs_P-C Product feature CHAIN KC774285_MHBs_P-C of FT:mat_peptide KC774285_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1067). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774286_MHBs_P-C Product feature CHAIN KC774286_MHBs_P-C of FT:mat_peptide KC774286_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1076). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774287_MHBs_P-C Product feature CHAIN KC774287_MHBs_P-C of FT:mat_peptide KC774287_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1087). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774288_MHBs_P-C Product feature CHAIN KC774288_MHBs_P-C of FT:mat_peptide KC774288_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1175). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPTLPIFFCLWVYI
>gnl|hbvpro|KC774289_MHBs_P-C Product feature CHAIN KC774289_MHBs_P-C of FT:mat_peptide KC774289_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1180). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCHIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774290_MHBs_P-C Product feature CHAIN KC774290_MHBs_P-C of FT:mat_peptide KC774290_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1183). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLILLVPFVQWFVW
PSPTVWFSIIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774292_MHBs_P-C Product feature CHAIN KC774292_MHBs_P-C of FT:mat_peptide KC774292_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1196). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774293_MHBs_P-C Product feature CHAIN KC774293_MHBs_P-C of FT:mat_peptide KC774293_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1204). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774295_MHBs_P-C Product feature CHAIN KC774295_MHBs_P-C of FT:mat_peptide KC774295_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1207). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774296_MHBs_P-C Product feature CHAIN KC774296_MHBs_P-C of FT:mat_peptide KC774296_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1210). Complete genome. [Hepadnaviridae] (length=281 residues).
MRWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFSLTRI
LTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774297_MHBs_P-C Product feature CHAIN KC774297_MHBs_P-C of FT:mat_peptide KC774297_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1580). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSPTFHQAPLNPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774298_MHBs_P-C Product feature CHAIN KC774298_MHBs_P-C of FT:mat_peptide KC774298_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1586). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774299_MHBs_P-C Product feature CHAIN KC774299_MHBs_P-C of FT:mat_peptide KC774299_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1601). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774300_MHBs_P-C Product feature CHAIN KC774300_MHBs_P-C of FT:mat_peptide KC774300_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1602). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774301_MHBs_P-C Product feature CHAIN KC774301_MHBs_P-C of FT:mat_peptide KC774301_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1627). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774302_MHBs_P-C Product feature CHAIN KC774302_MHBs_P-C of FT:mat_peptide KC774302_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1650). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774303_MHBs_P-C Product feature CHAIN KC774303_MHBs_P-C of FT:mat_peptide KC774303_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1659). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774304_MHBs_P-C Product feature CHAIN KC774304_MHBs_P-C of FT:mat_peptide KC774304_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa1662). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774306_MHBs_P-C Product feature CHAIN KC774306_MHBs_P-C of FT:mat_peptide KC774306_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2006). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGGAPACPGQNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGSSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774308_MHBs_P-C Product feature CHAIN KC774308_MHBs_P-C of FT:mat_peptide KC774308_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2019). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774309_MHBs_P-C Product feature CHAIN KC774309_MHBs_P-C of FT:mat_peptide KC774309_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2020). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774310_MHBs_P-C Product feature CHAIN KC774310_MHBs_P-C of FT:mat_peptide KC774310_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2022). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774311_MHBs_P-C Product feature CHAIN KC774311_MHBs_P-C of FT:mat_peptide KC774311_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2026). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774312_MHBs_P-C Product feature CHAIN KC774312_MHBs_P-C of FT:mat_peptide KC774312_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2029). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774313_MHBs_P-C Product feature CHAIN KC774313_MHBs_P-C of FT:mat_peptide KC774313_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2032). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774314_MHBs_P-C Product feature CHAIN KC774314_MHBs_P-C of FT:mat_peptide KC774314_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2033). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774315_MHBs_P-C Product feature CHAIN KC774315_MHBs_P-C of FT:mat_peptide KC774315_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2039). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774316_MHBs_P-C Product feature CHAIN KC774316_MHBs_P-C of FT:mat_peptide KC774316_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2041). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774318_MHBs_P-C Product feature CHAIN KC774318_MHBs_P-C of FT:mat_peptide KC774318_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2043). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774319_MHBs_P-C Product feature CHAIN KC774319_MHBs_P-C of FT:mat_peptide KC774319_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2044). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774320_MHBs_P-C Product feature CHAIN KC774320_MHBs_P-C of FT:mat_peptide KC774320_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2051). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWIMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774321_MHBs_P-C Product feature CHAIN KC774321_MHBs_P-C of FT:mat_peptide KC774321_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2052). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|KC774325_MHBs_P-C Product feature CHAIN KC774325_MHBs_P-C of FT:mat_peptide KC774325_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2063). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSLFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|KC774326_MHBs_P-C Product feature CHAIN KC774326_MHBs_P-C of FT:mat_peptide KC774326_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2067). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774327_MHBs_P-C Product feature CHAIN KC774327_MHBs_P-C of FT:mat_peptide KC774327_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2069). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774329_MHBs_P-C Product feature CHAIN KC774329_MHBs_P-C of FT:mat_peptide KC774329_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2074). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774330_MHBs_P-C Product feature CHAIN KC774330_MHBs_P-C of FT:mat_peptide KC774330_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2075). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774331_MHBs_P-C Product feature CHAIN KC774331_MHBs_P-C of FT:mat_peptide KC774331_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxa2077). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774333_MHBs_P-C Product feature CHAIN KC774333_MHBs_P-C of FT:mat_peptide KC774333_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1006). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774334_MHBs_P-C Product feature CHAIN KC774334_MHBs_P-C of FT:mat_peptide KC774334_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1007). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774335_MHBs_P-C Product feature CHAIN KC774335_MHBs_P-C of FT:mat_peptide KC774335_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1013). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTTTTSTGTCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|KC774336_MHBs_P-C Product feature CHAIN KC774336_MHBs_P-C of FT:mat_peptide KC774336_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1015). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASLTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774337_MHBs_P-C Product feature CHAIN KC774337_MHBs_P-C of FT:mat_peptide KC774337_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1019). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774338_MHBs_P-C Product feature CHAIN KC774338_MHBs_P-C of FT:mat_peptide KC774338_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1027). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774339_MHBs_P-C Product feature CHAIN KC774339_MHBs_P-C of FT:mat_peptide KC774339_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1029). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774340_MHBs_P-C Product feature CHAIN KC774340_MHBs_P-C of FT:mat_peptide KC774340_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1034). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSILSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774342_MHBs_P-C Product feature CHAIN KC774342_MHBs_P-C of FT:mat_peptide KC774342_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1044). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774343_MHBs_P-C Product feature CHAIN KC774343_MHBs_P-C of FT:mat_peptide KC774343_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1046). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774345_MHBs_P-C Product feature CHAIN KC774345_MHBs_P-C of FT:mat_peptide KC774345_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1076). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774346_MHBs_P-C Product feature CHAIN KC774346_MHBs_P-C of FT:mat_peptide KC774346_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1078). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774347_MHBs_P-C Product feature CHAIN KC774347_MHBs_P-C of FT:mat_peptide KC774347_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1092). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774348_MHBs_P-C Product feature CHAIN KC774348_MHBs_P-C of FT:mat_peptide KC774348_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cxn1093). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774351_MHBs_P-C Product feature CHAIN KC774351_MHBs_P-C of FT:mat_peptide KC774351_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1031). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774352_MHBs_P-C Product feature CHAIN KC774352_MHBs_P-C of FT:mat_peptide KC774352_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1042). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774353_MHBs_P-C Product feature CHAIN KC774353_MHBs_P-C of FT:mat_peptide KC774353_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1043). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLALQAGFFSLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQSSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774354_MHBs_P-C Product feature CHAIN KC774354_MHBs_P-C of FT:mat_peptide KC774354_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1048). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774355_MHBs_P-C Product feature CHAIN KC774355_MHBs_P-C of FT:mat_peptide KC774355_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1070). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774356_MHBs_P-C Product feature CHAIN KC774356_MHBs_P-C of FT:mat_peptide KC774356_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1080). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTGDPAPSMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSMYNIMSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774357_MHBs_P-C Product feature CHAIN KC774357_MHBs_P-C of FT:mat_peptide KC774357_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1081). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774358_MHBs_P-C Product feature CHAIN KC774358_MHBs_P-C of FT:mat_peptide KC774358_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1098). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYLPAGGSGSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774359_MHBs_P-C Product feature CHAIN KC774359_MHBs_P-C of FT:mat_peptide KC774359_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1099). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWIMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774360_MHBs_P-C Product feature CHAIN KC774360_MHBs_P-C of FT:mat_peptide KC774360_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1105). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC774361_MHBs_P-C Product feature CHAIN KC774361_MHBs_P-C of FT:mat_peptide KC774361_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate cyc1106). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792655_MHBs_P-C Product feature CHAIN KC792655_MHBs_P-C of FT:mat_peptide KC792655_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0008). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792656_MHBs_P-C Product feature CHAIN KC792656_MHBs_P-C of FT:mat_peptide KC792656_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0009). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=280 residues).
TWTYTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRIL
TIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDYQGMLPV
CPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGL
SPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792658_MHBs_P-C Product feature CHAIN KC792658_MHBs_P-C of FT:mat_peptide KC792658_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0011). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792669_MHBs_P-C Product feature CHAIN KC792669_MHBs_P-C of FT:mat_peptide KC792669_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0022). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAXFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC792672_MHBs_P-C Product feature CHAIN KC792672_MHBs_P-C of FT:mat_peptide KC792672_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0025). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPATNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792679_MHBs_P-C Product feature CHAIN KC792679_MHBs_P-C of FT:mat_peptide KC792679_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0032). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSSFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792680_MHBs_P-C Product feature CHAIN KC792680_MHBs_P-C of FT:mat_peptide KC792680_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0033). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792682_MHBs_P-C Product feature CHAIN KC792682_MHBs_P-C of FT:mat_peptide KC792682_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0035). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792690_MHBs_P-C Product feature CHAIN KC792690_MHBs_P-C of FT:mat_peptide KC792690_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0043). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792691_MHBs_P-C Product feature CHAIN KC792691_MHBs_P-C of FT:mat_peptide KC792691_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0044). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSXFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792695_MHBs_P-C Product feature CHAIN KC792695_MHBs_P-C of FT:mat_peptide KC792695_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0048). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792700_MHBs_P-C Product feature CHAIN KC792700_MHBs_P-C of FT:mat_peptide KC792700_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0053). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPTCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTSTTTTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPXLXLLPIFFCLWVYI
>gnl|hbvpro|KC792704_MHBs_P-C Product feature CHAIN KC792704_MHBs_P-C of FT:mat_peptide KC792704_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0057). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792706_MHBs_P-C Product feature CHAIN KC792706_MHBs_P-C of FT:mat_peptide KC792706_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0059). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792708_MHBs_P-C Product feature CHAIN KC792708_MHBs_P-C of FT:mat_peptide KC792708_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792710_MHBs_P-C Product feature CHAIN KC792710_MHBs_P-C of FT:mat_peptide KC792710_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0063). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCIKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWAYI
>gnl|hbvpro|KC792713_MHBs_P-C Product feature CHAIN KC792713_MHBs_P-C of FT:mat_peptide KC792713_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0066). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792716_MHBs_P-C Product feature CHAIN KC792716_MHBs_P-C of FT:mat_peptide KC792716_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0069). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTLGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFXG
LSPTVWLSVIWMMWYWGXSLYNILSPFLPLLPIFFXLWVYI
>gnl|hbvpro|KC792739_MHBs_P-C Product feature CHAIN KC792739_MHBs_P-C of FT:mat_peptide KC792739_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0092). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792740_MHBs_P-C Product feature CHAIN KC792740_MHBs_P-C of FT:mat_peptide KC792740_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0093). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVGHPYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAFI
>gnl|hbvpro|KC792746_MHBs_P-C Product feature CHAIN KC792746_MHBs_P-C of FT:mat_peptide KC792746_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0099). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XXWNSTTFXQALLDPRVRXLYFPAGGSXSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGXLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLXIFFCLWVYI
>gnl|hbvpro|KC792759_MHBs_P-C Product feature CHAIN KC792759_MHBs_P-C of FT:mat_peptide KC792759_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0112). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTXI
LTIPQSLDSWWTSLNFXGVTPACPGQNSQSPTSNHSPTXCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLXNILRPFIPLLPIFLCLWVYI
>gnl|hbvpro|KC792762_MHBs_P-C Product feature CHAIN KC792762_MHBs_P-C of FT:mat_peptide KC792762_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0115). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQXFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792771_MHBs_P-C Product feature CHAIN KC792771_MHBs_P-C of FT:mat_peptide KC792771_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0124). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSXTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIXAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792775_MHBs_P-C Product feature CHAIN KC792775_MHBs_P-C of FT:mat_peptide KC792775_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0128). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLICLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLHNILSHFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792776_MHBs_P-C Product feature CHAIN KC792776_MHBs_P-C of FT:mat_peptide KC792776_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0129). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792790_MHBs_P-C Product feature CHAIN KC792790_MHBs_P-C of FT:mat_peptide KC792790_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0143). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792792_MHBs_P-C Product feature CHAIN KC792792_MHBs_P-C of FT:mat_peptide KC792792_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0145). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792793_MHBs_P-C Product feature CHAIN KC792793_MHBs_P-C of FT:mat_peptide KC792793_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0146). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792799_MHBs_P-C Product feature CHAIN KC792799_MHBs_P-C of FT:mat_peptide KC792799_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFXLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLGPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792803_MHBs_P-C Product feature CHAIN KC792803_MHBs_P-C of FT:mat_peptide KC792803_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792817_MHBs_P-C Product feature CHAIN KC792817_MHBs_P-C of FT:mat_peptide KC792817_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0170). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSPTSCPQNCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDXQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFXPLLXIFFCLWVYI
>gnl|hbvpro|KC792818_MHBs_P-C Product feature CHAIN KC792818_MHBs_P-C of FT:mat_peptide KC792818_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0171). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLNPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLPVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGPPECPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLXVLXDYQGMLP
VCPLLPGTSITSTGPCKTCTTPAQGTSMFPFCCCTKPSDGNCTCIPIPLSWAFARFLWEWVSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792831_MHBs_P-C Product feature CHAIN KC792831_MHBs_P-C of FT:mat_peptide KC792831_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0184). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALADPRVRGLYLPAGGSGSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAPRNSTFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGRSLYNILRPFLPLLPIFFYLWVYI
>gnl|hbvpro|KC792834_MHBs_P-C Product feature CHAIN KC792834_MHBs_P-C of FT:mat_peptide KC792834_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0187). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGNSXFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMXXYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792853_MHBs_P-C Product feature CHAIN KC792853_MHBs_P-C of FT:mat_peptide KC792853_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0206). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTVSPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFSLTRI
LTIPQRLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792857_MHBs_P-C Product feature CHAIN KC792857_MHBs_P-C of FT:mat_peptide KC792857_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0210). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGEVTTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPKLCNILSPFLPLLLIFCCLWVYI
>gnl|hbvpro|KC792862_MHBs_P-C Product feature CHAIN KC792862_MHBs_P-C of FT:mat_peptide KC792862_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0215). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSXFSRTGDPAPNMENTTSGFLGPLLVLQAGFFXLTXI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792873_MHBs_P-C Product feature CHAIN KC792873_MHBs_P-C of FT:mat_peptide KC792873_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0226). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNXLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792880_MHBs_P-C Product feature CHAIN KC792880_MHBs_P-C of FT:mat_peptide KC792880_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0233). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGXAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKSCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|KC792902_MHBs_P-C Product feature CHAIN KC792902_MHBs_P-C of FT:mat_peptide KC792902_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0255). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPKSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRHSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC792911_MHBs_P-C Product feature CHAIN KC792911_MHBs_P-C of FT:mat_peptide KC792911_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0264). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIXQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDXXGMLP
VCPLLPGTSTTSTGPCKTCTSPAQGTSTFPSCCCTKPSDXNCTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792921_MHBs_P-C Product feature CHAIN KC792921_MHBs_P-C of FT:mat_peptide KC792921_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0274). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792923_MHBs_P-C Product feature CHAIN KC792923_MHBs_P-C of FT:mat_peptide KC792923_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0276). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792926_MHBs_P-C Product feature CHAIN KC792926_MHBs_P-C of FT:mat_peptide KC792926_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0279). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792927_MHBs_P-C Product feature CHAIN KC792927_MHBs_P-C of FT:mat_peptide KC792927_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0280). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792940_MHBs_P-C Product feature CHAIN KC792940_MHBs_P-C of FT:mat_peptide KC792940_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0293). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792941_MHBs_P-C Product feature CHAIN KC792941_MHBs_P-C of FT:mat_peptide KC792941_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0294). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792961_MHBs_P-C Product feature CHAIN KC792961_MHBs_P-C of FT:mat_peptide KC792961_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0314). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792962_MHBs_P-C Product feature CHAIN KC792962_MHBs_P-C of FT:mat_peptide KC792962_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0315). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792965_MHBs_P-C Product feature CHAIN KC792965_MHBs_P-C of FT:mat_peptide KC792965_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0318). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792968_MHBs_P-C Product feature CHAIN KC792968_MHBs_P-C of FT:mat_peptide KC792968_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0321). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSXTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792995_MHBs_P-C Product feature CHAIN KC792995_MHBs_P-C of FT:mat_peptide KC792995_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0348). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IKWNSTTFHQALLDPRVKSLYYPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPACPGQNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWXSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC792999_MHBs_P-C Product feature CHAIN KC792999_MHBs_P-C of FT:mat_peptide KC792999_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0352). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793003_MHBs_P-C Product feature CHAIN KC793003_MHBs_P-C of FT:mat_peptide KC793003_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0356). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=282 residues).
XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPXSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWXSVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWXWGPXLXNILSPFLPLLPIFFCLWVYIX
>gnl|hbvpro|KC793019_MHBs_P-C Product feature CHAIN KC793019_MHBs_P-C of FT:mat_peptide KC793019_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0372). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTTTGPCKTCTIAAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793024_MHBs_P-C Product feature CHAIN KC793024_MHBs_P-C of FT:mat_peptide KC793024_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0377). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGXLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLXFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLXVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAXARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793035_MHBs_P-C Product feature CHAIN KC793035_MHBs_P-C of FT:mat_peptide KC793035_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0388). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793039_MHBs_P-C Product feature CHAIN KC793039_MHBs_P-C of FT:mat_peptide KC793039_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0392). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793040_MHBs_P-C Product feature CHAIN KC793040_MHBs_P-C of FT:mat_peptide KC793040_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0393). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IHWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLXVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLXNIXSPFXPLLPIFXCLWVYI
>gnl|hbvpro|KC793046_MHBs_P-C Product feature CHAIN KC793046_MHBs_P-C of FT:mat_peptide KC793046_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0399). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLNPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPTMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYXGMFP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWGSVRFSWLSLLVPFVQWCVG
LSPIVWLLAIWMMWYWGLSLLNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793050_MHBs_P-C Product feature CHAIN KC793050_MHBs_P-C of FT:mat_peptide KC793050_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0403). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSSLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793051_MHBs_P-C Product feature CHAIN KC793051_MHBs_P-C of FT:mat_peptide KC793051_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0404). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTLNPVPTTASPTSSIFSRTGDPATNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793074_MHBs_P-C Product feature CHAIN KC793074_MHBs_P-C of FT:mat_peptide KC793074_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0427). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRXIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWXVG
LSPTVWXXVIWXMWXWGPXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793097_MHBs_P-C Product feature CHAIN KC793097_MHBs_P-C of FT:mat_peptide KC793097_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0450). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISLIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|KC793100_MHBs_P-C Product feature CHAIN KC793100_MHBs_P-C of FT:mat_peptide KC793100_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0453). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGDAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793103_MHBs_P-C Product feature CHAIN KC793103_MHBs_P-C of FT:mat_peptide KC793103_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0456). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LXIPQSLDSWWTSLNFLGGXPXCPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRXFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793107_MHBs_P-C Product feature CHAIN KC793107_MHBs_P-C of FT:mat_peptide KC793107_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0460). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFSLTKI
LTIPQSLDSWWTSLNFLGGTPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLFLWAYI
>gnl|hbvpro|KC793108_MHBs_P-C Product feature CHAIN KC793108_MHBs_P-C of FT:mat_peptide KC793108_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0461). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFLRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPNLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793110_MHBs_P-C Product feature CHAIN KC793110_MHBs_P-C of FT:mat_peptide KC793110_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0463). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLXVLLDCQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|KC793119_MHBs_P-C Product feature CHAIN KC793119_MHBs_P-C of FT:mat_peptide KC793119_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSKTGDPAQNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAHGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793123_MHBs_P-C Product feature CHAIN KC793123_MHBs_P-C of FT:mat_peptide KC793123_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0476). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IRWNSTTFHQALLDPRVRGLYXPAGGSSSGTXNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLXNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793129_MHBs_P-C Product feature CHAIN KC793129_MHBs_P-C of FT:mat_peptide KC793129_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0482). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNSLGEAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSEGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793142_MHBs_P-C Product feature CHAIN KC793142_MHBs_P-C of FT:mat_peptide KC793142_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0495). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IKWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793187_MHBs_P-C Product feature CHAIN KC793187_MHBs_P-C of FT:mat_peptide KC793187_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0540). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTASGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793195_MHBs_P-C Product feature CHAIN KC793195_MHBs_P-C of FT:mat_peptide KC793195_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0548). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGDAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLXFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|KC793201_MHBs_P-C Product feature CHAIN KC793201_MHBs_P-C of FT:mat_peptide KC793201_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0554). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC793202_MHBs_P-C Product feature CHAIN KC793202_MHBs_P-C of FT:mat_peptide KC793202_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EP0555). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLXLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|KC875261_MHBs_P-C Product feature CHAIN KC875261_MHBs_P-C of FT:mat_peptide KC875261_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV26). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTVPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICRGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875262_MHBs_P-C Product feature CHAIN KC875262_MHBs_P-C of FT:mat_peptide KC875262_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV36). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPRQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQGFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875263_MHBs_P-C Product feature CHAIN KC875263_MHBs_P-C of FT:mat_peptide KC875263_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV61). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQAPLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTGI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCMIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875264_MHBs_P-C Product feature CHAIN KC875264_MHBs_P-C of FT:mat_peptide KC875264_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV49). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPTVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCMIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875265_MHBs_P-C Product feature CHAIN KC875265_MHBs_P-C of FT:mat_peptide KC875265_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV50). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCMIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875267_MHBs_P-C Product feature CHAIN KC875267_MHBs_P-C of FT:mat_peptide KC875267_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV33). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCMITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLLPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875269_MHBs_P-C Product feature CHAIN KC875269_MHBs_P-C of FT:mat_peptide KC875269_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV62). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASGRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875270_MHBs_P-C Product feature CHAIN KC875270_MHBs_P-C of FT:mat_peptide KC875270_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV63). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCIWVYI
>gnl|hbvpro|KC875271_MHBs_P-C Product feature CHAIN KC875271_MHBs_P-C of FT:mat_peptide KC875271_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV65). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875272_MHBs_P-C Product feature CHAIN KC875272_MHBs_P-C of FT:mat_peptide KC875272_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV64). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSPYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875273_MHBs_P-C Product feature CHAIN KC875273_MHBs_P-C of FT:mat_peptide KC875273_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV77). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVKPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875274_MHBs_P-C Product feature CHAIN KC875274_MHBs_P-C of FT:mat_peptide KC875274_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV78). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053161_MHBs_P-C Product feature CHAIN KF053161_MHBs_P-C of FT:mat_peptide KF053161_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY832150). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHNALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFTPLLPIFFCLWVYI
>gnl|hbvpro|KF053164_MHBs_P-C Product feature CHAIN KF053164_MHBs_P-C of FT:mat_peptide KF053164_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY333850). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQTLKDSRVRGLNFPAGGSGSGTVNPVPTTASPISSTFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYS
>gnl|hbvpro|KF053167_MHBs_P-C Product feature CHAIN KF053167_MHBs_P-C of FT:mat_peptide KF053167_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY114622). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053168_MHBs_P-C Product feature CHAIN KF053168_MHBs_P-C of FT:mat_peptide KF053168_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY805753). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDSAPNMESTTSGFLRPLLGLQEGFFSLTRI
LTIPQSLGSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILPLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLNLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILNPFLPLLLIFFCLWVYI
>gnl|hbvpro|KF053169_MHBs_P-C Product feature CHAIN KF053169_MHBs_P-C of FT:mat_peptide KF053169_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY761182). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053170_MHBs_P-C Product feature CHAIN KF053170_MHBs_P-C of FT:mat_peptide KF053170_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY799841). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTGDPAPNMENTTSGFLGPLLVLQAGFSLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053172_MHBs_P-C Product feature CHAIN KF053172_MHBs_P-C of FT:mat_peptide KF053172_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZD5205). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053173_MHBs_P-C Product feature CHAIN KF053173_MHBs_P-C of FT:mat_peptide KF053173_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZD5113). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQALLDPRVRGLYLPAGGSSSGTGNPVPTTASPISSIFSRTGDPAPNMESITSGSLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPRCPGQNSQSPTSNHSPTSCPPNCPGYRSMCLRRFIIFLFILLLCLIFLLVLVDYRGMLP
VCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVRFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053175_MHBs_P-C Product feature CHAIN KF053175_MHBs_P-C of FT:mat_peptide KF053175_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY630304). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|KF053176_MHBs_P-C Product feature CHAIN KF053176_MHBs_P-C of FT:mat_peptide KF053176_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY71639). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053177_MHBs_P-C Product feature CHAIN KF053177_MHBs_P-C of FT:mat_peptide KF053177_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY836190). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDCKGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLLVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVSI
>gnl|hbvpro|KF053181_MHBs_P-C Product feature CHAIN KF053181_MHBs_P-C of FT:mat_peptide KF053181_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY98472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLIPGSSTTSTGPCKTCTTTAQGTSMFPSCCCTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWFWGPKLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053183_MHBs_P-C Product feature CHAIN KF053183_MHBs_P-C of FT:mat_peptide KF053183_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY854757). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPPCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYRGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVE
LSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053184_MHBs_P-C Product feature CHAIN KF053184_MHBs_P-C of FT:mat_peptide KF053184_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY772684). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDLWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQNNSMFPSCCCTKPSDGNCTCIPIPSSWAFARYLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|KF053185_MHBs_P-C Product feature CHAIN KF053185_MHBs_P-C of FT:mat_peptide KF053185_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY855776). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053187_MHBs_P-C Product feature CHAIN KF053187_MHBs_P-C of FT:mat_peptide KF053187_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY797212). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTAFHPALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053193_MHBs_P-C Product feature CHAIN KF053193_MHBs_P-C of FT:mat_peptide KF053193_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY795059). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSNTFHTALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF214652_MHBs_P-C Product feature CHAIN KF214652_MHBs_P-C of FT:mat_peptide KF214652_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-7). Non-functional genomic sequence. [Hepadnaviridae] (length=280 residues).
MQWNTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPARNMENTTSGFLGPLLVLQAGFFLLTKIL
TIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPV
CPLLPGSATTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGL
SPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF214655_MHBs_P-C Product feature CHAIN KF214655_MHBs_P-C of FT:mat_peptide KF214655_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-1963-11). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSATFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|KF214667_MHBs_P-C Product feature CHAIN KF214667_MHBs_P-C of FT:mat_peptide KF214667_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-19). Non-functional genomic sequence. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF214668_MHBs_P-C Product feature CHAIN KF214668_MHBs_P-C of FT:mat_peptide KF214668_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2011-22). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPFDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF214670_MHBs_P-C Product feature CHAIN KF214670_MHBs_P-C of FT:mat_peptide KF214670_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2010-20). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPFPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF214671_MHBs_P-C Product feature CHAIN KF214671_MHBs_P-C of FT:mat_peptide KF214671_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2007-10). Complete genome. [Hepadnaviridae] (length=281 residues).
VQWNSSAFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWLTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDYKGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF214673_MHBs_P-C Product feature CHAIN KF214673_MHBs_P-C of FT:mat_peptide KF214673_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2009-17). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGLLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFPGGAPVSPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLAPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF214675_MHBs_P-C Product feature CHAIN KF214675_MHBs_P-C of FT:mat_peptide KF214675_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-4). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSSTTSTGPCKTCTTPAQGTSTFPSCCCIKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF214676_MHBs_P-C Product feature CHAIN KF214676_MHBs_P-C of FT:mat_peptide KF214676_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IND-2008-12). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF485389_MHBs_P-C Product feature CHAIN KF485389_MHBs_P-C of FT:mat_peptide KF485389_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF7). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTXNPVPTTASPISSTFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF485390_MHBs_P-C Product feature CHAIN KF485390_MHBs_P-C of FT:mat_peptide KF485390_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FF11). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMILFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF495606_MHBs_P-C Product feature CHAIN KF495606_MHBs_P-C of FT:mat_peptide KF495606_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NT-1). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWLTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779242_MHBs_P-C Product feature CHAIN KF779242_MHBs_P-C of FT:mat_peptide KF779242_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate DEN6139). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENITSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779300_MHBs_P-C Product feature CHAIN KF779300_MHBs_P-C of FT:mat_peptide KF779300_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MLT0980). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPKVGGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENMTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779327_MHBs_P-C Product feature CHAIN KF779327_MHBs_P-C of FT:mat_peptide KF779327_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PNF4470). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRDLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFFQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF873514_MHBs_P-C Product feature CHAIN KF873514_MHBs_P-C of FT:mat_peptide KF873514_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 053_EA_Gap). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTGDPAANMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGEAPACLGQNSQSQTSNHSLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLXLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF873516_MHBs_P-C Product feature CHAIN KF873516_MHBs_P-C of FT:mat_peptide KF873516_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 020_EA_Ram). Non-functional genomic sequence. [Hepadnaviridae] (length=279 residues).
MQWNSTAFHQALQDPKVRGLPAGGSSSGAVNPVPNTVSPISSIFAKTGDPAANMENTTSGFLGPLLVLQAGFFLLTRILT
IPQSLDSWWTSLNFLGGAPACRGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVC
PLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAGLS
PTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF873520_MHBs_P-C Product feature CHAIN KF873520_MHBs_P-C of FT:mat_peptide KF873520_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 025_EA_Yir). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTGDPAANMENTTSGFLGPLLVLQAGFFLLTKI
LTIPQSLDSWWTSLNFLGGVPACLGQNSQSQTSNHSQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMIWYWGPSLYNXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF873526_MHBs_P-C Product feature CHAIN KF873526_MHBs_P-C of FT:mat_peptide KF873526_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 040_K_Laj). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSSAFHQALQDPRVRGLYFPAGGSSSGTVSPVQNTVSHISSIFTKTGDPATNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMTWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KF873528_MHBs_P-C Product feature CHAIN KF873528_MHBs_P-C of FT:mat_peptide KF873528_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 026_K_Laj). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=281 residues).
MQWNSSAFHQALQDPRVRGLYFPAGGSSSGTVSPVQNTVSHISSIFTKTGDPATNMENTTSGFLGPLLXLQAGFFLLTRI
LTIXQSLDSWWTSLNFLGGAXACLGQNSQSQTSXHSPTSCPPTXPGYRWMCLRRFIXFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTXTSTGPCRTCTXTAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMXWYWGPSLYNILSPFLPLLPIFFCLWXYI
>gnl|hbvpro|KF873529_MHBs_P-C Product feature CHAIN KF873529_MHBs_P-C of FT:mat_peptide KF873529_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 060_K_Laj). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=281 residues).
MQWNSSAFHQALQDPRVRGLYFPAGGSSSGTVSPVQNTVSHISSIFTKTGDPATNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAXACLGQNSQSQTSXHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFAG
LSPTVWLSVIWMTWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KF873536_MHBs_P-C Product feature CHAIN KF873536_MHBs_P-C of FT:mat_peptide KF873536_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 062_WA_Man). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSXFXTTGDPATNMENTTSGFLGPLLXLQAGFFLLTRI
LTIPQSLDSWWTSLSFLGXXPXCXGQNSQSQTSNHSXTSCPPTCPGYRWMCLRRFIIFLFILLLCLXXLLVLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDXNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMIWYWGPSLYNILSPFFPLLPIFFCLWVYX
>gnl|hbvpro|KF873539_MHBs_P-C Product feature CHAIN KF873539_MHBs_P-C of FT:mat_peptide KF873539_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 033_TI_Ngu). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTGDPATNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMIWYWGPSLXNILSPFFPLLPLFFCLWVYI
>gnl|hbvpro|KF873541_MHBs_P-C Product feature CHAIN KF873541_MHBs_P-C of FT:mat_peptide KF873541_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 042_DR_Wad). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTGDPATNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPACLGQNSQSQTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
VCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFAG
LSPTVWLSVIWMIWYWGPSLHNILSPFFPLLPLFFCLWVYI
>gnl|hbvpro|KF873544_MHBs_P-C Product feature CHAIN KF873544_MHBs_P-C of FT:mat_peptide KF873544_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 009_DR_Wad). Complete genome. [Hepadnaviridae] (length=281 residues).
IQWNSTTFHQALTDPRXRGLXXPVGGSSSGTVNPVPNTVSHISSTFTKTGDPATNMESTTSGFLGPLLVLQAGFFXLTRI
LTIPQSLDSWWTSLNFLGGAPACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYXGMLP
VCPLLPGSTTTSTGXCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ173281_MHBs_P-C Product feature CHAIN KJ173281_MHBs_P-C of FT:mat_peptide KJ173281_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX009C(e216)). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ173282_MHBs_P-C Product feature CHAIN KJ173282_MHBs_P-C of FT:mat_peptide KJ173282_MHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CX009M(e217)). Complete genome. [Hepadnaviridae] (length=281 residues).
MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLTRI
LTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLP
VCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVG
LSPTVWLSVIWMMWYWGPSLYNILSPFLP