HBVdb

Dataset for protein Pol of genotype C

[Download (right click)] [Alignment] [Repertoires]

2613 sequence(s)

>gnl|hbvpro|AB014360_Pol_P-C Product feature CHAIN AB014360_Pol_P-C of FT:mat_peptide AB014360_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D01HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNGASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHG
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014362_Pol_P-C Product feature CHAIN AB014362_Pol_P-C of FT:mat_peptide AB014362_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 03D03HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPAGSGHIDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWPQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITHFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGSXPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQPKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014363_Pol_P-C Product feature CHAIN AB014363_Pol_P-C of FT:mat_peptide AB014363_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04D04HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPL
PACWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESXLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYISLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AB014365_Pol_P-C Product feature CHAIN AB014365_Pol_P-C of FT:mat_peptide AB014365_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D06HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSSRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSALSASSCLHQSAVRKTAYSHXSTFKRQSSSGHTVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLAHIVNLLEDWGPCTEHGDHNIRIPRTPARVTGGVFLVDKNPHNTTESKLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRIINYQHGTMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014367_Pol_P-C Product feature CHAIN AB014367_Pol_P-C of FT:mat_peptide AB014367_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08D08HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSKGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQYGNMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB014369_Pol_P-C Product feature CHAIN AB014369_Pol_P-C of FT:mat_peptide AB014369_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10D10HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLAGGKSGGS
GSIRARVHPTTRRSFGVEPSGSGHIDSSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSAGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
XVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSXGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSMVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYTLNFMGYRIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYXNLYPVARQRSGFCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSAQNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB014371_Pol_P-C Product feature CHAIN AB014371_Pol_P-C of FT:mat_peptide AB014371_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 12D12HCC). Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPSVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCIHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSXSRNINNQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSSTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWAWRPP
>gnl|hbvpro|AB014372_Pol_P-C Product feature CHAIN AB014372_Pol_P-C of FT:mat_peptide AB014372_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13D13HCC). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPATRRSFGVEPSGSGHIDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPISSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESXLVVDFSQFSRGSTRVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRKL
YDSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPF
RPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|AB014374_Pol_P-C Product feature CHAIN AB014374_Pol_P-C of FT:mat_peptide AB014374_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 15D15HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNIYYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFG
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB014376_Pol_P-C Product feature CHAIN AB014376_Pol_P-C of FT:mat_peptide AB014376_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17T02HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKXKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014377_Pol_P-C Product feature CHAIN AB014377_Pol_P-C of FT:mat_peptide AB014377_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18T03HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASGASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVMKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHXRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWKPP
>gnl|hbvpro|AB014378_Pol_P-C Product feature CHAIN AB014378_Pol_P-C of FT:mat_peptide AB014378_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19Y01HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGAEPSGSRHIDNSASGASSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHHIPPSSVRSQSEGPI
SSCWWLQFRNRKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTEARLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHRESLFTXITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLTLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB014379_Pol_P-C Product feature CHAIN AB014379_Pol_P-C of FT:mat_peptide AB014379_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 20Y02HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHE
SCSKHLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGFCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014380_Pol_P-C Product feature CHAIN AB014380_Pol_P-C of FT:mat_peptide AB014380_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 21Y03HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSAKPQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRQLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014381_Pol_P-C Product feature CHAIN AB014381_Pol_P-C of FT:mat_peptide AB014381_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 22Y04HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSATPQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB014382_Pol_P-C Product feature CHAIN AB014382_Pol_P-C of FT:mat_peptide AB014382_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23Y05HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCAQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARGHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGXT
QVSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSKHLYISLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB014383_Pol_P-C Product feature CHAIN AB014383_Pol_P-C of FT:mat_peptide AB014383_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24Y06HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSKGPL
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014384_Pol_P-C Product feature CHAIN AB014384_Pol_P-C of FT:mat_peptide AB014384_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 25Y07HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRTRVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRTTAHSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINXQHGTMQDLHB
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB014385_Pol_P-C Product feature CHAIN AB014385_Pol_P-C of FT:mat_peptide AB014385_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26Y08HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGCIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSEHLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESXFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB014389_Pol_P-C Product feature CHAIN AB014389_Pol_P-C of FT:mat_peptide AB014389_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30Y12HCC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGCIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSDRPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCNQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHHRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB014391_Pol_P-C Product feature CHAIN AB014391_Pol_P-C of FT:mat_peptide AB014391_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 32Y14HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIBRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
KVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSKQLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKRAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPPTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB014392_Pol_P-C Product feature CHAIN AB014392_Pol_P-C of FT:mat_peptide AB014392_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 33Y15HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRAPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLAHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESKLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSKHLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIILKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014393_Pol_P-C Product feature CHAIN AB014393_Pol_P-C of FT:mat_peptide AB014393_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 34Y16HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVQSQLKQSRLGLQPQQGSLARGXSGRG
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHPVELHNIPPSSARPQSKGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAHFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIHKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014394_Pol_P-C Product feature CHAIN AB014394_Pol_P-C of FT:mat_peptide AB014394_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35Y17HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWQAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014396_Pol_P-C Product feature CHAIN AB014396_Pol_P-C of FT:mat_peptide AB014396_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37Y19HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEQAVNHYFKTRHYLHTLWKAGILYKR
ETSRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLAKGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
SSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNNNYQHGTMQDLHD
SCSKHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB014399_Pol_P-C Product feature CHAIN AB014399_Pol_P-C of FT:mat_peptide AB014399_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 40Y22HCC). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSTPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCAQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTXVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB026811_Pol_P-C Product feature CHAIN AB026811_Pol_P-C of FT:mat_peptide AB026811_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Feb.). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSSVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSAGSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIILKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB026812_Pol_P-C Product feature CHAIN AB026812_Pol_P-C of FT:mat_peptide AB026812_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;98.May). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSSVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSAGSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIILKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB026813_Pol_P-C Product feature CHAIN AB026813_Pol_P-C of FT:mat_peptide AB026813_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Sep.). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSSVGPCVRSQLKQSRLGLQPQQGSLARGRSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSAGSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIILKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB026814_Pol_P-C Product feature CHAIN AB026814_Pol_P-C of FT:mat_peptide AB026814_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Donor 3;98.May). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSSVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSAGSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIILKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB026815_Pol_P-C Product feature CHAIN AB026815_Pol_P-C of FT:mat_peptide AB026815_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 2:full). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB031262_Pol_P-C Product feature CHAIN AB031262_Pol_P-C of FT:mat_peptide AB031262_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV VietA-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIISRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNVNHQHGTMQDLHN
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB033550_Pol_P-C Product feature CHAIN AB033550_Pol_P-C of FT:mat_peptide AB033550_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NDR260). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCEQYVGPLTTNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDHSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNNNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB033551_Pol_P-C Product feature CHAIN AB033551_Pol_P-C of FT:mat_peptide AB033551_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK300). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPSIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQEPHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPPTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB033552_Pol_P-C Product feature CHAIN AB033552_Pol_P-C of FT:mat_peptide AB033552_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK494). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPSIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB033553_Pol_P-C Product feature CHAIN AB033553_Pol_P-C of FT:mat_peptide AB033553_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK619). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPSIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSVRSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYETFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB033556_Pol_P-C Product feature CHAIN AB033556_Pol_P-C of FT:mat_peptide AB033556_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AK66). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPSIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRWSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB042282_Pol_P-C Product feature CHAIN AB042282_Pol_P-C of FT:mat_peptide AB042282_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILARSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRVRVHPATRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSASKRQSSSGHAVELHNIPPSSARSQSERPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTLQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB042283_Pol_P-C Product feature CHAIN AB042283_Pol_P-C of FT:mat_peptide AB042283_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILARSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPATRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSASKRQSSSGHAVELHNIPPSSARSQSERPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTLQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB042284_Pol_P-C Product feature CHAIN AB042284_Pol_P-C of FT:mat_peptide AB042284_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNLHYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRAGLCQVFADATPTGWGLAIGHRRMSGTFV
APLPIHTAELVAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWQPP
>gnl|hbvpro|AB049610_Pol_P-C Product feature CHAIN AB049610_Pol_P-C of FT:mat_peptide AB049610_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV AN29). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWSRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPNSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCIEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEALFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLYKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRCGAKLIGTDNCVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB050018_Pol_P-C Product feature CHAIN AB050018_Pol_P-C of FT:mat_peptide AB050018_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSAGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB074047_Pol_P-C Product feature CHAIN AB074047_Pol_P-C of FT:mat_peptide AB074047_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th11). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLKEDIINRCQNFVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKSGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVQSQFKQSRLGLQSQQGSMASSKPGRS
GIIRARIHSTTRQSFGVGPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHVEFQHIPPSSARSQSEGPIF
SCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSKGNTR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDS
CSKHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVH
HREALFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVT
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB074755_Pol_P-C Product feature CHAIN AB074755_Pol_P-C of FT:mat_peptide AB074755_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th44). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASSKPGRS
GSIRARVHSTTRQSFGVEPSGSGHIVNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
FSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB074756_Pol_P-C Product feature CHAIN AB074756_Pol_P-C of FT:mat_peptide AB074756_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th55). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQARQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFAHSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB105173_Pol_P-C Product feature CHAIN AB105173_Pol_P-C of FT:mat_peptide AB105173_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 16). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPTNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB105174_Pol_P-C Product feature CHAIN AB105174_Pol_P-C of FT:mat_peptide AB105174_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 60). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGAEPSGSRHIDNSASGASSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHHIPPSSVRSQSEGPI
SSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKPV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB106895_Pol_P-C Product feature CHAIN AB106895_Pol_P-C of FT:mat_peptide AB106895_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pHB4-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMDRGTSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAAELHNIPPNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNNNYQHGTMQDLHG
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGVHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB111114_Pol_P-C Product feature CHAIN AB111114_Pol_P-C of FT:mat_peptide AB111114_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVLQTSTRHGDESFCSQSSGILSRSPVRPSVRSQLKQSRLGLQSQQGSLAGSKSGRS
GSIRARVHPTSRRPFGVEPSGSGHIDNSASSASSCLLQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTEARLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPYVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB111119_Pol_P-C Product feature CHAIN AB111119_Pol_P-C of FT:mat_peptide AB111119_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGSIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVEIHNIPPSSARPQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
AFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB111120_Pol_P-C Product feature CHAIN AB111120_Pol_P-C of FT:mat_peptide AB111120_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGSIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVEIHNIPPSSARPQSKGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINNQHGTMQDLHD
SCSRHLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIILKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB111121_Pol_P-C Product feature CHAIN AB111121_Pol_P-C of FT:mat_peptide AB111121_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPKHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSPSFCGSPYSWEQELQHGSLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNNKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB111122_Pol_P-C Product feature CHAIN AB111122_Pol_P-C of FT:mat_peptide AB111122_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNNKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB111123_Pol_P-C Product feature CHAIN AB111123_Pol_P-C of FT:mat_peptide AB111123_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNNKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB111124_Pol_P-C Product feature CHAIN AB111124_Pol_P-C of FT:mat_peptide AB111124_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTAKRQSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDIVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB111125_Pol_P-C Product feature CHAIN AB111125_Pol_P-C of FT:mat_peptide AB111125_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTAKRQSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDIVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB111946_Pol_P-C Product feature CHAIN AB111946_Pol_P-C of FT:mat_peptide AB111946_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT103). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSSVGPGIRSQFKQSRLGLQPQQGSLASGKPGRS
GIIRARVHSTTRRSFGVEPSGSGHIDNCTSSASSCLHQSAVRKTAHSHLSTSKRQSFSGNAVELKHIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRSPARVTGGVFLVDKNPHNTTESRLVVDFSQFSGGSP
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
TCSRNLYVSLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGVHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPLNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSAYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|AB112063_Pol_P-C Product feature CHAIN AB112063_Pol_P-C of FT:mat_peptide AB112063_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT101). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKVTMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGTLVFQTSTRHGDESFGSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHPTTRQSFGVEPAGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVFWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
TCSRNLYVSLLLLYTTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGVHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPLNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLSACIQAKRAFTFSPTYRAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB112065_Pol_P-C Product feature CHAIN AB112065_Pol_P-C of FT:mat_peptide AB112065_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT140). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFP
HIHLKEDIINRCQQYVGPLTANEQRRLKLIMPARFYPNLTKYLPLDTGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDFQTSTRHGDESFCSQSSGILSLSPVGPGIQSQFKQSILGLQPQQGSMASGKPGRS
GIIRTRVHPTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNRKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYHHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGTPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LVRLPFRPTTGCTSLYAVSPSVPSHLPDRVHFALPLHVAWRPP
>gnl|hbvpro|AB112066_Pol_P-C Product feature CHAIN AB112066_Pol_P-C of FT:mat_peptide AB112066_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY624). Complete genome. [Hepadnaviridae] (length=843 residues).
MPPSYQHSRKLLLLDDEAGPLERELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQPSERHGDEPFCSQSSGILSRSPVGPSVQSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGST
HVSWPKFAVTNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYHHGTMQDLHE
SCSRNLYVSLVLLYKTFGRKWHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEALFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFRCEQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTYLYAVSPSVPAHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB112348_Pol_P-C Product feature CHAIN AB112348_Pol_P-C of FT:mat_peptide AB112348_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY656). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
YIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVQSPFKQSRLGLQPQQGSMASGKPGRS
GSIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTAKRQSSSGHAVELQHIPPSSARTQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVFCPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRRLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIEQCFRILPINRPIDWEVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPPGWGLAIDQQRMRGTLV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTSGRTTIYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB112408_Pol_P-C Product feature CHAIN AB112408_Pol_P-C of FT:mat_peptide AB112408_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY683). Non-functional genomic sequence. [Hepadnaviridae] (length=840 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHTGNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGPPYSWEQELQHGRSVFQTSTRHGDEPFCSQSSGILSRKPVGPSGRSQGKQSRLGLQPQQGAMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHISTSKRQPSSGHAVELQHIPPSSARSQSEGSC
WWLKFRNSKPCSDHCLSHIVNLLEDWGPCTEYGEHRIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVS
WPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCS
RHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHL
ESLFTSITNFLSSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRQLPINRPIDWEVCQRIVGLLGFA
APFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPPGWGLAIDQQRMRGTLVAPL
PIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLR
LPFRPTSGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB112471_Pol_P-C Product feature CHAIN AB112471_Pol_P-C of FT:mat_peptide AB112471_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH123). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSQSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GSIRARVHSTTRQSFGVEPSGSGHIDNRASSASSCLHQSAVRKTAYSHLSTSKRQSSAGHAVELQHIPPSSARSQSEGPI
FSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLDE
SCSRNLYVSLMLVDKTLGRKMHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRGGYSLNFMGYVIGSWGTLPQEHIGQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB112472_Pol_P-C Product feature CHAIN AB112472_Pol_P-C of FT:mat_peptide AB112472_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH124). Complete genome. [Hepadnaviridae] (length=843 residues).
MLLSYQHFRKLLLLDDEAGPLEEEFPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDEPFCSQSSGILSQSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GSIRARVHSTTRQSFGVEPSGSGHIDNRASSASSCLHQSAVRKTAYSHLSTSKRQSSAGHAVELQHIPPSSARSQSEGTV
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGSLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQWGYPALMPLDACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVVADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRGHFATPLHEAWRPP
>gnl|hbvpro|AB113875_Pol_P-C Product feature CHAIN AB113875_Pol_P-C of FT:mat_peptide AB113875_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVDHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQARLGLQPQHGSLAGGESGRS
GSIRSRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSNQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB113876_Pol_P-C Product feature CHAIN AB113876_Pol_P-C of FT:mat_peptide AB113876_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVDHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQARLGLQPQHGSLAGGESGRS
GSIRSRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSNQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB113878_Pol_P-C Product feature CHAIN AB113878_Pol_P-C of FT:mat_peptide AB113878_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETARSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGSGVRSQLKQSRLGLQPQQGSLARGNSGRS
GSIRTRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVEFHNIPPGSTRSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKNCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPTLKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB113879_Pol_P-C Product feature CHAIN AB113879_Pol_P-C of FT:mat_peptide AB113879_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARVKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSRLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLQLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB115417_Pol_P-C Product feature CHAIN AB115417_Pol_P-C of FT:mat_peptide AB115417_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-O47). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRASVGPRDRSQHKQSRLGLQPQQGSMAGGKPGRR
GSIRARVHPTTRRSFGVEPSDSGHTDNSASSASSCHHQSADTKTAHDHLSTSNRQSSSGHAVELHNFPPSSARPQIEGPV
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLGGSSGLSRYVARLSSTSRNINHQYGTMQDLHD
SCSKHLYVSLLVVDKTFGRKLHLYSHPIVLGFRKNPMGVGLSPFLLAQFTSAICSVVRRASPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKPKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFSFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLGLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB117758_Pol_P-C Product feature CHAIN AB117758_Pol_P-C of FT:mat_peptide AB117758_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CB10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTCKRQSYSGHAVELRNIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB176642_Pol_P-C Product feature CHAIN AB176642_Pol_P-C of FT:mat_peptide AB176642_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-115). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLREDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGGS
RSIRARVRPATRRSVGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSASERQSSSGHAVELHHIPPSSARSQSKGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSA
QHLESLFTXITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHXRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB182589_Pol_P-C Product feature CHAIN AB182589_Pol_P-C of FT:mat_peptide AB182589_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CH:Mat-Ko). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWARVHPTSRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELLNIPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNSLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAVGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB195930_Pol_P-C Product feature CHAIN AB195930_Pol_P-C of FT:mat_peptide AB195930_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETARSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGSGVRSQLKQSRLGLQPQQGSLARGNSGRS
GSIRTRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVEFHNIPPGSTRSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIRMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKNCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLYVAWRPP
>gnl|hbvpro|AB195931_Pol_P-C Product feature CHAIN AB195931_Pol_P-C of FT:mat_peptide AB195931_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETARSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGSGVRSQLKQSRLGLQPQQGSLARGNSGRS
GSIRTRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVEFHNIPPGSTRSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKNCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLYVAWRPP
>gnl|hbvpro|AB195932_Pol_P-C Product feature CHAIN AB195932_Pol_P-C of FT:mat_peptide AB195932_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETARSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGSGVRSQLKQSRLGLQPQQGSLARGNSGRS
GSIRTRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVEFHNIPPGSTRSQSKGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLIPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKNCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLYVAWRPP
>gnl|hbvpro|AB195936_Pol_P-C Product feature CHAIN AB195936_Pol_P-C of FT:mat_peptide AB195936_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSSVRETAYSHLSTSKRQSSSGRAVELHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB195937_Pol_P-C Product feature CHAIN AB195937_Pol_P-C of FT:mat_peptide AB195937_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSSVRETAYSHLSTSKRQSSSGRAVELHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB195938_Pol_P-C Product feature CHAIN AB195938_Pol_P-C of FT:mat_peptide AB195938_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSSVRETAYSHLSTSKRQSSSGRAVELHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB195942_Pol_P-C Product feature CHAIN AB195942_Pol_P-C of FT:mat_peptide AB195942_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSEEPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNFSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB195943_Pol_P-C Product feature CHAIN AB195943_Pol_P-C of FT:mat_peptide AB195943_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKTGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSEEPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNLNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB195944_Pol_P-C Product feature CHAIN AB195944_Pol_P-C of FT:mat_peptide AB195944_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKTGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSEEPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNLNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB195945_Pol_P-C Product feature CHAIN AB195945_Pol_P-C of FT:mat_peptide AB195945_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTLTRHGDESFCSQSSGILSRAPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSSVRKTAYSHLSTSKRQSSSGNAVELHHIPPNSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPVILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHDAWRPP
>gnl|hbvpro|AB195947_Pol_P-C Product feature CHAIN AB195947_Pol_P-C of FT:mat_peptide AB195947_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLARGKSGRS
GSIRARVHSTSRRSFGVEPSGSGHIDNSANSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSPRSQSEGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB195948_Pol_P-C Product feature CHAIN AB195948_Pol_P-C of FT:mat_peptide AB195948_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=835 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHTRHGDESFCSQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLARGKSGRSGSIRARVH
STSRRSFGVEPSGSGHIDNSANSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSPRSQSEGPIFPCWWLQF
RNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWPKFA
VPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNLYV
SLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFT
SITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQ
CGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIHTA
ELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPFRP
TTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB195949_Pol_P-C Product feature CHAIN AB195949_Pol_P-C of FT:mat_peptide AB195949_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLAGGEAGRS
GSIRSRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB195952_Pol_P-C Product feature CHAIN AB195952_Pol_P-C of FT:mat_peptide AB195952_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPPTRRSFGVEPSGSGHIDNSTSSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPIYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLALPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB195953_Pol_P-C Product feature CHAIN AB195953_Pol_P-C of FT:mat_peptide AB195953_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPPTRRSFGVEPSGSGHIDNSTSSTSSCLHQSAVRKTAYSHLSTTKRQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPIYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLALPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB195954_Pol_P-C Product feature CHAIN AB195954_Pol_P-C of FT:mat_peptide AB195954_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPPTRRSFGVEPSGSGHIDNSTSSTSSCLHQSAVRKTAYSHLSTTKRQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPIYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLALPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB198076_Pol_P-C Product feature CHAIN AB198076_Pol_P-C of FT:mat_peptide AB198076_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLNLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB198077_Pol_P-C Product feature CHAIN AB198077_Pol_P-C of FT:mat_peptide AB198077_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAVGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB198078_Pol_P-C Product feature CHAIN AB198078_Pol_P-C of FT:mat_peptide AB198078_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVWSQFKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFQKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB198079_Pol_P-C Product feature CHAIN AB198079_Pol_P-C of FT:mat_peptide AB198079_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAXELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRAGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB198080_Pol_P-C Product feature CHAIN AB198080_Pol_P-C of FT:mat_peptide AB198080_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHSIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHSAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB198081_Pol_P-C Product feature CHAIN AB198081_Pol_P-C of FT:mat_peptide AB198081_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPDNAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSGRSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB198082_Pol_P-C Product feature CHAIN AB198082_Pol_P-C of FT:mat_peptide AB198082_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESICSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSACSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNNKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB198083_Pol_P-C Product feature CHAIN AB198083_Pol_P-C of FT:mat_peptide AB198083_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHFPPSSARPQSEGPI
LSCWWLQFRDSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|AB202071_Pol_P-C Product feature CHAIN AB202071_Pol_P-C of FT:mat_peptide AB202071_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPITRRSFGVEPSGSGHIDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205123_Pol_P-C Product feature CHAIN AB205123_Pol_P-C of FT:mat_peptide AB205123_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CN578-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSEHTDNSASNTSSCLRQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCPTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNTNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFPSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205124_Pol_P-C Product feature CHAIN AB205124_Pol_P-C of FT:mat_peptide AB205124_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TJ3-1-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB205125_Pol_P-C Product feature CHAIN AB205125_Pol_P-C of FT:mat_peptide AB205125_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VH34-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMACGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSAGPL
PSCWWLQFRNSKPCSDHCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTTITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIEQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFM
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB222714_Pol_P-C Product feature CHAIN AB222714_Pol_P-C of FT:mat_peptide AB222714_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVFKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLYQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB222715_Pol_P-C Product feature CHAIN AB222715_Pol_P-C of FT:mat_peptide AB222715_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7M). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRXGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVFKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLYQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLVGTDNSVVLSRKYTSLPMLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB241110_Pol_P-C Product feature CHAIN AB241110_Pol_P-C of FT:mat_peptide AB241110_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC03). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFP
DIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSKRHGDESFCSQSSGILARPSVGPGFRSQFKQSRLGLQPQQGPLARGLAGRS
WSIRARVHPTTRRPFGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNISSSSARSQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNIHNKHGTMQNLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFQPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB241111_Pol_P-C Product feature CHAIN AB241111_Pol_P-C of FT:mat_peptide AB241111_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC14). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFP
DIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSKRHGDESLCSQSSGILARPSVGPGFRSQFKQSRLGLQPQQGPLARGLAGRS
WSIRARVHPTTRRPFGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNISSSSARSQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNIHNKHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLRKQYLTLYPVARQRPGLCQVFADATPTGWGLAMGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFLPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB246344_Pol_P-C Product feature CHAIN AB246344_Pol_P-C of FT:mat_peptide AB246344_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTAKRQSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDIVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB246345_Pol_P-C Product feature CHAIN AB246345_Pol_P-C of FT:mat_peptide AB246345_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPTGTGRIDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELHNIPPSSARPQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB246346_Pol_P-C Product feature CHAIN AB246346_Pol_P-C of FT:mat_peptide AB246346_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGPMASGKPGRS
GSIRARVHSTTRKSFGVEPSGSGHIDNSTSSSSSCLHQSAVRKTAYSHLSTSKRQSSAGHAVELQHIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLSHLVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNFNHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTTVSNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB247916_Pol_P-C Product feature CHAIN AB247916_Pol_P-C of FT:mat_peptide AB247916_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNCKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLTQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB288026_Pol_P-C Product feature CHAIN AB288026_Pol_P-C of FT:mat_peptide AB288026_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRXGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRGSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTVYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKLAVPNLKSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKGWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPASMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGFCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLHLPFRPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB298720_Pol_P-C Product feature CHAIN AB298720_Pol_P-C of FT:mat_peptide AB298720_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1S). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADAGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPSTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSERPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB298721_Pol_P-C Product feature CHAIN AB298721_Pol_P-C of FT:mat_peptide AB298721_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1C). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADAGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKXIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPSTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSERPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB299858_Pol_P-C Product feature CHAIN AB299858_Pol_P-C of FT:mat_peptide AB299858_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIVNSASSPSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB300359_Pol_P-C Product feature CHAIN AB300359_Pol_P-C of FT:mat_peptide AB300359_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHHRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB300360_Pol_P-C Product feature CHAIN AB300360_Pol_P-C of FT:mat_peptide AB300360_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTCNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLAGGKSGRS
GSIRARVHPTTRKSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGSI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTLQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGARSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYADSPSVPFHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB300361_Pol_P-C Product feature CHAIN AB300361_Pol_P-C of FT:mat_peptide AB300361_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAKELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLRLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPSTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARSQSERPI
FSCWWLQFRNSTPCSDYCLTHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB300362_Pol_P-C Product feature CHAIN AB300362_Pol_P-C of FT:mat_peptide AB300362_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIXPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVMKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCNQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|AB300363_Pol_P-C Product feature CHAIN AB300363_Pol_P-C of FT:mat_peptide AB300363_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQKGSMASSKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRKSSSGHAVELQHIPPSSARSQSEGPI
FSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB300365_Pol_P-C Product feature CHAIN AB300365_Pol_P-C of FT:mat_peptide AB300365_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSANSTSSCIHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB300368_Pol_P-C Product feature CHAIN AB300368_Pol_P-C of FT:mat_peptide AB300368_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESCCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYMHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNAVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB300372_Pol_P-C Product feature CHAIN AB300372_Pol_P-C of FT:mat_peptide AB300372_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient14). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRWSFGVKPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNLPPNSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKALLCKQYLNLYPVARQRSGFCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLQLPFRPTTGRTSLYAVFLSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB362932_Pol_P-C Product feature CHAIN AB362932_Pol_P-C of FT:mat_peptide AB362932_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARITGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB365451_Pol_P-C Product feature CHAIN AB365451_Pol_P-C of FT:mat_peptide AB365451_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL196). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367392_Pol_P-C Product feature CHAIN AB367392_Pol_P-C of FT:mat_peptide AB367392_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQHYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVRPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRSFPHCVAFSYVDDVVLGAKSV
QHLESLFTSITNFLSSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB367394_Pol_P-C Product feature CHAIN AB367394_Pol_P-C of FT:mat_peptide AB367394_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 3/Adefovir-treated Pt. 8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367395_Pol_P-C Product feature CHAIN AB367395_Pol_P-C of FT:mat_peptide AB367395_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPSIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSASSCLHQSAVRKTAYSHISTSKRQSSSGHAVELHHIPPNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367396_Pol_P-C Product feature CHAIN AB367396_Pol_P-C of FT:mat_peptide AB367396_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPSIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367397_Pol_P-C Product feature CHAIN AB367397_Pol_P-C of FT:mat_peptide AB367397_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHALEFHNIPPSSARPQSAGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIILKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGYCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB367398_Pol_P-C Product feature CHAIN AB367398_Pol_P-C of FT:mat_peptide AB367398_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 7/Adefovir-treated Pt. 20). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDHSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367399_Pol_P-C Product feature CHAIN AB367399_Pol_P-C of FT:mat_peptide AB367399_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 8/Adefovir-treated Pt. 29). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSARHGDESFCSQSSGILSRSPVGPCVQSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLALPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367401_Pol_P-C Product feature CHAIN AB367401_Pol_P-C of FT:mat_peptide AB367401_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 10/Adefovir-treated Pt. 9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPQSYARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPFHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB367402_Pol_P-C Product feature CHAIN AB367402_Pol_P-C of FT:mat_peptide AB367402_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQYGTMQDLHE
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367403_Pol_P-C Product feature CHAIN AB367403_Pol_P-C of FT:mat_peptide AB367403_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 12/Adefovir-treated Pt. 17). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINHQYGTMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367404_Pol_P-C Product feature CHAIN AB367404_Pol_P-C of FT:mat_peptide AB367404_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 13/Adefovir-treated Pt. 22). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSTVRETAYSHFSTSKRQSSSGHAVELHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB367406_Pol_P-C Product feature CHAIN AB367406_Pol_P-C of FT:mat_peptide AB367406_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 15/Adefovir-treated Pt. 7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRAHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPDSARSQSEGPI
FSCWWLQFRDSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPGYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHRESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367407_Pol_P-C Product feature CHAIN AB367407_Pol_P-C of FT:mat_peptide AB367407_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 16/Adefovir-treated Pt. 11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB367410_Pol_P-C Product feature CHAIN AB367410_Pol_P-C of FT:mat_peptide AB367410_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 19/Adefovir-treated Pt. 19). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVAAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRAGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAASPSVPCHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB367411_Pol_P-C Product feature CHAIN AB367411_Pol_P-C of FT:mat_peptide AB367411_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 20). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPAHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKKAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLVFSYIDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367412_Pol_P-C Product feature CHAIN AB367412_Pol_P-C of FT:mat_peptide AB367412_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 21). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSANSASSCLHQSAVRKTAYSHLSTSKRKSSSGHAVELHNIPPSFARSQSEGPV
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLVFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKECFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVLSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367414_Pol_P-C Product feature CHAIN AB367414_Pol_P-C of FT:mat_peptide AB367414_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 23/Adefovir-treated Pt. 3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKTYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367416_Pol_P-C Product feature CHAIN AB367416_Pol_P-C of FT:mat_peptide AB367416_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 25). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGSSIRSQLKQSRLGLQPQQGSLARGTSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDYSASSATSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRYSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTEARLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVAAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCVAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367417_Pol_P-C Product feature CHAIN AB367417_Pol_P-C of FT:mat_peptide AB367417_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 26). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLREDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGRLVFQTSTRHGDESFCSQSSGILSRSSVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLRQSAVRKTAYSHLSTSKRQSSSGHAVELNNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367418_Pol_P-C Product feature CHAIN AB367418_Pol_P-C of FT:mat_peptide AB367418_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 27/Adefovir-treated Pt. 21). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLRLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHISPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGNMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDLVLGAKSV
QHLESLFTSITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367420_Pol_P-C Product feature CHAIN AB367420_Pol_P-C of FT:mat_peptide AB367420_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 29). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILPRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTARRSFGVEPSGSGHIDNSASSTSSCLHQSAVGETAYSHLSTSKRQSSSGHAVEFHNISPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
KVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLSSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPIYKAFLRKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367421_Pol_P-C Product feature CHAIN AB367421_Pol_P-C of FT:mat_peptide AB367421_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 30). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGTLNGSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGRLVSQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSEHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVDFHNIPPSTARSRSEGPV
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLTWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLSSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367422_Pol_P-C Product feature CHAIN AB367422_Pol_P-C of FT:mat_peptide AB367422_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 31/Adefovir-treated Pt. 12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPITRRSFGVEPSGSGHIDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTENGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPSKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHRRMSGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB367423_Pol_P-C Product feature CHAIN AB367423_Pol_P-C of FT:mat_peptide AB367423_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 32/Adefovir-treated Pt. 28). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGMEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSEGSI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367424_Pol_P-C Product feature CHAIN AB367424_Pol_P-C of FT:mat_peptide AB367424_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 33). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPSIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367427_Pol_P-C Product feature CHAIN AB367427_Pol_P-C of FT:mat_peptide AB367427_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 36/Adefovir-treated Pt. 18). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNGASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTAITNFLLSLGIHLNPNKIKRWGYTLNFMGYRIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367431_Pol_P-C Product feature CHAIN AB367431_Pol_P-C of FT:mat_peptide AB367431_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 40). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRSDFHTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSASSCHHQSAVRKTAHSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTNRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB367432_Pol_P-C Product feature CHAIN AB367432_Pol_P-C of FT:mat_peptide AB367432_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 41). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFP
NIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGGS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCYHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLEALFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB367434_Pol_P-C Product feature CHAIN AB367434_Pol_P-C of FT:mat_peptide AB367434_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 43/Adefovir-treated Pt. 26). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEACLLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIRLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLQHQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGLCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWVSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB367803_Pol_P-C Product feature CHAIN AB367803_Pol_P-C of FT:mat_peptide AB367803_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 13). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADECLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGSSIRSQLKQSRLGLQPQQGSLARGTSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDYSASSATSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRYSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTEARLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVAAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCVAFSYIDDVVLGAKSV
QHLESLFTSITHFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGAFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB367804_Pol_P-C Product feature CHAIN AB367804_Pol_P-C of FT:mat_peptide AB367804_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFP
NIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSSRHGDESFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGGS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLEALFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB426467_Pol_P-C Product feature CHAIN AB426467_Pol_P-C of FT:mat_peptide AB426467_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIVNSASSPSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB471848_Pol_P-C Product feature CHAIN AB471848_Pol_P-C of FT:mat_peptide AB471848_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-F). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIAGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB471849_Pol_P-C Product feature CHAIN AB471849_Pol_P-C of FT:mat_peptide AB471849_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIAGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB471850_Pol_P-C Product feature CHAIN AB471850_Pol_P-C of FT:mat_peptide AB471850_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIAGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB471851_Pol_P-C Product feature CHAIN AB471851_Pol_P-C of FT:mat_peptide AB471851_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2NK-F). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAMGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB471852_Pol_P-C Product feature CHAIN AB471852_Pol_P-C of FT:mat_peptide AB471852_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAMGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB471853_Pol_P-C Product feature CHAIN AB471853_Pol_P-C of FT:mat_peptide AB471853_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAMGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB485808_Pol_P-C Product feature CHAIN AB485808_Pol_P-C of FT:mat_peptide AB485808_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-IT). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSPGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASGASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHLVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIILKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLTLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB485809_Pol_P-C Product feature CHAIN AB485809_Pol_P-C of FT:mat_peptide AB485809_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FEP1). Non-functional genomic sequence. [Hepadnaviridae] (length=836 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEQAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRFVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWSRVHPTTRRSFGVEPSGSGHVDDSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQSSARSQSEGPIFSCW
WLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTQVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRKQHGTMQNLHDSCSRNLY
DTLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLF
TSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPFT
QCGYPALMPLYACIQSKQAFTFSPTYKAFLYAQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHT
AELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFR
PTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|AB485810_Pol_P-C Product feature CHAIN AB485810_Pol_P-C of FT:mat_peptide AB485810_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FEP2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSPGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWSGVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLYAQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|AB493839_Pol_P-C Product feature CHAIN AB493839_Pol_P-C of FT:mat_peptide AB493839_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSERHGDESVCSQSSGILSRSPVGPGVRSQLKQTRLGLQPQQGSLAKGKSGRS
GSIRARVHPTTRRSSGVEPSGSGHIDNSASCTSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHHFPPSSARSQSEGPL
FSCWWLQFRNSKPCSDYCLSHIVNLLVDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINDHHRTLQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACISAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLALGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRP
LLRLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB493844_Pol_P-C Product feature CHAIN AB493844_Pol_P-C of FT:mat_peptide AB493844_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 43UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSERHGDESVCSQSSGILSRSPVGPCVRSQLKQTRLGLQPQQGSLAKGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNVPPSSARSQSEGPL
FSCWWLQFRNSKPCSDYCLSHLVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGALQDLHN
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSI
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLALGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFRPTTGRTSLYAVSPSVPFHLPTRVHFASPLHVAWRPP
>gnl|hbvpro|AB640730_Pol_P-C Product feature CHAIN AB640730_Pol_P-C of FT:mat_peptide AB640730_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ehime-EPCH-HBV-C1-HN). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFP
NIHLQEDILNRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKICQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB642095_Pol_P-C Product feature CHAIN AB642095_Pol_P-C of FT:mat_peptide AB642095_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2000-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIXNRCQQYVGPLTVNEXRRLKLIMPARFYPNXTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPXVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPATRRSFGVEPSGSGHIDNSASSXSSCLHQSAVRKTXYSHLSASKRQSSSGHAVELHNIPPSSARSQSEGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB642097_Pol_P-C Product feature CHAIN AB642097_Pol_P-C of FT:mat_peptide AB642097_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2003-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGXLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFLTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSXHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCXAFSYMDDVVLGXXSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB642099_Pol_P-C Product feature CHAIN AB642099_Pol_P-C of FT:mat_peptide AB642099_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2005-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAELIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAASPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB642100_Pol_P-C Product feature CHAIN AB642100_Pol_P-C of FT:mat_peptide AB642100_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2006-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGNAVELHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670237_Pol_P-C Product feature CHAIN AB670237_Pol_P-C of FT:mat_peptide AB670237_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFYGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPSTRRSFGVEPSGSGHIDNSASCASSCLHQSAVRKTAHSXLSTSKRQSSSGHAVEFNNIPPSSARSQSERPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLXWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINHQYGTMQDLHD
SCSXHLYVSLLLLYKTFGRKLHLYSHPIIXGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLXSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHXRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670238_Pol_P-C Product feature CHAIN AB670238_Pol_P-C of FT:mat_peptide AB670238_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
NIHLQEDIIBRCQQYVGPLTVNEKRRLRLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSXSGHIDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGPMQGLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|AB670239_Pol_P-C Product feature CHAIN AB670239_Pol_P-C of FT:mat_peptide AB670239_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGREVEVHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670240_Pol_P-C Product feature CHAIN AB670240_Pol_P-C of FT:mat_peptide AB670240_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGREVEVHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670241_Pol_P-C Product feature CHAIN AB670241_Pol_P-C of FT:mat_peptide AB670241_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDFQTSTRHGDESFGSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDXVLGAKSV
QHLESLXTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVXKXKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIXSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
ASLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670242_Pol_P-C Product feature CHAIN AB670242_Pol_P-C of FT:mat_peptide AB670242_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRHVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
PCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPXRVHFASPLHVAWKPP
>gnl|hbvpro|AB670247_Pol_P-C Product feature CHAIN AB670247_Pol_P-C of FT:mat_peptide AB670247_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670249_Pol_P-C Product feature CHAIN AB670249_Pol_P-C of FT:mat_peptide AB670249_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.13). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNFNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLXLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB670251_Pol_P-C Product feature CHAIN AB670251_Pol_P-C of FT:mat_peptide AB670251_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVYQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVGKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670252_Pol_P-C Product feature CHAIN AB670252_Pol_P-C of FT:mat_peptide AB670252_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.16). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEGGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPCVRSQLKQSRLGLQPQQGSLSRGKSGRS
GSIRARVHPTTRRXFGVEPSGSGHIXNSASSASSCLHQSAVRKTAYXHXSTSXRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFVAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670253_Pol_P-C Product feature CHAIN AB670253_Pol_P-C of FT:mat_peptide AB670253_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.17). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDHSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670254_Pol_P-C Product feature CHAIN AB670254_Pol_P-C of FT:mat_peptide AB670254_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.18). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDXSAISASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670256_Pol_P-C Product feature CHAIN AB670256_Pol_P-C of FT:mat_peptide AB670256_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.20). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMRARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDHSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQFLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670258_Pol_P-C Product feature CHAIN AB670258_Pol_P-C of FT:mat_peptide AB670258_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.22). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTANEKRRLKLIMPARFYPNLTKYLPLDKGIKPHYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQSQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHADNSASSASSCHHQSAVKKTAYSHLSTSKRQSSSGHAVELHNIPPNSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVAAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHG
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB670259_Pol_P-C Product feature CHAIN AB670259_Pol_P-C of FT:mat_peptide AB670259_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.23). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLXQSRLGLQPQQGSLARGKSXRS
GSIRARVHPTTRRSFGVEPSGSGHTDYXASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAPXLHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNIDYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVQSALNPADDPSRGRLNIYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670260_Pol_P-C Product feature CHAIN AB670260_Pol_P-C of FT:mat_peptide AB670260_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.24). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSMVRRAFPHCLAFRYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670261_Pol_P-C Product feature CHAIN AB670261_Pol_P-C of FT:mat_peptide AB670261_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.25). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDHSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPILSCWWL
QFRNSKPCSDYCLTNIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHCRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670262_Pol_P-C Product feature CHAIN AB670262_Pol_P-C of FT:mat_peptide AB670262_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.26). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWEAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQSQQGSLAGGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHNDNSASSASSCLHQSAVRKKAYSHLSTSKRQSSSGHAVELNNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670263_Pol_P-C Product feature CHAIN AB670263_Pol_P-C of FT:mat_peptide AB670263_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.27). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPITRRSFGVEPSGSGHIDNSASISSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYSCIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAMGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLXLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670264_Pol_P-C Product feature CHAIN AB670264_Pol_P-C of FT:mat_peptide AB670264_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.28). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIIDRCQQYAGPLTANEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLASGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670265_Pol_P-C Product feature CHAIN AB670265_Pol_P-C of FT:mat_peptide AB670265_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.29). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQKYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670266_Pol_P-C Product feature CHAIN AB670266_Pol_P-C of FT:mat_peptide AB670266_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.30). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARSQSEGPIXSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRVRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670267_Pol_P-C Product feature CHAIN AB670267_Pol_P-C of FT:mat_peptide AB670267_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.31). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRSRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670268_Pol_P-C Product feature CHAIN AB670268_Pol_P-C of FT:mat_peptide AB670268_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.32). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYXHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRTRVHPTTRWSFGVEPSGSGHIDNSASSTSSCLHQSADRKTAYSHLSTSKRQSSSGHAVELHNIPSSSARPQSECWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTTRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPNKTRRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670269_Pol_P-C Product feature CHAIN AB670269_Pol_P-C of FT:mat_peptide AB670269_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.33). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQPSSGHAMELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLXTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670270_Pol_P-C Product feature CHAIN AB670270_Pol_P-C of FT:mat_peptide AB670270_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.34). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRTRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPGSARSQSEGPI
CSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670272_Pol_P-C Product feature CHAIN AB670272_Pol_P-C of FT:mat_peptide AB670272_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.36). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLKEDIIDICQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670273_Pol_P-C Product feature CHAIN AB670273_Pol_P-C of FT:mat_peptide AB670273_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.37). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPDNAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWTRVHPTTRRSFGVEPSGSGHVDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHEVELHNIPPGSARSQSEGPI
SSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYTCIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670274_Pol_P-C Product feature CHAIN AB670274_Pol_P-C of FT:mat_peptide AB670274_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGXLNVXIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDILDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHINNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVXKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAXLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670275_Pol_P-C Product feature CHAIN AB670275_Pol_P-C of FT:mat_peptide AB670275_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGXS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSERPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670276_Pol_P-C Product feature CHAIN AB670276_Pol_P-C of FT:mat_peptide AB670276_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIITRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPAGSGRIDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRQLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670277_Pol_P-C Product feature CHAIN AB670277_Pol_P-C of FT:mat_peptide AB670277_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCEQYVGPLTTNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDHSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNNNYQHGTMQDLHE
SCSRTLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHXRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLPLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670278_Pol_P-C Product feature CHAIN AB670278_Pol_P-C of FT:mat_peptide AB670278_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSWSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSAMNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|AB670279_Pol_P-C Product feature CHAIN AB670279_Pol_P-C of FT:mat_peptide AB670279_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLRLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPSTRRSFGVEPSGSGHTDNSASCASSCLHQSAVRKTAYAHLSTSKRQSSSGHAVELHNIPPSSARSQSERPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQYGTMQDLHD
CCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEALFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTXKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLXLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670281_Pol_P-C Product feature CHAIN AB670281_Pol_P-C of FT:mat_peptide AB670281_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRXVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRSRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLYXQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670282_Pol_P-C Product feature CHAIN AB670282_Pol_P-C of FT:mat_peptide AB670282_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
YCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFDSPLHVAWKPP
>gnl|hbvpro|AB670283_Pol_P-C Product feature CHAIN AB670283_Pol_P-C of FT:mat_peptide AB670283_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670285_Pol_P-C Product feature CHAIN AB670285_Pol_P-C of FT:mat_peptide AB670285_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPXAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSSTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670287_Pol_P-C Product feature CHAIN AB670287_Pol_P-C of FT:mat_peptide AB670287_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.14). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEYGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPIYKAFLCKQYLYLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670288_Pol_P-C Product feature CHAIN AB670288_Pol_P-C of FT:mat_peptide AB670288_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.15). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKXKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB670289_Pol_P-C Product feature CHAIN AB670289_Pol_P-C of FT:mat_peptide AB670289_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.16). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIITRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPAGSGRIDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPXSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKXPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRQLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670290_Pol_P-C Product feature CHAIN AB670290_Pol_P-C of FT:mat_peptide AB670290_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.17). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLEKGIKTYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPILSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSAGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670291_Pol_P-C Product feature CHAIN AB670291_Pol_P-C of FT:mat_peptide AB670291_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.18). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTEARLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITHFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB670292_Pol_P-C Product feature CHAIN AB670292_Pol_P-C of FT:mat_peptide AB670292_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.19). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670294_Pol_P-C Product feature CHAIN AB670294_Pol_P-C of FT:mat_peptide AB670294_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.21). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLTWLSLDVSAAFYHIPLHPAAMPHLLVGSAGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRPLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPIYKAFLCKQYLYLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670295_Pol_P-C Product feature CHAIN AB670295_Pol_P-C of FT:mat_peptide AB670295_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.22). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESVCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRTTAYSHLSTSQRQSSSGRVLEHHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSXTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670297_Pol_P-C Product feature CHAIN AB670297_Pol_P-C of FT:mat_peptide AB670297_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.24). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPXVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRSRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670298_Pol_P-C Product feature CHAIN AB670298_Pol_P-C of FT:mat_peptide AB670298_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.25). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHRVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILPRSPVGPCVRSQLKQSRLGLQSQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELDNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGIFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNVNYQHGTMQDLHE
SCQRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYTLNFMGYEIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIXXKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVEWRPP
>gnl|hbvpro|AB670300_Pol_P-C Product feature CHAIN AB670300_Pol_P-C of FT:mat_peptide AB670300_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.27). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQNYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670301_Pol_P-C Product feature CHAIN AB670301_Pol_P-C of FT:mat_peptide AB670301_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.28). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRVRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670302_Pol_P-C Product feature CHAIN AB670302_Pol_P-C of FT:mat_peptide AB670302_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.29). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSKGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670304_Pol_P-C Product feature CHAIN AB670304_Pol_P-C of FT:mat_peptide AB670304_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.31). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPKITKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWERELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRWSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSECWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNIBYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLALGHRRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670305_Pol_P-C Product feature CHAIN AB670305_Pol_P-C of FT:mat_peptide AB670305_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.32). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSSTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670306_Pol_P-C Product feature CHAIN AB670306_Pol_P-C of FT:mat_peptide AB670306_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.33). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDILDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSQDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670309_Pol_P-C Product feature CHAIN AB670309_Pol_P-C of FT:mat_peptide AB670309_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.36). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLRLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRYFGVEPSGSGHIDNSASSTSSCLHQPAVRKTAYSHLSTSKRQSSSGHAVELHHISPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTARNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSA
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB670310_Pol_P-C Product feature CHAIN AB670310_Pol_P-C of FT:mat_peptide AB670310_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.37). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSATVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGSCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB670311_Pol_P-C Product feature CHAIN AB670311_Pol_P-C of FT:mat_peptide AB670311_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.38). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
QIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSSRPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFASITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTAFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLQLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB675674_Pol_P-C Product feature CHAIN AB675674_Pol_P-C of FT:mat_peptide AB675674_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A33). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARSKSGRS
GSIRAGVHPTTRQSFGVGPSGSGHIDNSASSASSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELNNFPPSSARSQSKGPL
LSCWWLQFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRINNYQHGAMQDLHD
SCSRTLYVSLLLLFKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTTFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB675675_Pol_P-C Product feature CHAIN AB675675_Pol_P-C of FT:mat_peptide AB675675_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A34). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARSKSGRS
GSIRAGVHPTTRQSFGVGPSGSGHIDNSASSASSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELNNFPPSSARSQSKGPL
LSCWWLQFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRINNYQHGAMQDLHD
SCSRTLYVSLLLLFKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTTFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB675677_Pol_P-C Product feature CHAIN AB675677_Pol_P-C of FT:mat_peptide AB675677_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A39). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPSVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSSRSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQAFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697490_Pol_P-C Product feature CHAIN AB697490_Pol_P-C of FT:mat_peptide AB697490_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASGTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVMKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|AB697494_Pol_P-C Product feature CHAIN AB697494_Pol_P-C of FT:mat_peptide AB697494_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No9). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTLTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPTTRRSFGVEPSGSGHIENSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSKGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB697500_Pol_P-C Product feature CHAIN AB697500_Pol_P-C of FT:mat_peptide AB697500_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No17). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIWARVHPTSRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB697502_Pol_P-C Product feature CHAIN AB697502_Pol_P-C of FT:mat_peptide AB697502_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No20). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEVGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLKEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYQR
ETSRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLXRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVXGAKTV
HHLXSLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRERGTFV
APLPIHTAELLAACFARSRSGANXIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLYVAWRPP
>gnl|hbvpro|AB697510_Pol_P-C Product feature CHAIN AB697510_Pol_P-C of FT:mat_peptide AB697510_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No33). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGTSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDISASSASSCLHQSAVRQTAYSHLSTSKRQSSSGHAVELHHIPSNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSWSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLXGRVHFASPLHVEWRPP
>gnl|hbvpro|AB900099_Pol_P-C Product feature CHAIN AB900099_Pol_P-C of FT:mat_peptide AB900099_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEQAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPXVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPAGSGRIDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900109_Pol_P-C Product feature CHAIN AB900109_Pol_P-C of FT:mat_peptide AB900109_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAINHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFHTSKRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPHQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSDSRHTDNSASSTSSCHHQSAVRKTAYSHLSTSKRQSSSGHAVEXHNIPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900113_Pol_P-C Product feature CHAIN AB900113_Pol_P-C of FT:mat_peptide AB900113_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPAFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTANEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDFHTSKRHGDESFCSQSSGILSRSPVGPGIRSQLTQSRLGLQPNQGSMARGTSGRS
GSIRARVHPTTRRSFGVEPSDSGHTDNSANSTSSCHNQSAVRKTAHSHLSTSTRQSSSGHAVELHNIPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINDQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFL
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB900115_Pol_P-C Product feature CHAIN AB900115_Pol_P-C of FT:mat_peptide AB900115_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
NIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNMTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPSSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSAMNPADDPSRGRLGLYRP
LLQLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AB900116_Pol_P-C Product feature CHAIN AB900116_Pol_P-C of FT:mat_peptide AB900116_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPGSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFIFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPFHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB931170_Pol_P-C Product feature CHAIN AB931170_Pol_P-C of FT:mat_peptide AB931170_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2P_HB11-0921). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFLKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNETRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRPGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPHQGSMARGKSGRS
GSIRSRVHPTTRRSFGVEPSDSGQTDINASSTSSCHHQSAVRKTAYSHHSTSKRQSSSGHAVELLNIPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSAGLERYVARLSSTSRNINHQYGTMQDLHD
SCSRDLYVSLLLLFKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFL
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB931171_Pol_P-C Product feature CHAIN AB931171_Pol_P-C of FT:mat_peptide AB931171_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2S_HB11-0922). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFLKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNETRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRPGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPHQGSMARGKSGRS
GSIRSRVHPTTRRSFGVEPSDSGQTDINASSTSSCHHQSAVRKTAYSHHSTSKRQSSSGHAVELLNIPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINHQYGTMQDLHD
SCSRDLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFL
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB971714_Pol_P-C Product feature CHAIN AB971714_Pol_P-C of FT:mat_peptide AB971714_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1026). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYTWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGSCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITHFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSRPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB971715_Pol_P-C Product feature CHAIN AB971715_Pol_P-C of FT:mat_peptide AB971715_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1027). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYTWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGSCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITHFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSRPPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF068756_Pol_P-C Product feature CHAIN AF068756_Pol_P-C of FT:mat_peptide AF068756_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSTGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF182802_Pol_P-C Product feature CHAIN AF182802_Pol_P-C of FT:mat_peptide AF182802_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARGHPTTRRSFGAEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSQRQSSSGHAVELYNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHAEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLQRYVARLSSSSRNINYQHGTMQDLHE
SRSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLNPFLLAQFTSSICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYRAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF182803_Pol_P-C Product feature CHAIN AF182803_Pol_P-C of FT:mat_peptide AF182803_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARGHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPRLLVGSSGLPRYVARLSSSSRNINYQHGTMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLNPFLLAQFTSAICSVGRKAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKASLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTVNSVVLSRKYTSFPWLLGCGANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF182804_Pol_P-C Product feature CHAIN AF182804_Pol_P-C of FT:mat_peptide AF182804_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARGHPTTRRPFGVEPSGSGHIDNSASSTSSCLHQSAVRVTAYSHLSTSKRQSSSGHAMELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSSSRNINYQHGTMQDLHD
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF223954_Pol_P-C Product feature CHAIN AF223954_Pol_P-C of FT:mat_peptide AF223954_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWKTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GIFRTRVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSVRSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMAHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF223955_Pol_P-C Product feature CHAIN AF223955_Pol_P-C of FT:mat_peptide AF223955_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASCKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF223956_Pol_P-C Product feature CHAIN AF223956_Pol_P-C of FT:mat_peptide AF223956_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea3). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASCKSGRSGIIRAG
VHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPILSCWWL
QFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFVAPLPIH
TAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF223957_Pol_P-C Product feature CHAIN AF223957_Pol_P-C of FT:mat_peptide AF223957_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWQTPSFP
HIHLKEDIINRCQQYVGPLTINEKRRLKLVMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF223958_Pol_P-C Product feature CHAIN AF223958_Pol_P-C of FT:mat_peptide AF223958_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQEIQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSVASGTSGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLHFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF223959_Pol_P-C Product feature CHAIN AF223959_Pol_P-C of FT:mat_peptide AF223959_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea6). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASCKSGRSGIIRAG
VHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPILSCWWL
QFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFVAPLPIH
TAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF223960_Pol_P-C Product feature CHAIN AF223960_Pol_P-C of FT:mat_peptide AF223960_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMACGTPGRS
GIFRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
RSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARVSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGSLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF223961_Pol_P-C Product feature CHAIN AF223961_Pol_P-C of FT:mat_peptide AF223961_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPAKTKRWGYSLHFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF241410_Pol_P-C Product feature CHAIN AF241410_Pol_P-C of FT:mat_peptide AF241410_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3270). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
DIHLQEDIINRCQQFVGPLNVNEKRRLKLVMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFKTSKRHGDESFCSQSSGILARPSVGPCFRSQFKQSRLGLQPQQGPLARGLAGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNISSSSARSQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTENGEHNIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNINNKHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESFFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKKCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF241411_Pol_P-C Product feature CHAIN AF241411_Pol_P-C of FT:mat_peptide AF241411_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8290). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIINRCQQFVGPLNVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFWGSPYSWEQELQHGRLFFKTSKRHGDESFCSQSSGILARPSVGPCFRSQFKQSRLGLQPQQGPLARGLAGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNRASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVEFHNISSSSARSQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTENGEHNIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNINNKHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QXLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF286594_Pol_P-C Product feature CHAIN AF286594_Pol_P-C of FT:mat_peptide AF286594_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARRNQGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKECFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF363961_Pol_P-C Product feature CHAIN AF363961_Pol_P-C of FT:mat_peptide AF363961_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPSDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGTSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASGTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF384371_Pol_P-C Product feature CHAIN AF384371_Pol_P-C of FT:mat_peptide AF384371_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNERRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNGASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYNHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|AF411408_Pol_P-C Product feature CHAIN AF411408_Pol_P-C of FT:mat_peptide AF411408_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEADPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSRHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHTVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AF411411_Pol_P-C Product feature CHAIN AF411411_Pol_P-C of FT:mat_peptide AF411411_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEADPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSRHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHTVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AF411412_Pol_P-C Product feature CHAIN AF411412_Pol_P-C of FT:mat_peptide AF411412_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFP
NIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDFQTSTRHGDESFCSQSSGILPRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWARVHPTTRQSFGVEPSGSRHIDNSASSTTSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSVRPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNIDYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AF458664_Pol_P-C Product feature CHAIN AF458664_Pol_P-C of FT:mat_peptide AF458664_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C84). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRELLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSQPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNFQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF458665_Pol_P-C Product feature CHAIN AF458665_Pol_P-C of FT:mat_peptide AF458665_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C733). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPDFNPEWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVDHYFKTWHYLHTLWKAGILYKR
GTTRSASFCGSPYSWEQELQHGRPVFQTSTRHGDRSVCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRWSFGVEPSGSGHIVNSASSTSSCLHQSAVRKTAYSHLSTSKRKSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNNRIPRTPARVTGGVFLVDKNPHNTSESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAVFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|AF461357_Pol_P-C Product feature CHAIN AF461357_Pol_P-C of FT:mat_peptide AF461357_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAMSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF461358_Pol_P-C Product feature CHAIN AF461358_Pol_P-C of FT:mat_peptide AF461358_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH8). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HTHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQKGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLRD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFFLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMLGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRTYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPPVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF461359_Pol_P-C Product feature CHAIN AF461359_Pol_P-C of FT:mat_peptide AF461359_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate c16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HTHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQKGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLRD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRTYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF461363_Pol_P-C Product feature CHAIN AF461363_Pol_P-C of FT:mat_peptide AF461363_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAMSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF473543_Pol_P-C Product feature CHAIN AF473543_Pol_P-C of FT:mat_peptide AF473543_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2e). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTLQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKHCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AF533983_Pol_P-C Product feature CHAIN AF533983_Pol_P-C of FT:mat_peptide AF533983_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPSVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRWSFGVEPSGSGHTDNSASGTSSCFHQSAVRKTAYSHLFTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCPEHGEHNIRIPRTPARVTGGVFLVDKNPHSTTESRLAVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ748098_Pol_P-C Product feature CHAIN AJ748098_Pol_P-C of FT:mat_peptide AJ748098_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient Z1). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWLTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLILPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSQSPVGPCIQSQFKQSRLGLQPQQGSMASGTPGRSGILRAR
VHSTTRQSSGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPILSCWWL
QFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHLIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTAVTNFLLSLGIHLNPAKTKRWGYSLHFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIH
TAELLAACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011097_Pol_P-C Product feature CHAIN AP011097_Pol_P-C of FT:mat_peptide AP011097_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPSKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLYKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|AP011098_Pol_P-C Product feature CHAIN AP011098_Pol_P-C of FT:mat_peptide AP011098_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011099_Pol_P-C Product feature CHAIN AP011099_Pol_P-C of FT:mat_peptide AP011099_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFP
DIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSKRHGDESFCSQSSGILARPSVGPGFRSQFKQSRLGLQPQQGPLARGLAGRS
WSIRARVHPTTRRPFGVEPAGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNISSSSARSQSKRPI
LPCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNIHNKHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLAMGHRRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011100_Pol_P-C Product feature CHAIN AP011100_Pol_P-C of FT:mat_peptide AP011100_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPDWQTPSFP
DIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSKRHGDESFCSQSSGILARPSVGPGFRSQFKQSRLGLQPQQGPLARGLAGRS
WSIRARVHPTTRRPFGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNISSSSARSQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNIHNKHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGVHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIILKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSSTYKTFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLAMGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011101_Pol_P-C Product feature CHAIN AP011101_Pol_P-C of FT:mat_peptide AP011101_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPDWQTPSFP
DIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSKRHGDESFCSQSSGILARPSVGPGFRSQFKQSRLGLQPQQGPLARGLAGRS
GSIRARVHPTTRRPFGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNISSSSARSQSKGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNSHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNIHNKHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIILKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLAMGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AP011106_Pol_P-C Product feature CHAIN AP011106_Pol_P-C of FT:mat_peptide AP011106_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLREDIINRCQQYVGPLTVNEKRRLSLIMPARFYPNITKYLPLDKGIKPYYPNHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSQRHGDESFCSQSSGILSRTSVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSVRARVHPTTRKSFGVEPSGSGHIDTSASSASSCLHQSAVRKTAYSHLSTSKRHSSSGHAVELHNIPPNSARSQSQGPL
FSCWWLQFRNSKPCSDFCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVEKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLRTQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AP011107_Pol_P-C Product feature CHAIN AP011107_Pol_P-C of FT:mat_peptide AP011107_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLREDIINRCQRYVGPLTVNEKRRLSLIMPARFYPNITKYLPLDNGIKPYYPNHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSQRHGDESFCSQSSGILSRTSVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSVRARVHPTTRKSFGVEPSGSGHIDTSASSTSSCLHQSAVRKTAYSHLSTSKRHSSSGHAVELHNISPGSAGSQSEGPL
FSCWWLQFRNSKPCSDFCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVGKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLSQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY057947_Pol_P-C Product feature CHAIN AY057947_Pol_P-C of FT:mat_peptide AY057947_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet705). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIITRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQPSGILSRSPFGPCVRSQLKQSRLGLQPHQGPLASSQPGRS
GSIRARAHPSTWRYFGVEPSGSGHIDHSVNNSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNLPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHVYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRXGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWQPP
>gnl|hbvpro|AY066028_Pol_P-C Product feature CHAIN AY066028_Pol_P-C of FT:mat_peptide AY066028_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRDRVHPTTRRSFGVEPSGSRHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHTVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHVVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AY167090_Pol_P-C Product feature CHAIN AY167090_Pol_P-C of FT:mat_peptide AY167090_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHILWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVVHTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMATGTSCWS
GSILARVHPTTRRSFGVEPSCSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQPSSCHAVELHNIAPSSARPQSEGAI
LPCWWLQLRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSISNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY167091_Pol_P-C Product feature CHAIN AY167091_Pol_P-C of FT:mat_peptide AY167091_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ic). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSDSGHTDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGSV
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLSKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167096_Pol_P-C Product feature CHAIN AY167096_Pol_P-C of FT:mat_peptide AY167096_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IIIa). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNXPIDWKVCQKIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY167099_Pol_P-C Product feature CHAIN AY167099_Pol_P-C of FT:mat_peptide AY167099_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IVb). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIVNRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSTSSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPL
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESKLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKMHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY206376_Pol_P-C Product feature CHAIN AY206376_Pol_P-C of FT:mat_peptide AY206376_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQLKQSRLGLQPQQGSLARSKAGRS
GSIRARVHPTTRQSFGVEPSGSGHVDNSASSASSCLHQSAVRKTAYSHLTTSKRQSSSGPEVELHNFPPSSARSQSEGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQGLHD
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAVGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY206379_Pol_P-C Product feature CHAIN AY206379_Pol_P-C of FT:mat_peptide AY206379_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQLKQSRLGLQPQQGSLARSKAGRS
GSIRARVHPTTRQSFGVEPSGSGHVDNSASSASSCLHQSAVRKTAYSHLTTSKRQSSSGPEVELHNFPPSSARSQSEGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQGLHD
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAVGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY206381_Pol_P-C Product feature CHAIN AY206381_Pol_P-C of FT:mat_peptide AY206381_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLTDEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHFSTSKRKSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIMQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFPPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY206382_Pol_P-C Product feature CHAIN AY206382_Pol_P-C of FT:mat_peptide AY206382_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILPRSPVGPCVRSQLKQSRLGLQPQQGSLAKGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEYGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWSLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY206384_Pol_P-C Product feature CHAIN AY206384_Pol_P-C of FT:mat_peptide AY206384_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHFDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMEVCLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY206386_Pol_P-C Product feature CHAIN AY206386_Pol_P-C of FT:mat_peptide AY206386_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGSLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSDSGHTDNSASSASSCHHQSAVRKTAYSHLSTSKRQSSSDHAVELHNIPPSSARSQSEGPV
SSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNNNYQHGTMQDLHD
SCSRNLYVSLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRXAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARCRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRP
LLHLPFRPPTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY206388_Pol_P-C Product feature CHAIN AY206388_Pol_P-C of FT:mat_peptide AY206388_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=836 residues).
MPLSYQHFRKLLLLDEAGPLEEELPRLADEGLNRLVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPH
IHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKRE
TTRSASFCGSPYSWEQELQQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGNSGRSGSIRARV
HPSTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSEGPILSCWWLQ
FRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWPKF
AVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRKFNYQHGTMQDLHDSCSRNLY
ESLLLLYKTFGRKLHLYSHPIILGLRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSVQHREALF
TTITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPFT
QCGYPALMPLYACIQSKQAFTFSPTYKAFLRNQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHT
AELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFR
PTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY206389_Pol_P-C Product feature CHAIN AY206389_Pol_P-C of FT:mat_peptide AY206389_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCAQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLAKGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHSSTSSCLHQSAVRKTLHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWPK
FAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLLLPF
RPTTGRTSLYAVSPSVPSHPQDRVHFASPLHVAWRPP
>gnl|hbvpro|AY206392_Pol_P-C Product feature CHAIN AY206392_Pol_P-C of FT:mat_peptide AY206392_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPSLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSARSTSSCIHQSAVRQTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSERPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFPRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYASIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY220699_Pol_P-C Product feature CHAIN AY220699_Pol_P-C of FT:mat_peptide AY220699_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPATRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSCHTVELHNIPPNSARPQSEGPI
HSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLWSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHHRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY220701_Pol_P-C Product feature CHAIN AY220701_Pol_P-C of FT:mat_peptide AY220701_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQLFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVHHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQPSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRQLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSP
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY220702_Pol_P-C Product feature CHAIN AY220702_Pol_P-C of FT:mat_peptide AY220702_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQPFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQPSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWPK
FAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQNLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFDKIPMGVGLNPFLLTQFTSAICSMVRKAFPHCLAFSYIDDVVLGAKSVQHLESL
YTAITNFLVSLGIHLNPNKTKRWGYPLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY247031_Pol_P-C Product feature CHAIN AY247031_Pol_P-C of FT:mat_peptide AY247031_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB84). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELHNISPSFARSQSEGPL
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY247032_Pol_P-C Product feature CHAIN AY247032_Pol_P-C of FT:mat_peptide AY247032_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB95). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNCASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPIYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFM
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY306136_Pol_P-C Product feature CHAIN AY306136_Pol_P-C of FT:mat_peptide AY306136_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H85). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPGIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLPEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNPYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLYVAWRPP
>gnl|hbvpro|AY596107_Pol_P-C Product feature CHAIN AY596107_Pol_P-C of FT:mat_peptide AY596107_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-1). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEVGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGTSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSLCLHQSGVRKTDYSHLSTSKRQSSSGHAVELHNLPPNSVRSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAKFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY596108_Pol_P-C Product feature CHAIN AY596108_Pol_P-C of FT:mat_peptide AY596108_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSCGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY641558_Pol_P-C Product feature CHAIN AY641558_Pol_P-C of FT:mat_peptide AY641558_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He74). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPRTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYMHLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY641559_Pol_P-C Product feature CHAIN AY641559_Pol_P-C of FT:mat_peptide AY641559_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He53). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHSDTSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSTRSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEALYTSITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSSTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|AY641560_Pol_P-C Product feature CHAIN AY641560_Pol_P-C of FT:mat_peptide AY641560_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He100). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDILNRCQQFVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCAQSSGILSRSPVGPSVRSQLKQSRLGLQPQQGSLARGKSGRS
GNIRSRVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCNQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY641561_Pol_P-C Product feature CHAIN AY641561_Pol_P-C of FT:mat_peptide AY641561_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He127). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSSSSCLHQSAVRKTAYSHFSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPIYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY641562_Pol_P-C Product feature CHAIN AY641562_Pol_P-C of FT:mat_peptide AY641562_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He82). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTSRRSFGVEPSGSGHIDNSASSASYCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSKHL
YFSLLLLYKTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLSLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY641563_Pol_P-C Product feature CHAIN AY641563_Pol_P-C of FT:mat_peptide AY641563_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He52). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDAAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
NIHLHEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHALWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSRSIRA
RVHPTTRRSFGVEPSGSGHIDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNIDYQHGTMQDLHDSCSRH
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAKSVQHLES
LFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLP
FRPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWRPP
>gnl|hbvpro|D00630_Pol_P-C Product feature CHAIN D00630_Pol_P-C of FT:mat_peptide D00630_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWARVHSTTRRSFGVEPSGSGHIDNSASSASSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSCARSQSEGPI
SSCWWLQFRNSEPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGQSGMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRASLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|D12980_Pol_P-C Product feature CHAIN D12980_Pol_P-C of FT:mat_peptide D12980_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPECQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARRNQGRS
GRLRARVHPTTRRSFGVEPSGSGHLDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLVYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFGDATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|D23680_Pol_P-C Product feature CHAIN D23680_Pol_P-C of FT:mat_peptide D23680_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B4-HBVST1). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPAGSGHIDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLTWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITHFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|D23681_Pol_P-C Product feature CHAIN D23681_Pol_P-C of FT:mat_peptide D23681_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C4-HBVST2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSTPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLEKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLLFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPAGSGHIDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYASLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITHFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSWSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|D23682_Pol_P-C Product feature CHAIN D23682_Pol_P-C of FT:mat_peptide D23682_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B5-HBVKO1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYFPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSSVGSGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D23683_Pol_P-C Product feature CHAIN D23683_Pol_P-C of FT:mat_peptide D23683_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C5-HBVKO2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYFPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSSVGSGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGARSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D23684_Pol_P-C Product feature CHAIN D23684_Pol_P-C of FT:mat_peptide D23684_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C6-TKB588). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGCIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGDHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCNQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D28880_Pol_P-C Product feature CHAIN D28880_Pol_P-C of FT:mat_peptide D28880_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Plasma 1992-085-9434). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPAGSGRTDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNTNYQHRTMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKNCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLRKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRVRGTFV
APLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADNPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|D50517_Pol_P-C Product feature CHAIN D50517_Pol_P-C of FT:mat_peptide D50517_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRG
GSIRARVHPTTRRSFGVEPSGSGHIDNSASRASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D50518_Pol_P-C Product feature CHAIN D50518_Pol_P-C of FT:mat_peptide D50518_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRG
GSIRARVHPTTRRSFGVEPSGSGHIDNSASRASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|D50519_Pol_P-C Product feature CHAIN D50519_Pol_P-C of FT:mat_peptide D50519_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSARSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARITGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLGQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVGRQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVEWRPP
>gnl|hbvpro|D50520_Pol_P-C Product feature CHAIN D50520_Pol_P-C of FT:mat_peptide D50520_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSARSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARITGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLHLYPVGRQRSGLCQVFADATPTGWGLAIGHRRMRGTFM
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089757_Pol_P-C Product feature CHAIN DQ089757_Pol_P-C of FT:mat_peptide DQ089757_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2342). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRXVFQTSXRHGDESFCSQSSGILSRSPVGPGIQSQFKQSRLGLQPQQGSMARGTPGRS
GILRARVHSTTRRSFGVEPSGSGHIDNSTSSASSCLNQSAVRKTAYSHLSTXKRQXSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEDGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEXLFTAVTNFLLSLGIHLNPTKTKRWGYSLHFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089758_Pol_P-C Product feature CHAIN DQ089758_Pol_P-C of FT:mat_peptide DQ089758_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1733). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPDHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESCCSQSSGILSRSPVGPCIQSQYKQSRLGLQPQQGSMARGXAGRS
GILRARVHSTTRRSFGVEPSGSGHIDNSTSSASFCLHQSAVRKTAYSHFSTSKRQSSSGRAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTENGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSTNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTAVTNFLLSLGIHLNPAKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPTNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIXHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089759_Pol_P-C Product feature CHAIN DQ089759_Pol_P-C of FT:mat_peptide DQ089759_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1512). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMARGTPGRS
GILRARVHSTTRQSFGVEPSGSRHIDNSTSSVSSCLHQSAVRKTAYSHFSTSKRQSSSGHAVELQHIPPSSDRSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIIHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089760_Pol_P-C Product feature CHAIN DQ089760_Pol_P-C of FT:mat_peptide DQ089760_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK454). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRX
GILRARVHSTTRQSFGVEPSGSRHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSPSGHTVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPAKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYQNLYPVARQRSGLCQVFADATPTGWGLAIGHQRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089761_Pol_P-C Product feature CHAIN DQ089761_Pol_P-C of FT:mat_peptide DQ089761_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK515). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSARHGDESFCSQSSGILSRSSVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDYNTSSASSCLHQSAGRKKAYSHLSTSKRQSSSGXAVEFQHIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLSHIVSLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSASRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPXKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAAHWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089762_Pol_P-C Product feature CHAIN DQ089762_Pol_P-C of FT:mat_peptide DQ089762_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1644). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNXTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSARHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFRVEPSGTGHIDYSTSSASSCLHQSAVRXTAYSHLSTSKRQSSSGHAVELQNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
XVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKXIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089763_Pol_P-C Product feature CHAIN DQ089763_Pol_P-C of FT:mat_peptide DQ089763_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1048). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
YIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSARHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASCCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089764_Pol_P-C Product feature CHAIN DQ089764_Pol_P-C of FT:mat_peptide DQ089764_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK967). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089765_Pol_P-C Product feature CHAIN DQ089765_Pol_P-C of FT:mat_peptide DQ089765_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK428). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
LIHLKEDIINRCQNYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LPCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRVRGTFV
APLPIHTAELLAACFARSRSGATLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089766_Pol_P-C Product feature CHAIN DQ089766_Pol_P-C of FT:mat_peptide DQ089766_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK553). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPDWQTPTFP
LIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQYKQSRLGLQPQQGSMASGTPGGS
GILRARVHSTTWQSFGVEPSGSGHIDNSTSSASSCLHQAAVRKTAYSHLSTFKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPAKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQHMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089768_Pol_P-C Product feature CHAIN DQ089768_Pol_P-C of FT:mat_peptide DQ089768_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1814). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQPSGILSRSPVGPGIRSQFKQSRLGLQPKQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIVNSTSSASSCLYQSAVRKTAYSHLSTSKRQSSSGHTVELQHIPPSSDRSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRVRGTFV
APLPIHTAELLAACFARSRSGAXLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089769_Pol_P-C Product feature CHAIN DQ089769_Pol_P-C of FT:mat_peptide DQ089769_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK430). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQPSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLVLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKIPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089770_Pol_P-C Product feature CHAIN DQ089770_Pol_P-C of FT:mat_peptide DQ089770_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1272). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEPGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNTTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGXAVELQHIPPSSARSQSEGPI
LSCWWFQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGKHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIQQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089771_Pol_P-C Product feature CHAIN DQ089771_Pol_P-C of FT:mat_peptide DQ089771_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1629). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNERRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDESFCSQSSGILSQSPVGPCIQSQFKHSRLGLQPQQGSMASGTPGRS
GILRARVNSTTWRSSGVEPSSSGHIDNSTSSASSCLHQSAVRKTAYSHHSTSKRQSSSGHTVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHYIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|DQ089772_Pol_P-C Product feature CHAIN DQ089772_Pol_P-C of FT:mat_peptide DQ089772_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK910). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQKGSMASGTPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSTSRASSCLHQSAVRKKAYSHLSTSKRQSSSGHAVELQHIPPNSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTLQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPAKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089773_Pol_P-C Product feature CHAIN DQ089773_Pol_P-C of FT:mat_peptide DQ089773_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1193). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLFLDDEAAPLEEELPRLADEVLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDCQTPFFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHXLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELQNIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLSHIVNLIEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089775_Pol_P-C Product feature CHAIN DQ089775_Pol_P-C of FT:mat_peptide DQ089775_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK290). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCXQSSGILSRSPVGPGIRSQFKXSRLGLQPQQGSMASGKPGRS
GIIRAGVHSTTRQSFGVEPSGSRHIDNSTSSASSCLYQTAAKKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPXAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ089776_Pol_P-C Product feature CHAIN DQ089776_Pol_P-C of FT:mat_peptide DQ089776_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK884). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRXKLIMPARFYPNRTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYTWEQELQHGRLVCQTSTRHGDESXCSQSSGILSRSPVGPGFRSQFKQSRLGFQPQQGPMACGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSASRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLVSLGIHLNPBKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFG
APLPIHTAELLAACFARSRSGANLIGTDNSVVLXRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089777_Pol_P-C Product feature CHAIN DQ089777_Pol_P-C of FT:mat_peptide DQ089777_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1159). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYTWEQELQHGRLVCQTSTRHGDESVCSQSSGILSRSPVGPGFRSQFKQSRLGLQPQQGPMACGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSASRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFG
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089778_Pol_P-C Product feature CHAIN DQ089778_Pol_P-C of FT:mat_peptide DQ089778_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1442). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRPVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLRFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ089779_Pol_P-C Product feature CHAIN DQ089779_Pol_P-C of FT:mat_peptide DQ089779_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK554). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVDHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSXVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|DQ089780_Pol_P-C Product feature CHAIN DQ089780_Pol_P-C of FT:mat_peptide DQ089780_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK947). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSQSPVGPGIRSQFKQSRLGLQPQQGSMASGKSGRS
GIIRSRVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPL
PSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLGCSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVXRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTRRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089781_Pol_P-C Product feature CHAIN DQ089781_Pol_P-C of FT:mat_peptide DQ089781_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1476). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMANGKPGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089782_Pol_P-C Product feature CHAIN DQ089782_Pol_P-C of FT:mat_peptide DQ089782_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2032). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIVNRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRVRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089783_Pol_P-C Product feature CHAIN DQ089783_Pol_P-C of FT:mat_peptide DQ089783_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1402). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLSLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPDIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKKAYSHLSTSKRQSSSGHAMELQHIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLYKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089784_Pol_P-C Product feature CHAIN DQ089784_Pol_P-C of FT:mat_peptide DQ089784_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1285). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSTRSQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
XVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089785_Pol_P-C Product feature CHAIN DQ089785_Pol_P-C of FT:mat_peptide DQ089785_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1386). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGLNRRVAEELNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVCQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMARGKPGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSASSATSCLHQSAVRKTAYSHLSASKRQSSSGRAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
HHLESLYTAITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLYQQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089786_Pol_P-C Product feature CHAIN DQ089786_Pol_P-C of FT:mat_peptide DQ089786_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2074). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFNGSPYSWEQELQHGRLDFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQSQQGSMASGKPGRS
GIIRAGVYSTTRQSFGVEPSGSGHIDNSTSSSSSCLHQSAVRKTAYSHLSTSKRQSSXGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSEYCLSHIVNLREDWGPCTEYGEHLIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRXRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089787_Pol_P-C Product feature CHAIN DQ089787_Pol_P-C of FT:mat_peptide DQ089787_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK352). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GVMRVEVHSSTRSSCGVEPSGSRHIDNSTSSSSSCLHQSAVRKTAYSHLSTSKRQSSAGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPDKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKNCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089788_Pol_P-C Product feature CHAIN DQ089788_Pol_P-C of FT:mat_peptide DQ089788_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK820). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIIBRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFQQSRLGLKPQQGSMASGKPGRS
GIIRAGVHSTTRQSLGVEPSGSGHIDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSAGHAMELQHIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYKHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089789_Pol_P-C Product feature CHAIN DQ089789_Pol_P-C of FT:mat_peptide DQ089789_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK926). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGIWYKR
ETTRSASFCGSPYSWEQELQHGRPVFQTSTRHGDESCCSQPSGILSRSPVGPGIQSQFKQSRLGLQPQQGSMASGKPGRS
GSIRAGVHSTTRRSFGVEPSGSGHIDNSTSSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYRNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089790_Pol_P-C Product feature CHAIN DQ089790_Pol_P-C of FT:mat_peptide DQ089790_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1248). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQZXVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPGVQSQFKQSRLGLKPQQGSLASGTTSRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSSSSCLHQSAVRKTAYSHLSTSKRQSSAGHAVELKHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDNCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINYQHGTMQGLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTTITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWXLRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|DQ089791_Pol_P-C Product feature CHAIN DQ089791_Pol_P-C of FT:mat_peptide DQ089791_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1205). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPHYPEHIVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELQHIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEBGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINXQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAXTNFLXSLGIHINPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLALGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089792_Pol_P-C Product feature CHAIN DQ089792_Pol_P-C of FT:mat_peptide DQ089792_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK870). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDXAGPLEXELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCFHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARFQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLXTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAVDHQRMRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089793_Pol_P-C Product feature CHAIN DQ089793_Pol_P-C of FT:mat_peptide DQ089793_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK343). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQPSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089795_Pol_P-C Product feature CHAIN DQ089795_Pol_P-C of FT:mat_peptide DQ089795_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1465). Complete genome. [Hepadnaviridae] (length=844 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSTSFCLHQSAVRKTAXSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVKLLEDWGPCTEHGEHNIXIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRKFNNHQHGAMQDLH
DSCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKS
VQHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGL
LGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTF
VAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYR
PLLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089796_Pol_P-C Product feature CHAIN DQ089796_Pol_P-C of FT:mat_peptide DQ089796_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK751). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILTRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHSDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLAHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNLNXQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089797_Pol_P-C Product feature CHAIN DQ089797_Pol_P-C of FT:mat_peptide DQ089797_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1169). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQSQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRHSSSGHAVELHNNPPSSARSQSEEPI
FSCWWLQFRNSKPCSDYCLTHIVKLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQXLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKXV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLVGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ089799_Pol_P-C Product feature CHAIN DQ089799_Pol_P-C of FT:mat_peptide DQ089799_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK734). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNXEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRPFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELYNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRIINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089801_Pol_P-C Product feature CHAIN DQ089801_Pol_P-C of FT:mat_peptide DQ089801_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2100). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFHTSKRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSDSGHTDNSASSASSCHHQSAVRKTAYSHLSTSKRQSSSGHAVELHNVPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLSHLVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLPVAWRPP
>gnl|hbvpro|DQ089802_Pol_P-C Product feature CHAIN DQ089802_Pol_P-C of FT:mat_peptide DQ089802_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1371). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPXVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARIHPTTRRSFGVEPSDSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSFARSQSEGPV
XSCWWLQFRSSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQYGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHKRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089803_Pol_P-C Product feature CHAIN DQ089803_Pol_P-C of FT:mat_peptide DQ089803_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK931). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYRR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPVYSQSSGILSQSPVGPSVQSQFKQSRLGLQPQQGSMASGKQGRS
GIIRARVHSTTRQPFGVEPSGSGHIDNSASSTSSCLHQSAVQKTAYSHLSTSKRQSSSGHAVELKHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNNNYQHGTMQDLHE
SCSRDLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLRQCFRKLPTNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ089804_Pol_P-C Product feature CHAIN DQ089804_Pol_P-C of FT:mat_peptide DQ089804_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK262). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWQAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFGSQSSGILSQSPVGPSIRSQFKQSRLGLQPQQGSMASGKSGRS
GIFRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSVRSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPXTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSTNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTGELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ246215_Pol_P-C Product feature CHAIN DQ246215_Pol_P-C of FT:mat_peptide DQ246215_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASCKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ315781_Pol_P-C Product feature CHAIN DQ315781_Pol_P-C of FT:mat_peptide DQ315781_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI0398). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSTRHGDEPFCSQSSGILSRSPVGPSIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTWQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVLQHIPPGSTRSQSEGPIL
SCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTH
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYKHGTMQDLHDS
CSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ315783_Pol_P-C Product feature CHAIN DQ315783_Pol_P-C of FT:mat_peptide DQ315783_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI03188). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSTRHGDEPFCSQSSGILSRSPVGPSIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTWQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVLQHIPPGSTRSQSEGPIL
SCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTD
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYKHGTMQDLHDS
CSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ377160_Pol_P-C Product feature CHAIN DQ377160_Pol_P-C of FT:mat_peptide DQ377160_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT16). Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHEVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLMLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
WPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ377161_Pol_P-C Product feature CHAIN DQ377161_Pol_P-C of FT:mat_peptide DQ377161_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT14). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVSNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ377162_Pol_P-C Product feature CHAIN DQ377162_Pol_P-C of FT:mat_peptide DQ377162_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT20). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAATPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ377163_Pol_P-C Product feature CHAIN DQ377163_Pol_P-C of FT:mat_peptide DQ377163_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT32). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ377164_Pol_P-C Product feature CHAIN DQ377164_Pol_P-C of FT:mat_peptide DQ377164_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ377165_Pol_P-C Product feature CHAIN DQ377165_Pol_P-C of FT:mat_peptide DQ377165_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT35). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVDHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRRGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSPARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSTSSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEPHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPGYVARLSSTSRNINYPHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPSLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTGNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ478885_Pol_P-C Product feature CHAIN DQ478885_Pol_P-C of FT:mat_peptide DQ478885_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNPTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLRFRNSQPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPKYVARLSSTSRNINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCNQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ478899_Pol_P-C Product feature CHAIN DQ478899_Pol_P-C of FT:mat_peptide DQ478899_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D20). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDRGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPV
FSCWWLQFRNSTPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHTPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ536410_Pol_P-C Product feature CHAIN DQ536410_Pol_P-C of FT:mat_peptide DQ536410_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPL
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKNKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSSTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|DQ536412_Pol_P-C Product feature CHAIN DQ536412_Pol_P-C of FT:mat_peptide DQ536412_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGFLALMPLYACIQAKQAFTFSSTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|DQ683578_Pol_P-C Product feature CHAIN DQ683578_Pol_P-C of FT:mat_peptide DQ683578_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVSNPEWQTPSFP
NIHLQEDVINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVQSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNCASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
DFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ890381_Pol_P-C Product feature CHAIN DQ890381_Pol_P-C of FT:mat_peptide DQ890381_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=845 residues).
MPLSYQHFRKLLLLDVDNKAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPS
FPNIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILY
KRETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSG
RSGSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELHHISPNSARSQSEG
PISSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRVPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRG
STHVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDL
HDSCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLVFSYIDDVVLGAK
SVQHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVG
LLGFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGT
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLY
RPLLHLPFRPPTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ922649_Pol_P-C Product feature CHAIN DQ922649_Pol_P-C of FT:mat_peptide DQ922649_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRLRGTFV
APLPIHTAELLAACFARSRSGADLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSELNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ922650_Pol_P-C Product feature CHAIN DQ922650_Pol_P-C of FT:mat_peptide DQ922650_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARSKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPLLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVVKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHHRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVLLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ922651_Pol_P-C Product feature CHAIN DQ922651_Pol_P-C of FT:mat_peptide DQ922651_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLSVSIPWTHKVGNFTGLYSSTVPLFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYAHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLAHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWDLAIGHRRMRGTFK
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ975273_Pol_P-C Product feature CHAIN DQ975273_Pol_P-C of FT:mat_peptide DQ975273_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESVCSQSSGILSRSPVGPCVRSQLKQSRLGHQPQQGSLARGNSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|DQ975274_Pol_P-C Product feature CHAIN DQ975274_Pol_P-C of FT:mat_peptide DQ975274_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDPNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAANHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSSVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSAHAVELHTIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDASAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYKHGTMQDLHD
SCSRNLYVSLLLLYKTFGQKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSTICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPLDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFA
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ980547_Pol_P-C Product feature CHAIN DQ980547_Pol_P-C of FT:mat_peptide DQ980547_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTEYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGSMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRLRGTFV
APLPIHTAELLAACFARSRSGADLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSELNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993181_Pol_P-C Product feature CHAIN DQ993181_Pol_P-C of FT:mat_peptide DQ993181_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQEPQHGRLVFQTSTRHGDESFCSQPSGILSRSPVGPCIRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDHCLAHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPGYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRQLHLYSHPIILGFRKLPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSSLCQVFADATPTGWGLAIGHRRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993691_Pol_P-C Product feature CHAIN DQ993691_Pol_P-C of FT:mat_peptide DQ993691_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0803-Nature2.2-unSero). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993692_Pol_P-C Product feature CHAIN DQ993692_Pol_P-C of FT:mat_peptide DQ993692_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0810-Nature2.1-unSero). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ993693_Pol_P-C Product feature CHAIN DQ993693_Pol_P-C of FT:mat_peptide DQ993693_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 232-1125-Nature1.1-unSero). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF494379_Pol_P-C Product feature CHAIN EF494379_Pol_P-C of FT:mat_peptide EF494379_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW8585). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSRHIDNSASSTSSCPHQSAVRKAAYSHLTTSKRQSSSGRAVELQHIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF536065_Pol_P-C Product feature CHAIN EF536065_Pol_P-C of FT:mat_peptide EF536065_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EF536066_Pol_P-C Product feature CHAIN EF536066_Pol_P-C of FT:mat_peptide EF536066_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPV
LSCWWLRFRNSKPCSDYCLSHIANLLEDWGPCTEHGEHDIRIPRTPARVAGGVFLVDKNPHNTTESRLAVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFLSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPHEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRATTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EF688062_Pol_P-C Product feature CHAIN EF688062_Pol_P-C of FT:mat_peptide EF688062_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ28-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSSRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHYIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU305540_Pol_P-C Product feature CHAIN EU305540_Pol_P-C of FT:mat_peptide EU305540_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-123). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIQSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSSTRQSFGAEPSGSGYIDNSTRNASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCRWLQFRNSKPCSDYYLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPTHTAELLAACLARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVARRPP
>gnl|hbvpro|EU305541_Pol_P-C Product feature CHAIN EU305541_Pol_P-C of FT:mat_peptide EU305541_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-190). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSSTRQSFGVEPSGSGYIDNSTRNASSCLHQSAVRKTAHSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
RSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGPL
GFAAPFTQCGYPALMPLYACMQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU305542_Pol_P-C Product feature CHAIN EU305542_Pol_P-C of FT:mat_peptide EU305542_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-1251). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKCLPLDKGIKPYYPEHIVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSSTRQSFGVEPSGLGYIDNSTRNASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSLFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSRGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU306671_Pol_P-C Product feature CHAIN EU306671_Pol_P-C of FT:mat_peptide EU306671_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=836 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFP
DIHLREDIINRCQQYVGPLTVNEKRRLSLIMPARFYPNITKYLPLDKGIKPYYPNHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHLERHGDESFCSQSSGILSRTPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSVRARV
HPTTRKSFGVEPSGSGHIDTRASSASSCLHQSAVRKTAYSHLSTSKRHSSSGHAVELHNIPPSSARSQSKGPLFSCWWLQ
FRNSKPCSDFCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWPKF
AVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQYGTMQDLHDSCSRNLY
VSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLF
TSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVEKIKQCFRKLPVNRPIDWKVCQRIVVLLGFAAPFT
QCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHT
AELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFR
PTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU306673_Pol_P-C Product feature CHAIN EU306673_Pol_P-C of FT:mat_peptide EU306673_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNISPSFARSQSAGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306674_Pol_P-C Product feature CHAIN EU306674_Pol_P-C of FT:mat_peptide EU306674_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNISPSFARSQSAGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAAPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306675_Pol_P-C Product feature CHAIN EU306675_Pol_P-C of FT:mat_peptide EU306675_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNISPSFARSQSAGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306685_Pol_P-C Product feature CHAIN EU306685_Pol_P-C of FT:mat_peptide EU306685_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIITRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHSDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLEFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306687_Pol_P-C Product feature CHAIN EU306687_Pol_P-C of FT:mat_peptide EU306687_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIITRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHALWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHSDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306688_Pol_P-C Product feature CHAIN EU306688_Pol_P-C of FT:mat_peptide EU306688_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIITRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHSDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYHHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306689_Pol_P-C Product feature CHAIN EU306689_Pol_P-C of FT:mat_peptide EU306689_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIITRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRTRVHSTTRQSFGVEPSGSGHSDNSASSASSCLHQSAVRKTAYSYLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPRNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306690_Pol_P-C Product feature CHAIN EU306690_Pol_P-C of FT:mat_peptide EU306690_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIITRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHSDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGERHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGRAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306691_Pol_P-C Product feature CHAIN EU306691_Pol_P-C of FT:mat_peptide EU306691_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIITRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSSSGHSDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPIYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306694_Pol_P-C Product feature CHAIN EU306694_Pol_P-C of FT:mat_peptide EU306694_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIITRCQQYVGPLTVNEKRRLKLTMPARFYPNLTEYLPLDKGIKPYYPEHTVNHYFQTRRYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHSDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRLVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306713_Pol_P-C Product feature CHAIN EU306713_Pol_P-C of FT:mat_peptide EU306713_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEGIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TTCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRRTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLQLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306714_Pol_P-C Product feature CHAIN EU306714_Pol_P-C of FT:mat_peptide EU306714_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306719_Pol_P-C Product feature CHAIN EU306719_Pol_P-C of FT:mat_peptide EU306719_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVVRLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306720_Pol_P-C Product feature CHAIN EU306720_Pol_P-C of FT:mat_peptide EU306720_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLPFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306721_Pol_P-C Product feature CHAIN EU306721_Pol_P-C of FT:mat_peptide EU306721_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGIMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPAARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306722_Pol_P-C Product feature CHAIN EU306722_Pol_P-C of FT:mat_peptide EU306722_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=837 residues).
MPLFYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSTARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHESCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306724_Pol_P-C Product feature CHAIN EU306724_Pol_P-C of FT:mat_peptide EU306724_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDVEAGTLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPGRVIGGVFLVDKNPHNTTESRLVVDFSQFSRGSTYVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHESCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306725_Pol_P-C Product feature CHAIN EU306725_Pol_P-C of FT:mat_peptide EU306725_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGGLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306726_Pol_P-C Product feature CHAIN EU306726_Pol_P-C of FT:mat_peptide EU306726_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRPRVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306727_Pol_P-C Product feature CHAIN EU306727_Pol_P-C of FT:mat_peptide EU306727_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFAHSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306728_Pol_P-C Product feature CHAIN EU306728_Pol_P-C of FT:mat_peptide EU306728_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRPRVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU306729_Pol_P-C Product feature CHAIN EU306729_Pol_P-C of FT:mat_peptide EU306729_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSEHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLLRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLMLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLPAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU410079_Pol_P-C Product feature CHAIN EU410079_Pol_P-C of FT:mat_peptide EU410079_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph109). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFP
DIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSKRHGDESFCSQSSGILARPSVGPGFRSQFKQSRLGLQPQQGPLARGLAGRS
GSIRTRVHPTTRRPFGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTYKRHSSSGXSVELHHISSSSARSQSKGPX
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNIHNKHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLAMGHRRLRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU410080_Pol_P-C Product feature CHAIN EU410080_Pol_P-C of FT:mat_peptide EU410080_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph76). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFP
DIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSKRHGDESFCSQSSGILARPSVGPGFRSQFKQSRLGLQPQQGPLARGLAGRS
WSIRARVHTTTRRPFGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNISSSSARSQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNIHNKHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQDHIILKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSXLNPADDPSRGRLGIYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU410081_Pol_P-C Product feature CHAIN EU410081_Pol_P-C of FT:mat_peptide EU410081_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph80). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFP
DIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSKRHGDESFCSQSSGILARPSVGPGFRSQFKQSRLGLQPQQGPLARGLAGRS
WSIRARVHPTTRRPFGVEPSGSGHIDNSASSSSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNISSSSARSQSKGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSNSRNIHNKHGTMQNLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGGWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALLPLYACIQAKQAFTFSPTYKAFLCKQYLTLYPVXRQRPGLCQVFADATPTGWGLAMGHRRMRGTFX
XPXPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFQPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU439005_Pol_P-C Product feature CHAIN EU439005_Pol_P-C of FT:mat_peptide EU439005_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTDYGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLTWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU439015_Pol_P-C Product feature CHAIN EU439015_Pol_P-C of FT:mat_peptide EU439015_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKAGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAATWILRGTSFVYVPSALNPADDPSRGRLGLCRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU439016_Pol_P-C Product feature CHAIN EU439016_Pol_P-C of FT:mat_peptide EU439016_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRFYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEPQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARAHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPGYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCHRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU498227_Pol_P-C Product feature CHAIN EU498227_Pol_P-C of FT:mat_peptide EU498227_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JL). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSQSPVGPCIRSQFKQSRLGLQPQQGSMACGKPGRS
GILRARVHSTTRRSFGVEPSGSGHIDNRASSASSCLYQSAVRKTAYSHLSTTKRQSSSGHTVELQHIPQSSARSPSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLDDWGPCTEYGEHHIRTPRTPARVTGGVFLVDKNPQNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLQRYVARLSSTSRNNNYQQGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPNIWGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEALFTSITNFLLSLGIHLNTNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU522068_Pol_P-C Product feature CHAIN EU522068_Pol_P-C of FT:mat_peptide EU522068_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5N). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGSS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU522071_Pol_P-C Product feature CHAIN EU522071_Pol_P-C of FT:mat_peptide EU522071_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 7T). Complete genome. [Hepadnaviridae] (length=836 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSTTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHSQRHGDESFGSQSSGILSRSPVGPSVRSQLKQSRLGLQPQQGSMARGKSGRSGSIRARV
HPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNIPTSSARSQSEGPILSCWWLQ
FRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHITTESRLVVDFSQFSRGSTHVSWPKF
AVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQYGTMQDLHDSCSRNLY
VSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLF
TSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPFT
QCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHT
AELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLSLPFR
PTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWKPP
>gnl|hbvpro|EU547562_Pol_P-C Product feature CHAIN EU547562_Pol_P-C of FT:mat_peptide EU547562_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MC05). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEQDAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTWRSFGAEPSGSGHIDNSASSTSSCLHQSAVRKTAHSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLSRYVARLSSTSRNINYQHGPMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAQLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU554535_Pol_P-C Product feature CHAIN EU554535_Pol_P-C of FT:mat_peptide EU554535_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-20). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSLGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRRSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRSLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFANATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYDPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU554536_Pol_P-C Product feature CHAIN EU554536_Pol_P-C of FT:mat_peptide EU554536_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-24). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGTGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKGQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRSINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGPSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU554537_Pol_P-C Product feature CHAIN EU554537_Pol_P-C of FT:mat_peptide EU554537_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-13). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPAGFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFRGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVQSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLPYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYAIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU554538_Pol_P-C Product feature CHAIN EU554538_Pol_P-C of FT:mat_peptide EU554538_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-15). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU554539_Pol_P-C Product feature CHAIN EU554539_Pol_P-C of FT:mat_peptide EU554539_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-21). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVQSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU554540_Pol_P-C Product feature CHAIN EU554540_Pol_P-C of FT:mat_peptide EU554540_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S304-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPTFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
GTTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSFARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVPLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU554541_Pol_P-C Product feature CHAIN EU554541_Pol_P-C of FT:mat_peptide EU554541_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQYFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASNTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLFSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQAFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU554542_Pol_P-C Product feature CHAIN EU554542_Pol_P-C of FT:mat_peptide EU554542_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFDPEWQTPSFP
HIHSQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLFSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU560438_Pol_P-C Product feature CHAIN EU560438_Pol_P-C of FT:mat_peptide EU560438_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2-B74). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSVRARVHPTSRRSFGVEPSGSGHIDNSASSTSSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSTARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGERSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSPTSRNINHQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSRQAFTFSPTYKAFLCQQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCATNWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU560439_Pol_P-C Product feature CHAIN EU560439_Pol_P-C of FT:mat_peptide EU560439_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-B74). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDDSASSTSSCLYQSAGRKTAYSHLSTSKRQSSSGHAVELHNIPPSTARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINHQCGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU560440_Pol_P-C Product feature CHAIN EU560440_Pol_P-C of FT:mat_peptide EU560440_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-S869). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSKGPI
SSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKRCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU560441_Pol_P-C Product feature CHAIN EU560441_Pol_P-C of FT:mat_peptide EU560441_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4-S869). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNERRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNGASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYNHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|EU562215_Pol_P-C Product feature CHAIN EU562215_Pol_P-C of FT:mat_peptide EU562215_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGNESLCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGPLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVWKAAYSHFSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEPLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRTLPVNRPLDWKVCQRIVGLL
GFAAPFTQCSYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU562216_Pol_P-C Product feature CHAIN EU562216_Pol_P-C of FT:mat_peptide EU562216_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKKRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELQHGRLVFQTSTRHGNESLCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGPLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKAAYSHFSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKSAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLTFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVALSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU562217_Pol_P-C Product feature CHAIN EU562217_Pol_P-C of FT:mat_peptide EU562217_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQGDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGNESLCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGPLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKAAYSHFSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQGHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARNRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRSRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU562218_Pol_P-C Product feature CHAIN EU562218_Pol_P-C of FT:mat_peptide EU562218_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGSI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU570068_Pol_P-C Product feature CHAIN EU570068_Pol_P-C of FT:mat_peptide EU570068_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26-S541). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGLAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHRLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAGLLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLYLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU570072_Pol_P-C Product feature CHAIN EU570072_Pol_P-C of FT:mat_peptide EU570072_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-B74). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNLNVGIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSTFSCLYQSAVRKTAYSHLSTSKRQSSSGHAVDLHNIPPSTARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDMSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFIGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWTLRGTSFVYVPSALNPADDPFRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU570073_Pol_P-C Product feature CHAIN EU570073_Pol_P-C of FT:mat_peptide EU570073_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8-S698). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSYCSQSSGILSRSPVGPCVRSQLKQSRLGLQSQQGSLAGGKSGRS
GSIRARVHPTTRRSFGVEPAGSGQIDKSASSTSSCLHQSAVRQTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCNEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGMGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKNCFRKLPVNRPIDWKVRQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRLRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU570074_Pol_P-C Product feature CHAIN EU570074_Pol_P-C of FT:mat_peptide EU570074_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11-S698). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSYCSQSSGILSRSPVGPCVRSQLKQSRLGLQSQQGSLAGGKSGRS
GSIRARVHPTTRRSFGVEPAGSGQIDKSASSTSSCLHQSAVRQTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCNEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGMGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKNCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU579442_Pol_P-C Product feature CHAIN EU579442_Pol_P-C of FT:mat_peptide EU579442_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQNPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCLHQSAVRKTAYSHLTTSKRQSSSGHAVELHNIPPSSARSQSKGPI
SSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHDTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVDRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU579443_Pol_P-C Product feature CHAIN EU579443_Pol_P-C of FT:mat_peptide EU579443_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKKGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARPQSERPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU589336_Pol_P-C Product feature CHAIN EU589336_Pol_P-C of FT:mat_peptide EU589336_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1175-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAINHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASNTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGRVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLWSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU589345_Pol_P-C Product feature CHAIN EU589345_Pol_P-C of FT:mat_peptide EU589345_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S624-2). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWP
KFAVPNLQSLTNLLSSNLSWLSMDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU670263_Pol_P-C Product feature CHAIN EU670263_Pol_P-C of FT:mat_peptide EU670263_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph105). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSERHGDESFCSQSSGILSRSPVGPGIPSQLKQSRLGLQPQQGSLARGMAGRS
GGIRARVHPATRRSFGVEPSSSGHFDIRASSASSCLHQSAVGKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSERPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINHQYGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPIYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU717212_Pol_P-C Product feature CHAIN EU717212_Pol_P-C of FT:mat_peptide EU717212_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D26K-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPATRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FPCWWLQFRNSEPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU717215_Pol_P-C Product feature CHAIN EU717215_Pol_P-C of FT:mat_peptide EU717215_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q67K-1). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYTWEQELQQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGQSGRSGSIRAR
VHPTTRRSFGVEPAGSGRIDNSASSTSSCLHQSAVRKTAYSHLSTSKRKSSSGHAVELHNIPPSSARPQSEGPILSCWWL
QFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTQVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCQRNL
YVSLLLLYKTFGRKLYLHSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYEIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRAHFASPLHVAWRPP
>gnl|hbvpro|EU796069_Pol_P-C Product feature CHAIN EU796069_Pol_P-C of FT:mat_peptide EU796069_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIVDRCKQFVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQDLQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRN
GSIRARVHPTTRRCFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCFTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNLNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKLPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU796070_Pol_P-C Product feature CHAIN EU796070_Pol_P-C of FT:mat_peptide EU796070_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDGEADPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNLTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSRHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHTVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU796072_Pol_P-C Product feature CHAIN EU796072_Pol_P-C of FT:mat_peptide EU796072_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDGEADPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARFHPTTRRSFGVEPSGSRHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHTVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU871969_Pol_P-C Product feature CHAIN EU871969_Pol_P-C of FT:mat_peptide EU871969_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGRLVFQTSKRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARGHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSSSRNINYQHGTMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU871970_Pol_P-C Product feature CHAIN EU871970_Pol_P-C of FT:mat_peptide EU871970_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSKRHGDEPFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGGKPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGSI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSSSRNINYQHGTMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKKCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTAGRTSLYAVSPSVPSHLSDRVHFASPLHVAWRPP
>gnl|hbvpro|EU871971_Pol_P-C Product feature CHAIN EU871971_Pol_P-C of FT:mat_peptide EU871971_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPM
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSSSRNINYQHGTMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLDLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU871972_Pol_P-C Product feature CHAIN EU871972_Pol_P-C of FT:mat_peptide EU871972_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGGEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSSSRNINYQHGTMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHAAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU871973_Pol_P-C Product feature CHAIN EU871973_Pol_P-C of FT:mat_peptide EU871973_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-99-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLTQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGAEPSGSGHIDNSASSTSSCLHQSAVRTTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSSSRNINYQHGTMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU871974_Pol_P-C Product feature CHAIN EU871974_Pol_P-C of FT:mat_peptide EU871974_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLSVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSAGILSRSPVGPCVRSQRKQSRLGRQPQQGSLARGKSGRS
GSIRARGQPTTQRSFGVEPSGSGHIDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSSSRNINYQHGTMQDLHE
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU871975_Pol_P-C Product feature CHAIN EU871975_Pol_P-C of FT:mat_peptide EU871975_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSVCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSYGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU871976_Pol_P-C Product feature CHAIN EU871976_Pol_P-C of FT:mat_peptide EU871976_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-04-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRKSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGKHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIIFGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU871977_Pol_P-C Product feature CHAIN EU871977_Pol_P-C of FT:mat_peptide EU871977_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSVCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU871978_Pol_P-C Product feature CHAIN EU871978_Pol_P-C of FT:mat_peptide EU871978_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-2). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLAAEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTRLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAMELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTDGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|EU871979_Pol_P-C Product feature CHAIN EU871979_Pol_P-C of FT:mat_peptide EU871979_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-4). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFQNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|EU871980_Pol_P-C Product feature CHAIN EU871980_Pol_P-C of FT:mat_peptide EU871980_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-01-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARPQSEGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNLNYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU871982_Pol_P-C Product feature CHAIN EU871982_Pol_P-C of FT:mat_peptide EU871982_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-96-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU871998_Pol_P-C Product feature CHAIN EU871998_Pol_P-C of FT:mat_peptide EU871998_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-00-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARPQSEGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNLNYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU872000_Pol_P-C Product feature CHAIN EU872000_Pol_P-C of FT:mat_peptide EU872000_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYFPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQASKRHGDKSFGSQSSGILSRSPVGPCVRSHLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPNSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHYLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU872001_Pol_P-C Product feature CHAIN EU872001_Pol_P-C of FT:mat_peptide EU872001_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYFPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSKRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPNSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU872002_Pol_P-C Product feature CHAIN EU872002_Pol_P-C of FT:mat_peptide EU872002_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYFPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSKRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPNSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFPQFSRGST
HVSWPKFAVPNLQSLTNLLSPNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGMHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU872003_Pol_P-C Product feature CHAIN EU872003_Pol_P-C of FT:mat_peptide EU872003_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYFPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSKRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPNSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRVRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU872004_Pol_P-C Product feature CHAIN EU872004_Pol_P-C of FT:mat_peptide EU872004_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYFPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSKRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPNSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU872008_Pol_P-C Product feature CHAIN EU872008_Pol_P-C of FT:mat_peptide EU872008_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252A-8). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDKAFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPILSCWWL
QFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRKFNYQHGTMQDLHESCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLPY
RPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWKPP
>gnl|hbvpro|EU872010_Pol_P-C Product feature CHAIN EU872010_Pol_P-C of FT:mat_peptide EU872010_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-92-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPILSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPY
RPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|EU872012_Pol_P-C Product feature CHAIN EU872012_Pol_P-C of FT:mat_peptide EU872012_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-99-5). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSTRHGDESFRSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSEGPILSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU881996_Pol_P-C Product feature CHAIN EU881996_Pol_P-C of FT:mat_peptide EU881996_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient17). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRPVFQTSKRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGDMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU882005_Pol_P-C Product feature CHAIN EU882005_Pol_P-C of FT:mat_peptide EU882005_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient22). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQSQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSDSGHIDNSASSASSCLHQSAVRKTAYSHFSTSKRQSSSGHAVELHNIPPSSTRSQSEGPI
FSCWWLQFRDSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU916204_Pol_P-C Product feature CHAIN EU916204_Pol_P-C of FT:mat_peptide EU916204_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1.1). Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESGLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINNQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGMHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFSFSPTYKAFPCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU916210_Pol_P-C Product feature CHAIN EU916210_Pol_P-C of FT:mat_peptide EU916210_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2.4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCARSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGLRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKKAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTERTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|EU916219_Pol_P-C Product feature CHAIN EU916219_Pol_P-C of FT:mat_peptide EU916219_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTSARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU916222_Pol_P-C Product feature CHAIN EU916222_Pol_P-C of FT:mat_peptide EU916222_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEGWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYPHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU916223_Pol_P-C Product feature CHAIN EU916223_Pol_P-C of FT:mat_peptide EU916223_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAANHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
RSIRARIHPPTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPSSSARSQSEGPI
FSCWWIQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRIRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU916224_Pol_P-C Product feature CHAIN EU916224_Pol_P-C of FT:mat_peptide EU916224_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
RSIRARVHPTSRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNIPSSSARSQSEGPI
FSCWWIQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU916225_Pol_P-C Product feature CHAIN EU916225_Pol_P-C of FT:mat_peptide EU916225_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPAGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGAGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVARRPP
>gnl|hbvpro|EU916229_Pol_P-C Product feature CHAIN EU916229_Pol_P-C of FT:mat_peptide EU916229_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.4). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLREDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPTTRQSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTSESRLVVDFSQFLGGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHPES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKFTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU916233_Pol_P-C Product feature CHAIN EU916233_Pol_P-C of FT:mat_peptide EU916233_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGSCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSAGPQSEGPI
LSCWWLQFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU916237_Pol_P-C Product feature CHAIN EU916237_Pol_P-C of FT:mat_peptide EU916237_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDPNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVSPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESVCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLLFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKRYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIRTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU916238_Pol_P-C Product feature CHAIN EU916238_Pol_P-C of FT:mat_peptide EU916238_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNFSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVSPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESVCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU919164_Pol_P-C Product feature CHAIN EU919164_Pol_P-C of FT:mat_peptide EU919164_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient24). Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=839 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDNGIKPYYPEHAVNHYFKTGHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYTSKRQSSSGHAVELPNIPPSSARSQSEGPIFSCW
WLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPNNTTESRLVVDFSQFSRGSTRVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHDSCSR
NLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSVQHLE
SLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHL
PFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU919168_Pol_P-C Product feature CHAIN EU919168_Pol_P-C of FT:mat_peptide EU919168_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPCLRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRTRVHPTTRRSSGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSSSKRKSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGQKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPKKTKRWGYSLNFMGYVIGSWGTLPQDHIILKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPTRVHFASPLHVAWRPP
>gnl|hbvpro|EU919169_Pol_P-C Product feature CHAIN EU919169_Pol_P-C of FT:mat_peptide EU919169_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPGLRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSSGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSSSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNSNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPKKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHHRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|EU939536_Pol_P-C Product feature CHAIN EU939536_Pol_P-C of FT:mat_peptide EU939536_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNIDYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939538_Pol_P-C Product feature CHAIN EU939538_Pol_P-C of FT:mat_peptide EU939538_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939539_Pol_P-C Product feature CHAIN EU939539_Pol_P-C of FT:mat_peptide EU939539_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C22). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLHEDIINRCQQYVGPLTPNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEQAVNHYFKTRHYLHTLWKAGILYKR
ETARSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCAQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARFHPTTRRSFGVEPSGSGHIDNSASNXSSCLHQSADRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAVGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939540_Pol_P-C Product feature CHAIN EU939540_Pol_P-C of FT:mat_peptide EU939540_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C24). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSCQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939541_Pol_P-C Product feature CHAIN EU939541_Pol_P-C of FT:mat_peptide EU939541_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C25). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDKAGPLKKKLPRLANKGLNRRVAKNLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLKEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPQPIH
IAELLAACFGSSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNRADGPSRGRWGLYRPLLPRPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939542_Pol_P-C Product feature CHAIN EU939542_Pol_P-C of FT:mat_peptide EU939542_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLRLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARGHPATRRSFGVEPSGSGHIDHSASSTSSCLHQSAVRETAYSHLSTSERQSSSGHTVELHNIPPSSARSQSQRPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKECFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939543_Pol_P-C Product feature CHAIN EU939543_Pol_P-C of FT:mat_peptide EU939543_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C38). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGFQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPHSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDMHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTWV
ALLPIHTAEILAACFARSRYGAKLIATDNSVVLSRKYTSFPWLVGCAAKWILRGTSFVYVPSAMNPADDRSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939544_Pol_P-C Product feature CHAIN EU939544_Pol_P-C of FT:mat_peptide EU939544_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C39). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVIQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARVKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYTIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939545_Pol_P-C Product feature CHAIN EU939545_Pol_P-C of FT:mat_peptide EU939545_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C41). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWARVHPTSRRSFGVEPSGSGYIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHNRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSIVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU939546_Pol_P-C Product feature CHAIN EU939546_Pol_P-C of FT:mat_peptide EU939546_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C44). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTAKRQSSSGHAVELHNIPPNSARPQSERPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHRRMRGTFA
ALLPIHTAEILAACFAGSRYGGKLIGTDNSVVLSRKYTSFPWLVGCAANWILRGTSFVYVPSAMNPADDPSRGRLGLYRP
LLSSPFRPTSGRTSLYAVSPSVPCHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939548_Pol_P-C Product feature CHAIN EU939548_Pol_P-C of FT:mat_peptide EU939548_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C46). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPIRTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSKSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTARRSFGVEPSGSGHIDNSASSTTSCLHQSAVRKTAHSHLSTSKRQSSSGHAVELHNIPPNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|EU939549_Pol_P-C Product feature CHAIN EU939549_Pol_P-C of FT:mat_peptide EU939549_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C49). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGREVFQTSTRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSDRSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIILKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU939550_Pol_P-C Product feature CHAIN EU939550_Pol_P-C of FT:mat_peptide EU939550_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C55). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQFVGPLTVNERRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQHKQSRLGLQPQQGSLARGTSGRN
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FXCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSA
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|EU939552_Pol_P-C Product feature CHAIN EU939552_Pol_P-C of FT:mat_peptide EU939552_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C57). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLNNQAGPLEKELPRLANEGLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
TIHLQEDIINRCQHYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGSCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNFPPSSARSKSEGPIFSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQYGTLQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYMTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFAAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939553_Pol_P-C Product feature CHAIN EU939553_Pol_P-C of FT:mat_peptide EU939553_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C60). Non-functional genomic sequence. [Hepadnaviridae] (length=834 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVSQTSTRHGDESFCSQSSGILSRSPVGSCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRAKVHPTTRRSFGVKPSGSGHIDNSASSTSSCLHQSAVRKTAYSTSGHAVELHNIPPSPARSQSEGPISSCWWLQFR
NSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARITGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPKFAV
PNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNLYVS
LLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLXQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTS
ITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQC
GYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRLRGTFVAPLPIHTAE
LLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPT
TGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939555_Pol_P-C Product feature CHAIN EU939555_Pol_P-C of FT:mat_peptide EU939555_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C63). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVRNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSLARGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSXGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKXKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939556_Pol_P-C Product feature CHAIN EU939556_Pol_P-C of FT:mat_peptide EU939556_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=840 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGSC
WWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVS
WPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNVNYQHGTMQDLHDSCS
RNLYVSLLLLYKTFGRKLHLYSHPIIFGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHL
ESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFA
APFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPL
PIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLS
LPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939557_Pol_P-C Product feature CHAIN EU939557_Pol_P-C of FT:mat_peptide EU939557_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C65). Non-functional genomic sequence. [Hepadnaviridae] (length=839 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTAKRQSSSGHAVELHNIPPSSARPQSESCW
WLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSW
PKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSR
NLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLE
SLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKECFRKLPVNRPIDWKVCQRIVGLLGFAA
PFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLP
IHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHL
PFRPTTGRTSLYAVSPSVPSHLPDRVHFASPVHVAWKPP
>gnl|hbvpro|EU939561_Pol_P-C Product feature CHAIN EU939561_Pol_P-C of FT:mat_peptide EU939561_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C70). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPHYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSMVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|EU939562_Pol_P-C Product feature CHAIN EU939562_Pol_P-C of FT:mat_peptide EU939562_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C75). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVIIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHHRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939563_Pol_P-C Product feature CHAIN EU939563_Pol_P-C of FT:mat_peptide EU939563_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLVMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
RSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU939564_Pol_P-C Product feature CHAIN EU939564_Pol_P-C of FT:mat_peptide EU939564_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C77). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNAEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSTRHGDKSFSSQSSGILPRSPVGPGVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNGASSTSSCLHQSAVRKTAYSHLSTSESQSSSGREVELHNVPPSSARSQSEGPI
PSCWWLQFRNSKPCSDSCLAHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLVFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939566_Pol_P-C Product feature CHAIN EU939566_Pol_P-C of FT:mat_peptide EU939566_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C88). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSTRHGDESFCSQPSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGESGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGQKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939567_Pol_P-C Product feature CHAIN EU939567_Pol_P-C of FT:mat_peptide EU939567_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C91). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSIGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRWSFGVEPSGSGHADNSASSTSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
HHLESLFTAVTNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKECFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939568_Pol_P-C Product feature CHAIN EU939568_Pol_P-C of FT:mat_peptide EU939568_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C93). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSPGILSRSPVGPCVRSQLKQSRLGLQPQKGSMARGKSGRS
GSIRATVHPTTRRSLGVEPSGSWHTDNSANTTSSCFNRSAVSKTAYYHLSTSKRQSSSRHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNNTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDMSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMSGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|EU939569_Pol_P-C Product feature CHAIN EU939569_Pol_P-C of FT:mat_peptide EU939569_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C102). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWTRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELYNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLVMLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939570_Pol_P-C Product feature CHAIN EU939570_Pol_P-C of FT:mat_peptide EU939570_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C103). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNRASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGAFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939571_Pol_P-C Product feature CHAIN EU939571_Pol_P-C of FT:mat_peptide EU939571_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C104). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHCNNSACSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSERPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKKAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939572_Pol_P-C Product feature CHAIN EU939572_Pol_P-C of FT:mat_peptide EU939572_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C105). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSANSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939573_Pol_P-C Product feature CHAIN EU939573_Pol_P-C of FT:mat_peptide EU939573_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C106). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRPFGVEPSGSGHIDNSASSASSCFHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPIFSCWWL
QFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHNSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939578_Pol_P-C Product feature CHAIN EU939578_Pol_P-C of FT:mat_peptide EU939578_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C119). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939579_Pol_P-C Product feature CHAIN EU939579_Pol_P-C of FT:mat_peptide EU939579_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSANSTSSCLHQSAVRKTAYSHLSTSKRHSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRDSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939582_Pol_P-C Product feature CHAIN EU939582_Pol_P-C of FT:mat_peptide EU939582_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B25). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRWSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
KVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDLVLGAKSV
QHLESLFTSITNFLLSLGIHLNPSKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939584_Pol_P-C Product feature CHAIN EU939584_Pol_P-C of FT:mat_peptide EU939584_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B107). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARIHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHNHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPTRVHFASPLHVAWRPP
>gnl|hbvpro|EU939585_Pol_P-C Product feature CHAIN EU939585_Pol_P-C of FT:mat_peptide EU939585_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B126). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSERHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939586_Pol_P-C Product feature CHAIN EU939586_Pol_P-C of FT:mat_peptide EU939586_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B142). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLTDEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNSPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRAGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939587_Pol_P-C Product feature CHAIN EU939587_Pol_P-C of FT:mat_peptide EU939587_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSISNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQQHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU939588_Pol_P-C Product feature CHAIN EU939588_Pol_P-C of FT:mat_peptide EU939588_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPDNAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELPHGRSVVQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHSDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHDIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLVFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939590_Pol_P-C Product feature CHAIN EU939590_Pol_P-C of FT:mat_peptide EU939590_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU939591_Pol_P-C Product feature CHAIN EU939591_Pol_P-C of FT:mat_peptide EU939591_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C131). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU939592_Pol_P-C Product feature CHAIN EU939592_Pol_P-C of FT:mat_peptide EU939592_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C141). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|EU939593_Pol_P-C Product feature CHAIN EU939593_Pol_P-C of FT:mat_peptide EU939593_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C144). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILPRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939594_Pol_P-C Product feature CHAIN EU939594_Pol_P-C of FT:mat_peptide EU939594_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C146). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARAHPTTRRSFGVEPSGSGHTDNNARSTSSCLHQSAVRETAYSHLSTSKRQSSSSHAVELPNVPPNSARSQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939595_Pol_P-C Product feature CHAIN EU939595_Pol_P-C of FT:mat_peptide EU939595_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C147). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIHRCEQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRFVFQTSTRHGDKSFCSQSSGILSRSPVGSCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSANSTSSCLHQSAVRETAYSHLSTSKRQSSSGRAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU939596_Pol_P-C Product feature CHAIN EU939596_Pol_P-C of FT:mat_peptide EU939596_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C149). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQFVGPLTGNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSSGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSERSI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVPWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939597_Pol_P-C Product feature CHAIN EU939597_Pol_P-C of FT:mat_peptide EU939597_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C151). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRFVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTARRSFGVEPSGSGHIDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSVRSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939599_Pol_P-C Product feature CHAIN EU939599_Pol_P-C of FT:mat_peptide EU939599_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C172). Non-functional genomic sequence. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLAYEGLNRRVAQDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLHEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPTGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTYKRQSSSGHAVKHNIPPSSARSQSEGPVF
SCWWLQFRNCKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTH
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSSSRNINYQHGTMQDLHDS
CSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQ
HLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939600_Pol_P-C Product feature CHAIN EU939600_Pol_P-C of FT:mat_peptide EU939600_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C176). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVVQTSKRHGDKSFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHHRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939601_Pol_P-C Product feature CHAIN EU939601_Pol_P-C of FT:mat_peptide EU939601_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C177). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
KIHLHEDIINKCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPRVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHFSTSKRQSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCNQYLNLYPVARQRPGLCQVFADATPTGWGLALGHQRMRGTFV
APLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939603_Pol_P-C Product feature CHAIN EU939603_Pol_P-C of FT:mat_peptide EU939603_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C183). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVXQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHAVNSASSTSSCLNQSAVRKTAYSHLSTSKRKSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRXPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
XPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLXRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939605_Pol_P-C Product feature CHAIN EU939605_Pol_P-C of FT:mat_peptide EU939605_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C200). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQYFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPTGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKGQSSSGQSVELNNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939607_Pol_P-C Product feature CHAIN EU939607_Pol_P-C of FT:mat_peptide EU939607_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSTRSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939609_Pol_P-C Product feature CHAIN EU939609_Pol_P-C of FT:mat_peptide EU939609_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C209). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSCCSQSSGILSRSPVGPRVQSQLKQSTLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSTSFCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPTSSARPQSEGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939610_Pol_P-C Product feature CHAIN EU939610_Pol_P-C of FT:mat_peptide EU939610_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C211). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSSSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU939611_Pol_P-C Product feature CHAIN EU939611_Pol_P-C of FT:mat_peptide EU939611_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C212). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
XVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINNQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|EU939612_Pol_P-C Product feature CHAIN EU939612_Pol_P-C of FT:mat_peptide EU939612_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C213). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939613_Pol_P-C Product feature CHAIN EU939613_Pol_P-C of FT:mat_peptide EU939613_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C214). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTTKRQSSSGHAVELHNIPPSSARPQSEGPL
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939614_Pol_P-C Product feature CHAIN EU939614_Pol_P-C of FT:mat_peptide EU939614_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C217). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTLNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRKSSSGHAVELHNIPPSSARPQSEGPL
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINNQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939615_Pol_P-C Product feature CHAIN EU939615_Pol_P-C of FT:mat_peptide EU939615_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939616_Pol_P-C Product feature CHAIN EU939616_Pol_P-C of FT:mat_peptide EU939616_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C228). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVQSQLKQSRLGLQPQQGSLAGGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNLNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939617_Pol_P-C Product feature CHAIN EU939617_Pol_P-C of FT:mat_peptide EU939617_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C229). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRNVLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPENAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYTWEQELPHGRLVFQTSTRHGDESFCSQSSGILPRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVEFHNIPPSSARSQSEGPI
FSCWWLQFRDSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLRHQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFE
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939618_Pol_P-C Product feature CHAIN EU939618_Pol_P-C of FT:mat_peptide EU939618_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C230). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTTNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGRSDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939619_Pol_P-C Product feature CHAIN EU939619_Pol_P-C of FT:mat_peptide EU939619_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C233). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
RIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSKSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGESGRS
GSIRARVHPTTRRSFGVEPAGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSFARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCTRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939625_Pol_P-C Product feature CHAIN EU939625_Pol_P-C of FT:mat_peptide EU939625_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C167). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNINVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARSKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNFPPSSARSQSEGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTAFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|EU939626_Pol_P-C Product feature CHAIN EU939626_Pol_P-C of FT:mat_peptide EU939626_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D158). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARSKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYAHLSTSKRQSSSGHAVELHNFPPSSARSQSEGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTXFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFA
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EU939640_Pol_P-C Product feature CHAIN EU939640_Pol_P-C of FT:mat_peptide EU939640_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C239). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTARRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRDSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
KVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939642_Pol_P-C Product feature CHAIN EU939642_Pol_P-C of FT:mat_peptide EU939642_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D20). Non-functional genomic sequence. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSIRHGDKSFCSQSSGILARSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPIHSCWWL
QFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVTKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939644_Pol_P-C Product feature CHAIN EU939644_Pol_P-C of FT:mat_peptide EU939644_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D36). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSASRNINYQHGTMQDLHQ
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLVFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939646_Pol_P-C Product feature CHAIN EU939646_Pol_P-C of FT:mat_peptide EU939646_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D88). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHTDNSASSTSSCLRQSAVRKTAYSHLSTSKRQSSSGCEVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSKNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFSFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWRPP
>gnl|hbvpro|EU939647_Pol_P-C Product feature CHAIN EU939647_Pol_P-C of FT:mat_peptide EU939647_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D90). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAGRKTAYSHLSTSKRQSSSGHAVELHNIPPSSAGSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHPPARVHFASPLHVAWRPP
>gnl|hbvpro|EU939648_Pol_P-C Product feature CHAIN EU939648_Pol_P-C of FT:mat_peptide EU939648_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D96). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939649_Pol_P-C Product feature CHAIN EU939649_Pol_P-C of FT:mat_peptide EU939649_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D98). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCTQPSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSKGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAVGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939651_Pol_P-C Product feature CHAIN EU939651_Pol_P-C of FT:mat_peptide EU939651_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D104). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFP
HIHLQEDIINRCEQYVGPLTVNEKRRLQLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFYGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGESGRN
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEHHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNNNYQHGTMQDLHD
SCSRDLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939652_Pol_P-C Product feature CHAIN EU939652_Pol_P-C of FT:mat_peptide EU939652_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D107). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939653_Pol_P-C Product feature CHAIN EU939653_Pol_P-C of FT:mat_peptide EU939653_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D109). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRN
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRETAYSHLTTSKRQSSSGHAVEFHNIPPSSARSQSEGPI
FSCWWLQFRNNKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939654_Pol_P-C Product feature CHAIN EU939654_Pol_P-C of FT:mat_peptide EU939654_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D115). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNLNGSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQPSGILSRSPVGPCIRSQLKQSRLGLQPQKGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939655_Pol_P-C Product feature CHAIN EU939655_Pol_P-C of FT:mat_peptide EU939655_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D116). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSDFQTSTRHGDKSFCSQPSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSSRPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939656_Pol_P-C Product feature CHAIN EU939656_Pol_P-C of FT:mat_peptide EU939656_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D117). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSDFQTSTRHGDKSFCSQPSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSSRPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939657_Pol_P-C Product feature CHAIN EU939657_Pol_P-C of FT:mat_peptide EU939657_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D139). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCPKSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSFRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINHQHGTMQDLHE
SCSRKLYFSLLLLYKTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEALFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSGGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939658_Pol_P-C Product feature CHAIN EU939658_Pol_P-C of FT:mat_peptide EU939658_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D142). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDQAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNLTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELNNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSKYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU939659_Pol_P-C Product feature CHAIN EU939659_Pol_P-C of FT:mat_peptide EU939659_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D165). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGTSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSADRKTAYSHLSTFKRQSSSGRAVDFHNIPPNSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ023639_Pol_P-C Product feature CHAIN FJ023639_Pol_P-C of FT:mat_peptide FJ023639_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-0968). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GXIRARVYSTTRQSFGVEPSGSRHXDNXASSASSCLHQSAVRKTAYSHLSTSERQSSSGHAVELQHIPPSSARSQSEGPI
FSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINNQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPXNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023640_Pol_P-C Product feature CHAIN FJ023640_Pol_P-C of FT:mat_peptide FJ023640_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1206). Non-functional genomic sequence. [Hepadnaviridae] (length=834 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVXSQFKQSRLGLQPQQGSMASGKPGRS
GXIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSAPCWWLQFR
NSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPKFAV
PNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRNLYVS
LLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTS
ITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLLGFAAPFTQC
GYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHTAE
LLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPYRPT
TGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023641_Pol_P-C Product feature CHAIN FJ023641_Pol_P-C of FT:mat_peptide FJ023641_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1237). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
DIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSQSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023642_Pol_P-C Product feature CHAIN FJ023642_Pol_P-C of FT:mat_peptide FJ023642_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1257). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDEPFCSQSSGILSQSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023643_Pol_P-C Product feature CHAIN FJ023643_Pol_P-C of FT:mat_peptide FJ023643_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1306). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMACSKPGRS
GILRARVHSTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTENGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023644_Pol_P-C Product feature CHAIN FJ023644_Pol_P-C of FT:mat_peptide FJ023644_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1318). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMACSKPGRS
GILRARVHSTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTENGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023645_Pol_P-C Product feature CHAIN FJ023645_Pol_P-C of FT:mat_peptide FJ023645_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0071). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPCFRSQFKQSRLGLQPQKGSMASGKPGRS
GIIRARVHSSTRQSFGVEPSGSGHIDNSASSASSCLHQSAVKKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNIKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPKTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGAFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023646_Pol_P-C Product feature CHAIN FJ023646_Pol_P-C of FT:mat_peptide FJ023646_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0201). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLSLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSXRHGDESXCSQSSGILSRSPVGPCIQSQFKQSRLGLQPQQGSMASGKPGRS
GILRARVHSTTRRSFGVEPSGSGHIDNITSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHRIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023647_Pol_P-C Product feature CHAIN FJ023647_Pol_P-C of FT:mat_peptide FJ023647_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0214). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSTRSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSRLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023648_Pol_P-C Product feature CHAIN FJ023648_Pol_P-C of FT:mat_peptide FJ023648_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0273). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVYSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHKVELQHIPPSSARSQSEGPI
HSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINXQHGTMQDLHX
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023649_Pol_P-C Product feature CHAIN FJ023649_Pol_P-C of FT:mat_peptide FJ023649_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0289). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPYRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023650_Pol_P-C Product feature CHAIN FJ023650_Pol_P-C of FT:mat_peptide FJ023650_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0341). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVCQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAHSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGLI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ023653_Pol_P-C Product feature CHAIN FJ023653_Pol_P-C of FT:mat_peptide FJ023653_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0909). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNETRRLKLIMPARFYPNCTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMAHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023654_Pol_P-C Product feature CHAIN FJ023654_Pol_P-C of FT:mat_peptide FJ023654_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1412). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIITRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSSRSQSEGPI
LSCWWLKFRDSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRTGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023656_Pol_P-C Product feature CHAIN FJ023656_Pol_P-C of FT:mat_peptide FJ023656_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0938). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPGVQSQFKQSRLGLQPQQGSMASSKPGRS
GIIRARVHSTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELQHIPPSSTRSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023657_Pol_P-C Product feature CHAIN FJ023657_Pol_P-C of FT:mat_peptide FJ023657_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0987). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ023658_Pol_P-C Product feature CHAIN FJ023658_Pol_P-C of FT:mat_peptide FJ023658_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-1116). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFYSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQRSMASSKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032331_Pol_P-C Product feature CHAIN FJ032331_Pol_P-C of FT:mat_peptide FJ032331_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S193-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNGKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHPESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVMKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032332_Pol_P-C Product feature CHAIN FJ032332_Pol_P-C of FT:mat_peptide FJ032332_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-10). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRRLSSGHAVKLHNIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSAQHLES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032333_Pol_P-C Product feature CHAIN FJ032333_Pol_P-C of FT:mat_peptide FJ032333_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359-7). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVDEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQPRLGLQPQQGSLARGKSGRSWSIRA
RVHPTTRRSFGVEPSGSGHIDNGASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFPCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHNSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLTPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPI
HTAELLAACLARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032334_Pol_P-C Product feature CHAIN FJ032334_Pol_P-C of FT:mat_peptide FJ032334_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S445-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRIINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHSRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGASFVYVPSALNPAGDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032336_Pol_P-C Product feature CHAIN FJ032336_Pol_P-C of FT:mat_peptide FJ032336_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWKTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRPVFQTSTRHGDKSCCSQSSGILSRSPVGPCVPSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARFHPTSRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKGQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDQHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPLLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032338_Pol_P-C Product feature CHAIN FJ032338_Pol_P-C of FT:mat_peptide FJ032338_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWKTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRPVFQTSTRHGDKSCCSQSSGILSRSPVGPCVPSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARFHPTSRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKGQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLTPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GLAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRVRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032339_Pol_P-C Product feature CHAIN FJ032339_Pol_P-C of FT:mat_peptide FJ032339_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFP
HLHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRPVFQTSTRHGDKSCCSQSSGILSRSPVGPCVPSQLKQSRLGLQPQQGSLARGMAGRS
GSIRARFHPTSRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKGQPSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032340_Pol_P-C Product feature CHAIN FJ032340_Pol_P-C of FT:mat_peptide FJ032340_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
RIHLQEDIINRCQQYVGPLTVNERRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVVQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHDTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRELHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGTHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGAFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ032341_Pol_P-C Product feature CHAIN FJ032341_Pol_P-C of FT:mat_peptide FJ032341_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
RIHLQEDIINRCQQYVGPLTVNERRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTGHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVVQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGAFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ032345_Pol_P-C Product feature CHAIN FJ032345_Pol_P-C of FT:mat_peptide FJ032345_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIANLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLFSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ032346_Pol_P-C Product feature CHAIN FJ032346_Pol_P-C of FT:mat_peptide FJ032346_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQPSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFE
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTSGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032350_Pol_P-C Product feature CHAIN FJ032350_Pol_P-C of FT:mat_peptide FJ032350_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-1). Complete genome. [Hepadnaviridae] (length=843 residues).
TPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVLLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTIQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSELNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032351_Pol_P-C Product feature CHAIN FJ032351_Pol_P-C of FT:mat_peptide FJ032351_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSELNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032355_Pol_P-C Product feature CHAIN FJ032355_Pol_P-C of FT:mat_peptide FJ032355_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-8). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFRSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLASGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHY
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032356_Pol_P-C Product feature CHAIN FJ032356_Pol_P-C of FT:mat_peptide FJ032356_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYPHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFRSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLASGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELPNIPPSSARPQSEGPT
LSCWWLRFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVADFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHY
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032359_Pol_P-C Product feature CHAIN FJ032359_Pol_P-C of FT:mat_peptide FJ032359_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLAKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032360_Pol_P-C Product feature CHAIN FJ032360_Pol_P-C of FT:mat_peptide FJ032360_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-2). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILSFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ032361_Pol_P-C Product feature CHAIN FJ032361_Pol_P-C of FT:mat_peptide FJ032361_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQPLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKLPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTPITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKRAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRLTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349225_Pol_P-C Product feature CHAIN FJ349225_Pol_P-C of FT:mat_peptide FJ349225_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H94). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRRSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSERPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386574_Pol_P-C Product feature CHAIN FJ386574_Pol_P-C of FT:mat_peptide FJ386574_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1743). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVVKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386575_Pol_P-C Product feature CHAIN FJ386575_Pol_P-C of FT:mat_peptide FJ386575_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1745). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGIFSRSPVGPGVRSQLKQSRLGLQPQQGPLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLAHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386576_Pol_P-C Product feature CHAIN FJ386576_Pol_P-C of FT:mat_peptide FJ386576_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1746). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLAGGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSANSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNLNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386577_Pol_P-C Product feature CHAIN FJ386577_Pol_P-C of FT:mat_peptide FJ386577_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1747). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDISASSTSSCLHQSAVRKTAYSHFSTSKRQSSSGHAVELNNIPPNSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYTLNFMGYRIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386579_Pol_P-C Product feature CHAIN FJ386579_Pol_P-C of FT:mat_peptide FJ386579_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1762). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386587_Pol_P-C Product feature CHAIN FJ386587_Pol_P-C of FT:mat_peptide FJ386587_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1812). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSSVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386588_Pol_P-C Product feature CHAIN FJ386588_Pol_P-C of FT:mat_peptide FJ386588_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1828). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSTSSCIHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPSKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYXNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386589_Pol_P-C Product feature CHAIN FJ386589_Pol_P-C of FT:mat_peptide FJ386589_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1830). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDISASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNFPPGSARSKSEGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKSPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRIINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
SPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ386591_Pol_P-C Product feature CHAIN FJ386591_Pol_P-C of FT:mat_peptide FJ386591_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1869). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQGLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386592_Pol_P-C Product feature CHAIN FJ386592_Pol_P-C of FT:mat_peptide FJ386592_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1870). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRFVFQTSTRHGDKSFCSQSSGILSRSPVGPSVRSQLKQSRLGLQPQQGSLARGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LTCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPXTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRXRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386595_Pol_P-C Product feature CHAIN FJ386595_Pol_P-C of FT:mat_peptide FJ386595_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1879). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIITRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQLGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GNIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVVKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386596_Pol_P-C Product feature CHAIN FJ386596_Pol_P-C of FT:mat_peptide FJ386596_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1887). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKECFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSWSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386597_Pol_P-C Product feature CHAIN FJ386597_Pol_P-C of FT:mat_peptide FJ386597_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1888). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVRPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSTRPQSEGPI
PSCWWLQFRNNKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAVGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386598_Pol_P-C Product feature CHAIN FJ386598_Pol_P-C of FT:mat_peptide FJ386598_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1889). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRWSFGVEPSXSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQXKQAFTFSPTYKAFLCKQYLNLYPVARQRSGICQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386601_Pol_P-C Product feature CHAIN FJ386601_Pol_P-C of FT:mat_peptide FJ386601_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1912). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
KIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSCRS
GSIRARVHPTTRRSFGGEPSCSGHIDNNANITSSCIYQSAGKKTDYSHLSTSNRQSSSGHPMELRNVPPSSARSPSEGLI
FSCWWLLLRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
YCSRNLYVSLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKVFLYKQYLNLYPVARQRSGLCQVFADATPTGWGLALGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386602_Pol_P-C Product feature CHAIN FJ386602_Pol_P-C of FT:mat_peptide FJ386602_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1914). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSVNSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGAFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYTIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386603_Pol_P-C Product feature CHAIN FJ386603_Pol_P-C of FT:mat_peptide FJ386603_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1949). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIWSRVHPTTRRSFGVEPSGSGHINNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPLSARSQSEGPI
FCCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386604_Pol_P-C Product feature CHAIN FJ386604_Pol_P-C of FT:mat_peptide FJ386604_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1950). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELPNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDMHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIIFGFRKIPMGVGLSPFLMVQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386605_Pol_P-C Product feature CHAIN FJ386605_Pol_P-C of FT:mat_peptide FJ386605_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1965). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHKSAVRKTAYSHLSTSKRESSSRHAVELHNIPPSSARSXSEGPI
FSCWWLQFRNXKPCSDYCLSHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEALFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386607_Pol_P-C Product feature CHAIN FJ386607_Pol_P-C of FT:mat_peptide FJ386607_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1967). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESVCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHTTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPGSARSQSEGPI
FSCWWLKFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGLGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFLGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386609_Pol_P-C Product feature CHAIN FJ386609_Pol_P-C of FT:mat_peptide FJ386609_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1999). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNIHYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386611_Pol_P-C Product feature CHAIN FJ386611_Pol_P-C of FT:mat_peptide FJ386611_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2018). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELYNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPGYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
HHLESLFTSVTNFLLSLGIHLNPSKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386612_Pol_P-C Product feature CHAIN FJ386612_Pol_P-C of FT:mat_peptide FJ386612_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2019). Complete genome. [Hepadnaviridae] (length=840 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQVFQTSTRHGDESICSQSSGILSRSPVGPGIRSQLKQSRLGLQPQQGSLAKGKSGRSGSI
RARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSEGPIPSC
WWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVS
WPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHDSCS
RNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHL
ESLFTSITNFLWSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFA
APFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPL
PIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLS
LPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386613_Pol_P-C Product feature CHAIN FJ386613_Pol_P-C of FT:mat_peptide FJ386613_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2039). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRVRVHPTTRRPFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARSKSEGPL
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRIINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386614_Pol_P-C Product feature CHAIN FJ386614_Pol_P-C of FT:mat_peptide FJ386614_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2040). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRQSFGVEPSGSGHTDNSASSTSSCLYQSAVRKTAYSHLSASKRQSSSGHAVELHNIPPSSARPQSEGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINDQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386617_Pol_P-C Product feature CHAIN FJ386617_Pol_P-C of FT:mat_peptide FJ386617_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2093). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWRTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDISGSSNSSCLHQSAVRETAYSHLSTSKRQXSXGHAVEFHNIPPSSARSKSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLTWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRIINNQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLVSLGIHLTPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ386618_Pol_P-C Product feature CHAIN FJ386618_Pol_P-C of FT:mat_peptide FJ386618_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2111). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386619_Pol_P-C Product feature CHAIN FJ386619_Pol_P-C of FT:mat_peptide FJ386619_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2119). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWKTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPILTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNCASSTSSCLHQSAVRKTAYSHISTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMHGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386620_Pol_P-C Product feature CHAIN FJ386620_Pol_P-C of FT:mat_peptide FJ386620_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2121). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRYFGVEPSGPGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNVPPSSARSKSEGPL
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINHQYGTLQDLHG
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386623_Pol_P-C Product feature CHAIN FJ386623_Pol_P-C of FT:mat_peptide FJ386623_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2165). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSANSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNFPPSSARSQSEGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSCGLSRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFGYVDDVVLGAKSV
QHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386624_Pol_P-C Product feature CHAIN FJ386624_Pol_P-C of FT:mat_peptide FJ386624_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2187). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLAGGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSAGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
KVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGICQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386625_Pol_P-C Product feature CHAIN FJ386625_Pol_P-C of FT:mat_peptide FJ386625_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2190). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSARHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLREDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFVAPFTQCGYPALMPLYAAIQAKQAFTFSPTYRAFLCKQYLDLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386626_Pol_P-C Product feature CHAIN FJ386626_Pol_P-C of FT:mat_peptide FJ386626_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2205). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDNAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTGYGDESFSSSSSGILSRSRLGPCVRSQLKQSRLGLQPQQGSLGRGRTSRS
GSIRARVHSTAEQSFGVEPSGSGDIDTSGSRPSSCLQKTSFRFSTYSNFSSSKRQSSQRHTLPLHAIPPSSARSLSCGWI
FSCWRIQFWNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLEALFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386627_Pol_P-C Product feature CHAIN FJ386627_Pol_P-C of FT:mat_peptide FJ386627_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2242). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPXDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386628_Pol_P-C Product feature CHAIN FJ386628_Pol_P-C of FT:mat_peptide FJ386628_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2255). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESVCSQSSGILSRSPVGPIVRSQLKQSRLGLQPQQGSLGRVKSSRS
GSIRARVHPTTQQSFGVEPSGSGHIDNTASCTSSCLHKSAFSNTSYSHLSTSKRHASAGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGFCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFQPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386630_Pol_P-C Product feature CHAIN FJ386630_Pol_P-C of FT:mat_peptide FJ386630_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2336). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HLHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRESSSGHAMEFHNIPPSSARPQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRSLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386631_Pol_P-C Product feature CHAIN FJ386631_Pol_P-C of FT:mat_peptide FJ386631_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2359). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFP
HIHLKEDIIHRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
GSIRARVHPTTRRSFGVEPSCSGHIDNSATSTSSCLHQSAVRETAYSHLSTSKRQSSSSHAMELHNIPPSFARSQSEGPI
SSCWWLQFRNNKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386632_Pol_P-C Product feature CHAIN FJ386632_Pol_P-C of FT:mat_peptide FJ386632_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2370). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GXIRARVHPTTRRSFGVEPSGSGHIDNSTSSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|FJ386637_Pol_P-C Product feature CHAIN FJ386637_Pol_P-C of FT:mat_peptide FJ386637_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2151). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKLGRS
GSIRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386638_Pol_P-C Product feature CHAIN FJ386638_Pol_P-C of FT:mat_peptide FJ386638_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2015). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSARHGDESFCSQPSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDHCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLTWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLTQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386639_Pol_P-C Product feature CHAIN FJ386639_Pol_P-C of FT:mat_peptide FJ386639_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1929). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHSVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSPSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHXRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386644_Pol_P-C Product feature CHAIN FJ386644_Pol_P-C of FT:mat_peptide FJ386644_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S737). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLREDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKLSRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRSGICQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386647_Pol_P-C Product feature CHAIN FJ386647_Pol_P-C of FT:mat_peptide FJ386647_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2400). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPAHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSXRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARSQSEGPI
XSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386650_Pol_P-C Product feature CHAIN FJ386650_Pol_P-C of FT:mat_peptide FJ386650_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2468). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPTTRQSFGVEPSGSGHTDNSASNTSSCLRQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGSIPSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLTQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFSFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386651_Pol_P-C Product feature CHAIN FJ386651_Pol_P-C of FT:mat_peptide FJ386651_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2476). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHERLDFKTSTRHGDQAFCSQSSGIHCRSPLGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
ESIAPGVHPTTRWSFGAEPSSSRHIDNTASITSSCLHQSPLGMTGYSHLSTSNIQSPSGHALELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSVRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRAGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWXPP
>gnl|hbvpro|FJ386652_Pol_P-C Product feature CHAIN FJ386652_Pol_P-C of FT:mat_peptide FJ386652_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2518). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLTTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNNKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHN
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386653_Pol_P-C Product feature CHAIN FJ386653_Pol_P-C of FT:mat_peptide FJ386653_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLYTAITNFLVSLGIHLNPNKTKRWGYSLNFMGYVFGCWGSLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386657_Pol_P-C Product feature CHAIN FJ386657_Pol_P-C of FT:mat_peptide FJ386657_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S165). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSTGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARIHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSTTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386659_Pol_P-C Product feature CHAIN FJ386659_Pol_P-C of FT:mat_peptide FJ386659_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S219). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVEFHNIPPSSARPPSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386661_Pol_P-C Product feature CHAIN FJ386661_Pol_P-C of FT:mat_peptide FJ386661_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S251). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPRVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCLHQSAVRKTAYAHLSTSKRQSSSGHAVELHHIPPSSARPQSQGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYNHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ386662_Pol_P-C Product feature CHAIN FJ386662_Pol_P-C of FT:mat_peptide FJ386662_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S269). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKSYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386663_Pol_P-C Product feature CHAIN FJ386663_Pol_P-C of FT:mat_peptide FJ386663_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S307). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASCKSGRS
GIIRAGVHSTTRQSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVKLHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSXYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386664_Pol_P-C Product feature CHAIN FJ386664_Pol_P-C of FT:mat_peptide FJ386664_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S310). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLQQSRLGLQPQQGSLARSQSGRS
GSIRARVHPATRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHKFPPSSARSQSEGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGAFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386665_Pol_P-C Product feature CHAIN FJ386665_Pol_P-C of FT:mat_peptide FJ386665_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHKTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQPRLGLQPQQGSLARGKSGRSWSIRA
RVHPTTRRSFGVEPSGSGHIDNGASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFPCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHNSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLTPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386670_Pol_P-C Product feature CHAIN FJ386670_Pol_P-C of FT:mat_peptide FJ386670_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S454). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHFSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386671_Pol_P-C Product feature CHAIN FJ386671_Pol_P-C of FT:mat_peptide FJ386671_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S586). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAXGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386672_Pol_P-C Product feature CHAIN FJ386672_Pol_P-C of FT:mat_peptide FJ386672_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S606). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSRNIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386673_Pol_P-C Product feature CHAIN FJ386673_Pol_P-C of FT:mat_peptide FJ386673_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S633). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASITSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVXLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNIDYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386678_Pol_P-C Product feature CHAIN FJ386678_Pol_P-C of FT:mat_peptide FJ386678_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1147). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLPLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386679_Pol_P-C Product feature CHAIN FJ386679_Pol_P-C of FT:mat_peptide FJ386679_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1217). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRFVFQTSTRHGDESFCSQPSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386685_Pol_P-C Product feature CHAIN FJ386685_Pol_P-C of FT:mat_peptide FJ386685_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1568). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSSGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARSQSEGSI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSRQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386687_Pol_P-C Product feature CHAIN FJ386687_Pol_P-C of FT:mat_peptide FJ386687_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1600). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLFFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKECFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFV
APLPIHTAELLAACFARSWSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ386689_Pol_P-C Product feature CHAIN FJ386689_Pol_P-C of FT:mat_peptide FJ386689_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1649). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPEWKTPTFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
RSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNFPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQYGTLQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKNV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ518813_Pol_P-C Product feature CHAIN FJ518813_Pol_P-C of FT:mat_peptide FJ518813_Pol_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIHRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVGKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLVSLGIHLTPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATVIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562218_Pol_P-C Product feature CHAIN FJ562218_Pol_P-C of FT:mat_peptide FJ562218_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPL
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562221_Pol_P-C Product feature CHAIN FJ562221_Pol_P-C of FT:mat_peptide FJ562221_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I13). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQNKQAFTFSSTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHPPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562225_Pol_P-C Product feature CHAIN FJ562225_Pol_P-C of FT:mat_peptide FJ562225_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I19). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFHTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562228_Pol_P-C Product feature CHAIN FJ562228_Pol_P-C of FT:mat_peptide FJ562228_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I33). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVLQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSPSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562230_Pol_P-C Product feature CHAIN FJ562230_Pol_P-C of FT:mat_peptide FJ562230_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I38). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINHQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIILKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562232_Pol_P-C Product feature CHAIN FJ562232_Pol_P-C of FT:mat_peptide FJ562232_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I45). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCIHQSADRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPSKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562233_Pol_P-C Product feature CHAIN FJ562233_Pol_P-C of FT:mat_peptide FJ562233_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I48). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKAFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562235_Pol_P-C Product feature CHAIN FJ562235_Pol_P-C of FT:mat_peptide FJ562235_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I50). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGVHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSSLNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562238_Pol_P-C Product feature CHAIN FJ562238_Pol_P-C of FT:mat_peptide FJ562238_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I62). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHWTMQDLHD
TCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSAMNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562239_Pol_P-C Product feature CHAIN FJ562239_Pol_P-C of FT:mat_peptide FJ562239_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I64). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPQWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVRPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLQRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562241_Pol_P-C Product feature CHAIN FJ562241_Pol_P-C of FT:mat_peptide FJ562241_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I67). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHSPTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSERQSSSGHAVELHNLPPNSARSQGERPV
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYHHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHHRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562242_Pol_P-C Product feature CHAIN FJ562242_Pol_P-C of FT:mat_peptide FJ562242_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I68). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLRQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562243_Pol_P-C Product feature CHAIN FJ562243_Pol_P-C of FT:mat_peptide FJ562243_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I71). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVIQTSTRHGDESFCSQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWKPP
>gnl|hbvpro|FJ562244_Pol_P-C Product feature CHAIN FJ562244_Pol_P-C of FT:mat_peptide FJ562244_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I72). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562245_Pol_P-C Product feature CHAIN FJ562245_Pol_P-C of FT:mat_peptide FJ562245_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I73). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRAPVGPCVRSQLKQSSLGLLSQQGSMASCKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELNNIPPSSARSQSEGPI
SSCWWLRFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGNMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDIVLGAKSV
QHLEALFTSITNFLFSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562248_Pol_P-C Product feature CHAIN FJ562248_Pol_P-C of FT:mat_peptide FJ562248_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I76). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPLFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGNT
GKIRARVHPTARRSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562249_Pol_P-C Product feature CHAIN FJ562249_Pol_P-C of FT:mat_peptide FJ562249_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I79). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKPFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRIRVHPTTRRSFGVEPSGSGHNDNSASSTSSCLHQSAVRKTAYSHLSTSKRKSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562250_Pol_P-C Product feature CHAIN FJ562250_Pol_P-C of FT:mat_peptide FJ562250_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I83). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSSVGPCIRSQLKQSRLGLQPQQGSLAKSQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTTKRQSSSGHAVELHNFPPSSARSQSKGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLDSLFTAVTNFLLSLGIHLNPNKTKRWGYNLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAVGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562251_Pol_P-C Product feature CHAIN FJ562251_Pol_P-C of FT:mat_peptide FJ562251_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I84). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGLAVELHNIPPSSSRPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYKHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHERVRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562252_Pol_P-C Product feature CHAIN FJ562252_Pol_P-C of FT:mat_peptide FJ562252_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I85). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562255_Pol_P-C Product feature CHAIN FJ562255_Pol_P-C of FT:mat_peptide FJ562255_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I92). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCFRSQLKQSRLGLQPQQGSLARSKSGRS
GSIRARVHPTTRRSFGVEPSGSGHFDTSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNLPPSPARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLYTQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562256_Pol_P-C Product feature CHAIN FJ562256_Pol_P-C of FT:mat_peptide FJ562256_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I95). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGRLVFQTSERHGDESFRSKSAGILSRSPVGPGIRSQLKQSRLGLQPQQGSLARSKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELYNFPPSSARSQSKGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QESWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQDMHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIILKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562258_Pol_P-C Product feature CHAIN FJ562258_Pol_P-C of FT:mat_peptide FJ562258_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I97). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRTRVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRIINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLALGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562264_Pol_P-C Product feature CHAIN FJ562264_Pol_P-C of FT:mat_peptide FJ562264_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I114). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSADRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCSEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQTKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562265_Pol_P-C Product feature CHAIN FJ562265_Pol_P-C of FT:mat_peptide FJ562265_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I116). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNNASSTSSCLRQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSTRPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLVLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPXRVHFASPLHVAWXPP
>gnl|hbvpro|FJ562266_Pol_P-C Product feature CHAIN FJ562266_Pol_P-C of FT:mat_peptide FJ562266_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I118). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTARRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSSRPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYHHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562268_Pol_P-C Product feature CHAIN FJ562268_Pol_P-C of FT:mat_peptide FJ562268_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I121). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNFPQSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFQKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPPTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562269_Pol_P-C Product feature CHAIN FJ562269_Pol_P-C of FT:mat_peptide FJ562269_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I122). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSANSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVCAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYQALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562272_Pol_P-C Product feature CHAIN FJ562272_Pol_P-C of FT:mat_peptide FJ562272_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I125). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGESGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELHNIPPSSARPQSEGPL
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRIINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFM
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562273_Pol_P-C Product feature CHAIN FJ562273_Pol_P-C of FT:mat_peptide FJ562273_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I127). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTRYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSKRHGDKSFCSQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSTRPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPXNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNIHYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKRCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562274_Pol_P-C Product feature CHAIN FJ562274_Pol_P-C of FT:mat_peptide FJ562274_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I128). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCTQSSGILSRSPVGPCLRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGSI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562275_Pol_P-C Product feature CHAIN FJ562275_Pol_P-C of FT:mat_peptide FJ562275_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I129). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSACLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562276_Pol_P-C Product feature CHAIN FJ562276_Pol_P-C of FT:mat_peptide FJ562276_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I130). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSACLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLXHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLVSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQYGTMQDLHS
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVARRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFM
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562279_Pol_P-C Product feature CHAIN FJ562279_Pol_P-C of FT:mat_peptide FJ562279_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I140). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVLQTSTRHGDKSFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGRIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562280_Pol_P-C Product feature CHAIN FJ562280_Pol_P-C of FT:mat_peptide FJ562280_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I141). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHRTLQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562281_Pol_P-C Product feature CHAIN FJ562281_Pol_P-C of FT:mat_peptide FJ562281_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I143). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRIINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|FJ562282_Pol_P-C Product feature CHAIN FJ562282_Pol_P-C of FT:mat_peptide FJ562282_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I144). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPDNAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562283_Pol_P-C Product feature CHAIN FJ562283_Pol_P-C of FT:mat_peptide FJ562283_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I145). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562284_Pol_P-C Product feature CHAIN FJ562284_Pol_P-C of FT:mat_peptide FJ562284_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I146). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSARHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQKGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYQNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562285_Pol_P-C Product feature CHAIN FJ562285_Pol_P-C of FT:mat_peptide FJ562285_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I147). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSERQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLRFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562288_Pol_P-C Product feature CHAIN FJ562288_Pol_P-C of FT:mat_peptide FJ562288_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I153). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
KIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHFSTSKRQSSSGHAVELHNIPPSSARSQSEGLI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGALPQEHIVLKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCNQYLNLYPVARQRSGLCQVFADATPTGWGLALGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562291_Pol_P-C Product feature CHAIN FJ562291_Pol_P-C of FT:mat_peptide FJ562291_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I163). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGPLARGQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPL
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPGYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRVRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562292_Pol_P-C Product feature CHAIN FJ562292_Pol_P-C of FT:mat_peptide FJ562292_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I164). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMEPHHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPSTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDISAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYNHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ562293_Pol_P-C Product feature CHAIN FJ562293_Pol_P-C of FT:mat_peptide FJ562293_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I167). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSIGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRKSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSRLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562298_Pol_P-C Product feature CHAIN FJ562298_Pol_P-C of FT:mat_peptide FJ562298_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I174). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFHTSKRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRTRVHPTTRRSFGVEPSDSGHTDNSASSASSCHHQSAVRKTAYSHLSTSKRQSSSGHAVELHNVPPSSARSQSEGPV
FSCWWLQFRNSKPCSDYCLSHLVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFM
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562299_Pol_P-C Product feature CHAIN FJ562299_Pol_P-C of FT:mat_peptide FJ562299_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I175). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKKAYSHLSTSKRQSSSGHAVELHNIPPSSDTCRSEGSI
FSCWWLHFRNSKTCSHYCHSHIGNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRIINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562300_Pol_P-C Product feature CHAIN FJ562300_Pol_P-C of FT:mat_peptide FJ562300_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I182). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLREDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFGSQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLASGKSGRS
GSIRARVHSTPRQSFGVEPAGSGHIDYSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGYAVELHNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCSEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNFNYQHGTMQDLHD
TCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKPCFRKLPVNSPIDWKVCQRIVCLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLALGHKRLRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVYRP
LLCLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562301_Pol_P-C Product feature CHAIN FJ562301_Pol_P-C of FT:mat_peptide FJ562301_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I185). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTMHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHINPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562304_Pol_P-C Product feature CHAIN FJ562304_Pol_P-C of FT:mat_peptide FJ562304_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I190). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQRFRKLLLLDGEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHDIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKIEQCFRKLAVNRPIEWKVCQRMGGLW
AFYAAFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562306_Pol_P-C Product feature CHAIN FJ562306_Pol_P-C of FT:mat_peptide FJ562306_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I196). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRIINYQHGTMQDMHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLTLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562307_Pol_P-C Product feature CHAIN FJ562307_Pol_P-C of FT:mat_peptide FJ562307_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I197). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFWGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSAGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPGSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562308_Pol_P-C Product feature CHAIN FJ562308_Pol_P-C of FT:mat_peptide FJ562308_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I199). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562310_Pol_P-C Product feature CHAIN FJ562310_Pol_P-C of FT:mat_peptide FJ562310_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I201). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDAQAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMASCKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSVRSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVFWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562313_Pol_P-C Product feature CHAIN FJ562313_Pol_P-C of FT:mat_peptide FJ562313_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I204). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPGIRSQFKQSRLGLQPQQGSMASCKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQXSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562315_Pol_P-C Product feature CHAIN FJ562315_Pol_P-C of FT:mat_peptide FJ562315_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I207). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMSGTFV
APLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562318_Pol_P-C Product feature CHAIN FJ562318_Pol_P-C of FT:mat_peptide FJ562318_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I211). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLAGGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHFSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNLNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPMDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562319_Pol_P-C Product feature CHAIN FJ562319_Pol_P-C of FT:mat_peptide FJ562319_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I212). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHEXLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASGASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQNIPPSSARSQSEGPI
FPCWWLQFRNSEPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGAMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVMKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLYLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ562320_Pol_P-C Product feature CHAIN FJ562320_Pol_P-C of FT:mat_peptide FJ562320_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I213). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLREDIVNRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGTSGRS
GCIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELHNIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562323_Pol_P-C Product feature CHAIN FJ562323_Pol_P-C of FT:mat_peptide FJ562323_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I217). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPAHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARSKSGRS
GIIRARVHPTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNFPPSSARSQSEGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGVHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCNQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562324_Pol_P-C Product feature CHAIN FJ562324_Pol_P-C of FT:mat_peptide FJ562324_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I219). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIISRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLATGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFQKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|FJ562325_Pol_P-C Product feature CHAIN FJ562325_Pol_P-C of FT:mat_peptide FJ562325_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I223). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHILWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESVCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562327_Pol_P-C Product feature CHAIN FJ562327_Pol_P-C of FT:mat_peptide FJ562327_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I228). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYHHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSERQSSSGHAVELHNIPPSSARSQSEGPI
LPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIIVKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562329_Pol_P-C Product feature CHAIN FJ562329_Pol_P-C of FT:mat_peptide FJ562329_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I230). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562330_Pol_P-C Product feature CHAIN FJ562330_Pol_P-C of FT:mat_peptide FJ562330_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I231). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSFARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPGYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWXPP
>gnl|hbvpro|FJ562332_Pol_P-C Product feature CHAIN FJ562332_Pol_P-C of FT:mat_peptide FJ562332_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I42). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVWKTAYSRLSTSKRQSSAGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|FJ562333_Pol_P-C Product feature CHAIN FJ562333_Pol_P-C of FT:mat_peptide FJ562333_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I78). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFKTSTRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSPARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKHCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562334_Pol_P-C Product feature CHAIN FJ562334_Pol_P-C of FT:mat_peptide FJ562334_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I82). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
KIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLYQSAVRKTAYSHLSTSKRQSSSGHPVELHNVPPSSARSPSEGLI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDESAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHE
YCSRKLYVSLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKVFLYKQYLNLYPVARQRSGLCQVFADATPTGWGLALGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ562335_Pol_P-C Product feature CHAIN FJ562335_Pol_P-C of FT:mat_peptide FJ562335_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I108). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQALTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIIVKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562337_Pol_P-C Product feature CHAIN FJ562337_Pol_P-C of FT:mat_peptide FJ562337_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I173). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVDHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSMASCKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPXTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787437_Pol_P-C Product feature CHAIN FJ787437_Pol_P-C of FT:mat_peptide FJ787437_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S129-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLSRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELQHGRSVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELPNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDMHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIIFGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPDKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787439_Pol_P-C Product feature CHAIN FJ787439_Pol_P-C of FT:mat_peptide FJ787439_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLITPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRPFGVEPSGSRHIDNSASNTSTCLHQSAVRKTAYSHLSTSKRQSSSGHTVELYNIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSPGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPDKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTERTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ787441_Pol_P-C Product feature CHAIN FJ787441_Pol_P-C of FT:mat_peptide FJ787441_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRPFGVEPSGSRHIDNSARNTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELYNIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLTHTVNLLEDWGPCTEHGEHNIRIPRTPARATGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLTQFTSAICSVVHRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPDKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTPFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRASLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ787442_Pol_P-C Product feature CHAIN FJ787442_Pol_P-C of FT:mat_peptide FJ787442_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSPCIHQSAVRETAYSHISTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFLSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPSKTKRWGYSLNFMGYVIGSWGTLPQEHIVRKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787443_Pol_P-C Product feature CHAIN FJ787443_Pol_P-C of FT:mat_peptide FJ787443_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S171-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCIHQSAVRETAYSHISTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRHVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTYGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFLSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPSKTKRWGYSLNFMGYVIGSWGTLPQEHIVRNIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787445_Pol_P-C Product feature CHAIN FJ787445_Pol_P-C of FT:mat_peptide FJ787445_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S425-2). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSFRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQPLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPNRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787448_Pol_P-C Product feature CHAIN FJ787448_Pol_P-C of FT:mat_peptide FJ787448_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S461-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDAAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMAGGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPRSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSASRNINYQHGTMQDLHD
SCSRNLYVSLLLPYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLWSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787449_Pol_P-C Product feature CHAIN FJ787449_Pol_P-C of FT:mat_peptide FJ787449_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S567-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHRSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPL
FSCWWLQFRNNKPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAASYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSAVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLWSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFA
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787450_Pol_P-C Product feature CHAIN FJ787450_Pol_P-C of FT:mat_peptide FJ787450_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S627-2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=841 residues).
LSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFAGLYSSTVPIFNPEWQTPSFPHI
HLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPVDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGTLYKRET
TRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRSGS
IRARVHPATRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNFPPSSTRSQSEGPLLS
CWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGDHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHV
SWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSPGLSRYVARLSSTSRNINYQHGAMQDLHDSC
SRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQH
LESLFTAVTNFLLSLGVHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGF
AAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRLRGTFVAP
LPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLL
RLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787451_Pol_P-C Product feature CHAIN FJ787451_Pol_P-C of FT:mat_peptide FJ787451_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S627-3). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPATRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNFPPSSTRSQSEGPL
PSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGDHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGQKLHLYSHPIILGFRKIPMGVGLSPFLLTQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKLYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRLRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787452_Pol_P-C Product feature CHAIN FJ787452_Pol_P-C of FT:mat_peptide FJ787452_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S955-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRSVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGSIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNLNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFLGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHCRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787453_Pol_P-C Product feature CHAIN FJ787453_Pol_P-C of FT:mat_peptide FJ787453_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFLGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787454_Pol_P-C Product feature CHAIN FJ787454_Pol_P-C of FT:mat_peptide FJ787454_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1049-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSKGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFPQFSRGST
HVSWPKFAVPDLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFLGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787455_Pol_P-C Product feature CHAIN FJ787455_Pol_P-C of FT:mat_peptide FJ787455_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTMHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDKSFCAQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTEPRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFSFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAVGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVHVPSALNPADDPSRGRLGLYRP
LLHLPFRPATGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787456_Pol_P-C Product feature CHAIN FJ787456_Pol_P-C of FT:mat_peptide FJ787456_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1092-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTMHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFSFSPTYKAFLCKQYLNLYPVARQRSGLCQVSADATPTGWGLAMGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGCTSLYAVSPSVPSHLPDRVHFASPLRVAWRPP
>gnl|hbvpro|FJ787457_Pol_P-C Product feature CHAIN FJ787457_Pol_P-C of FT:mat_peptide FJ787457_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNFNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVIQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIGNSASSTSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSEPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWKPP
>gnl|hbvpro|FJ787458_Pol_P-C Product feature CHAIN FJ787458_Pol_P-C of FT:mat_peptide FJ787458_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1248-9). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVIQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRQSFGVELSGSGHIGNSASSTSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSEPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ787462_Pol_P-C Product feature CHAIN FJ787462_Pol_P-C of FT:mat_peptide FJ787462_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1357-3). Complete genome. [Hepadnaviridae] (length=837 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPFFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRAR
VHPTTRRSFGVEPSGSGHIDNSASCTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPILSCWWL
QFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWPK
FAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRDL
YVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLTQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESL
FTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPF
TQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPIH
TAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLPF
RPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787464_Pol_P-C Product feature CHAIN FJ787464_Pol_P-C of FT:mat_peptide FJ787464_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCPQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFLGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCRRIVGLL
GFAAPFTQCGYPALMPLYACIQTKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADTTPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ787466_Pol_P-C Product feature CHAIN FJ787466_Pol_P-C of FT:mat_peptide FJ787466_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-11). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSHSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRVPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRSLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSATCSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFLGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQTKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ787467_Pol_P-C Product feature CHAIN FJ787467_Pol_P-C of FT:mat_peptide FJ787467_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1371-16). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDTINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQRGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSHSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYNTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFLGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQTKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ787468_Pol_P-C Product feature CHAIN FJ787468_Pol_P-C of FT:mat_peptide FJ787468_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGGT
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787469_Pol_P-C Product feature CHAIN FJ787469_Pol_P-C of FT:mat_peptide FJ787469_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1426-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPCLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDHVHFASPLHVAWRPP
>gnl|hbvpro|FJ787470_Pol_P-C Product feature CHAIN FJ787470_Pol_P-C of FT:mat_peptide FJ787470_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-4). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNINVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPIGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLDDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVPAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQITSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIRLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWVLRGTSFIYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787471_Pol_P-C Product feature CHAIN FJ787471_Pol_P-C of FT:mat_peptide FJ787471_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1538-6). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNINVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRFFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPRSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787474_Pol_P-C Product feature CHAIN FJ787474_Pol_P-C of FT:mat_peptide FJ787474_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1732-6). Partial genome (Contains: HBx, Pol, HBSP). [Hepadnaviridae] (length=841 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHRRLVTSTRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGLQPQQGSLARGKSGRSGS
IRARVHPTTRRSFGVEPSGSGHIDNGASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFS
CWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTRV
SWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSC
SRNLYVSLLLLYKTFGRKLHLYSHPIIPGFRKIPMGVGLSPFLLTQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSVQH
LESLFASITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKHCFRKLPVNRPIDWKVCQRIVGLLGF
AAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAP
LPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLL
RLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ787479_Pol_P-C Product feature CHAIN FJ787479_Pol_P-C of FT:mat_peptide FJ787479_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S157-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFAGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRPFGVEPSGSRHIDNSASNTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELYNIPPSSARSQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPDKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ787486_Pol_P-C Product feature CHAIN FJ787486_Pol_P-C of FT:mat_peptide FJ787486_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2235-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNERRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNGASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYNHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ899761_Pol_P-C Product feature CHAIN FJ899761_Pol_P-C of FT:mat_peptide FJ899761_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHDIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899763_Pol_P-C Product feature CHAIN FJ899763_Pol_P-C of FT:mat_peptide FJ899763_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-4). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIINLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKLKRCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHQPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899764_Pol_P-C Product feature CHAIN FJ899764_Pol_P-C of FT:mat_peptide FJ899764_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899765_Pol_P-C Product feature CHAIN FJ899765_Pol_P-C of FT:mat_peptide FJ899765_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9-13). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWAHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLPGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRMHFASPLHVAWRPP
>gnl|hbvpro|FJ899767_Pol_P-C Product feature CHAIN FJ899767_Pol_P-C of FT:mat_peptide FJ899767_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26-2). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLRLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFGSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARGHPATRRSFGVEPSGSGHIDHSASSTSSCLHQSAVRETAYSHLSTSERQSSSGHTVELHNIPPSSARSQSQRPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKECFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADVTPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ899769_Pol_P-C Product feature CHAIN FJ899769_Pol_P-C of FT:mat_peptide FJ899769_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLQLVMPARFYPNLTKYLPLGKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
RSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQLAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDNCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLGSLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|FJ899770_Pol_P-C Product feature CHAIN FJ899770_Pol_P-C of FT:mat_peptide FJ899770_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-4). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLQLVMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILPRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
RSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGRAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNT
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899771_Pol_P-C Product feature CHAIN FJ899771_Pol_P-C of FT:mat_peptide FJ899771_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLQLVMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
RSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTDLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRSFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPLTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899772_Pol_P-C Product feature CHAIN FJ899772_Pol_P-C of FT:mat_peptide FJ899772_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C113-3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=843 residues).
MPLSYQDLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
RIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHRRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCIHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSERPI
LSCWWLQFRNSKPCSDYCLAHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPGYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKAFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMHGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899773_Pol_P-C Product feature CHAIN FJ899773_Pol_P-C of FT:mat_peptide FJ899773_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C113-6). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=842 residues).
PLSYQHFRKLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPR
IHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVHHYFKTRHYLHTLWKAGILYKRE
TTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLATGKSGRSG
SIRARVHPTTRRSFGVEPSGSGHIGNSASSTSSCIHQSAVGKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPIL
SCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHDS
CSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDEVLGAKSVQ
HLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHRRMHGTFVA
PLPIHTAELLAACLARSQSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899774_Pol_P-C Product feature CHAIN FJ899774_Pol_P-C of FT:mat_peptide FJ899774_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-5). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQKDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVWSQLKQSRLGPQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSANSTSSCLHQSAVRKTAYSHLSTSKRHSSSGHTVELHNIPPSSARSQSEGPI
FSCWWLQFRDSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWPSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRKLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GSAAPFTQCGYPALMPLYACMQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ899775_Pol_P-C Product feature CHAIN FJ899775_Pol_P-C of FT:mat_peptide FJ899775_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120-6). Complete genome. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHNIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIINLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIIQKLKRCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHQPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899776_Pol_P-C Product feature CHAIN FJ899776_Pol_P-C of FT:mat_peptide FJ899776_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C122-7). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNERRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNGASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYNHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ899777_Pol_P-C Product feature CHAIN FJ899777_Pol_P-C of FT:mat_peptide FJ899777_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127-10). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
YIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGQSGRS
RSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
PSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQNLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWKPP
>gnl|hbvpro|FJ899783_Pol_P-C Product feature CHAIN FJ899783_Pol_P-C of FT:mat_peptide FJ899783_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207-1). Complete genome. [Hepadnaviridae] (length=842 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQTRHYLHTLWKAGILYKR
ETSRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSRHNDNSASTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSTRSQSEGPIF
SCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTR
VSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHDS
CSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGARSVQ
HLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLG
FAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVA
PLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPL
LRLPFRPTTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899788_Pol_P-C Product feature CHAIN FJ899788_Pol_P-C of FT:mat_peptide FJ899788_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-1). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRFVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSPNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWQLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPSRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899789_Pol_P-C Product feature CHAIN FJ899789_Pol_P-C of FT:mat_peptide FJ899789_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRFVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGQELHLYSHPIILGFRKIPMGLGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ184326_Pol_P-C Product feature CHAIN GQ184326_Pol_P-C of FT:mat_peptide GQ184326_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ZADGM501). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDEPFCSQSSGILSRSPVGPSVRSQFKQSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGRIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAMELQHIPPSSARSQSEGPI
LSCWWLKFRDSKPCSDYCLSHIVNLLEDWGPCTEYGEHYIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSCQNFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ227692_Pol_P-C Product feature CHAIN GQ227692_Pol_P-C of FT:mat_peptide GQ227692_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z3-1). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLSLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSIRHGDESFCSQSSGILSRSPVEPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPITRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFGYVDDVVLGAKSVQHLES
LYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLRHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ227693_Pol_P-C Product feature CHAIN GQ227693_Pol_P-C of FT:mat_peptide GQ227693_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-1). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGSLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSIRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPITRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRTGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ227694_Pol_P-C Product feature CHAIN GQ227694_Pol_P-C of FT:mat_peptide GQ227694_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-2). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSIRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPITRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWEVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ227695_Pol_P-C Product feature CHAIN GQ227695_Pol_P-C of FT:mat_peptide GQ227695_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-5). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGPPYSWEQELQHQTSIRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPITRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRTGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ227696_Pol_P-C Product feature CHAIN GQ227696_Pol_P-C of FT:mat_peptide GQ227696_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-6). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHQTSIRHEDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPITRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLES
LFTSITNFLLSLGIRLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRTGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ227697_Pol_P-C Product feature CHAIN GQ227697_Pol_P-C of FT:mat_peptide GQ227697_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z3-2). Non-functional genomic sequence. [Hepadnaviridae] (length=838 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
GTTRSASFCGSPYSWEQELQHQTSIRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRSGSIRA
RVHPITRRSFGVEPSGSGHIDNSASSTSSCLHQSAGRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPIFSCWW
LQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHVSWP
KFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHDSCSRN
LYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFGYVDDVVLGAKSVQHLES
LYTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAP
FTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPI
HTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLHLP
FRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ259588_Pol_P-C Product feature CHAIN GQ259588_Pol_P-C of FT:mat_peptide GQ259588_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z31-22). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPITRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSCGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPHKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358153_Pol_P-C Product feature CHAIN GQ358153_Pol_P-C of FT:mat_peptide GQ358153_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIHB006). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLDFQTSTRHGDQPFCSQSSGILSRSPVGPSVRSQFKRSRLGLQPQQGSMASGKPGRS
GIIRARVHSTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAHSHLSTSKRQSSSGHAVELQHIPPISARSQSEGPI
LSCWWLKFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPGRVTGGVFLVDKNPHNPPESRLMVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPTNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFAFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358154_Pol_P-C Product feature CHAIN GQ358154_Pol_P-C of FT:mat_peptide GQ358154_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SLK126). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQEYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASGKSGRS
GILRARVHSTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELQHIPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHRTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPLNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLALGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTAFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358157_Pol_P-C Product feature CHAIN GQ358157_Pol_P-C of FT:mat_peptide GQ358157_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M007). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
DIHLREDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEQVVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELQHGRLVLQTSEGHGDESVCTQSSGIFSRSPVGPCLRSQLKQSRLGLQPQQGSLAKSTSGRN
RIIRARVHPTTRRSVGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSSSKGSL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVCRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQDKQAFTFSPTYKPFLCKQYLNLYPVARHRSGLCQVFADATPTGWGLAIGHQRMRGTFG
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPPTGRTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ358158_Pol_C-C Product feature CHAIN GQ358158_Pol_C-C of FT:mat_peptide GQ358158_Pol_C-C of [Viruses] Hepatitis B Virus genotype C (isolate M154). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVADDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTTKRHGDESLGSKSSGILSRSPVGPCIRSQLKQSRLGLQSQQGSLARSQSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCRHQSAVRKTAYSYLSTSKRQSSSGHAVELHNIPPSSARSSSKGPL
FSCWWLQFRNSKPCSDYCLSHIVNLLEEWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSASRNINYQHGTMQDLHD
SCSRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITTFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLRTQYLNLYPVARQRSGLCQVFADATPTGWGLAMGHQRMRGTFL
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLARKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ372968_Pol_P-C Product feature CHAIN GQ372968_Pol_P-C of FT:mat_peptide GQ372968_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6380-3). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQGLQHGRSVFQTSTRHGDESFRSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLAGGKSGRS
GSIRARVHPTTRQSFGVEPPGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAAELHNIPPSSARSQSAGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
KVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTSITNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGICQVFADATPTDWGLAIGHQRMRGTFV
APLPIHTAELLAACFAHSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377514_Pol_P-C Product feature CHAIN GQ377514_Pol_P-C of FT:mat_peptide GQ377514_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J8). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPDNAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHVRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKAAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|GQ377515_Pol_P-C Product feature CHAIN GQ377515_Pol_P-C of FT:mat_peptide GQ377515_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J9). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGSCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377517_Pol_P-C Product feature CHAIN GQ377517_Pol_P-C of FT:mat_peptide GQ377517_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J12). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTLPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377518_Pol_P-C Product feature CHAIN GQ377518_Pol_P-C of FT:mat_peptide GQ377518_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J14). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQSQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKGQSSSGHAVEFHNFPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTXESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLXTQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHXRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHXPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377521_Pol_P-C Product feature CHAIN GQ377521_Pol_P-C of FT:mat_peptide GQ377521_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J19). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSLRARVHPATRRSFGVEPSGSGPINNCASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAVGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377523_Pol_P-C Product feature CHAIN GQ377523_Pol_P-C of FT:mat_peptide GQ377523_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J21). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLKEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYXNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377524_Pol_P-C Product feature CHAIN GQ377524_Pol_P-C of FT:mat_peptide GQ377524_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J23). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHTVELHKIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSIVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKRAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377526_Pol_P-C Product feature CHAIN GQ377526_Pol_P-C of FT:mat_peptide GQ377526_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J27). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRI
GSIRARVHPTTRRSFGVEPSGSGHIDNGACSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHHIPPSSTRPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCSEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
QVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYKHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALKPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVTRQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSAMNPADDPSRGRLGLYRP
LLQLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377527_Pol_P-C Product feature CHAIN GQ377527_Pol_P-C of FT:mat_peptide GQ377527_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J28). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNISPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377528_Pol_P-C Product feature CHAIN GQ377528_Pol_P-C of FT:mat_peptide GQ377528_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J29). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASRTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELNNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377529_Pol_P-C Product feature CHAIN GQ377529_Pol_P-C of FT:mat_peptide GQ377529_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J34). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARSKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNFPPSSARSQSEGPL
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTTVTAFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377530_Pol_P-C Product feature CHAIN GQ377530_Pol_P-C of FT:mat_peptide GQ377530_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J35). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILPRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GIIRAGVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSSRPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377531_Pol_P-C Product feature CHAIN GQ377531_Pol_P-C of FT:mat_peptide GQ377531_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J36). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVTAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINHQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377533_Pol_P-C Product feature CHAIN GQ377533_Pol_P-C of FT:mat_peptide GQ377533_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J39). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSSRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRCFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTLQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377535_Pol_P-C Product feature CHAIN GQ377535_Pol_P-C of FT:mat_peptide GQ377535_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J45). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSKSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGESGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSSVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVTAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377536_Pol_P-C Product feature CHAIN GQ377536_Pol_P-C of FT:mat_peptide GQ377536_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J47). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFRSQSSGILSRSPVGPCIRSQFKQSRLGLQPQQGSMASSTPGRS
GILRARVHSTTRQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFQHFPPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSTSRNNNYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRTFPHCLAFSYMDDVVLGAKSV
QHLESLFTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSWGTLPQEHIVHKIKQCFRKLPINRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377538_Pol_P-C Product feature CHAIN GQ377538_Pol_P-C of FT:mat_peptide GQ377538_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J52). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFLKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTSRRSFGVEPSGSGHIDNSASSTSSCLYQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSTPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPDLLVGSSGLSRYVARLSSTSRNINHQYGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377540_Pol_P-C Product feature CHAIN GQ377540_Pol_P-C of FT:mat_peptide GQ377540_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J57). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFP
HIHLQEDIIDRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTSSCLHQSAVRKTAYSHFSTSKRQSSSGHAVELHDIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377541_Pol_P-C Product feature CHAIN GQ377541_Pol_P-C of FT:mat_peptide GQ377541_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J58). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSVSSTSSCLHQSAVRKTAYSHLSTSERQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHPESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377545_Pol_P-C Product feature CHAIN GQ377545_Pol_P-C of FT:mat_peptide GQ377545_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J76). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGAMQDLHD
SCSRNLYVSILLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYIIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRLRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLSLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377546_Pol_P-C Product feature CHAIN GQ377546_Pol_P-C of FT:mat_peptide GQ377546_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J77). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRTTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLFKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFQPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377551_Pol_P-C Product feature CHAIN GQ377551_Pol_P-C of FT:mat_peptide GQ377551_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J82). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSANSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGARLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377552_Pol_P-C Product feature CHAIN GQ377552_Pol_P-C of FT:mat_peptide GQ377552_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J83). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIBNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
XSCWWLQFRNSKPCSDYCLXHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377553_Pol_P-C Product feature CHAIN GQ377553_Pol_P-C of FT:mat_peptide GQ377553_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J84). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSKSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGESGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSSVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FPCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377554_Pol_P-C Product feature CHAIN GQ377554_Pol_P-C of FT:mat_peptide GQ377554_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J85). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHDIPPSSARSKSEGSI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARITGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377555_Pol_P-C Product feature CHAIN GQ377555_Pol_P-C of FT:mat_peptide GQ377555_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J86). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
NIHLQEDIIDRCQQYVGPLTVNERRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSKRHGDESLCSQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLASGKSGRS
GGIRARAHSTPRRPFGVEPAGSGHIDNSASSASSCLHQSAVRKTAYSHFSTSKRQSSSGHAVELHDISPSSARSQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNFNYQHGTMQDLHD
TCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRAGLCQVFADATPTGWGLALGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
LLCLPFRPTTGRTSLYAVSPSVPSRLPARVHFASPLHVAWRPP
>gnl|hbvpro|GQ377557_Pol_P-C Product feature CHAIN GQ377557_Pol_P-C of FT:mat_peptide GQ377557_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J88). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTANEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWRAGILYQR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPNSARSQSKGPI
FSCWWLQFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLYTAITNFLVSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377559_Pol_P-C Product feature CHAIN GQ377559_Pol_P-C of FT:mat_peptide GQ377559_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J92). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVLQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377562_Pol_P-C Product feature CHAIN GQ377562_Pol_P-C of FT:mat_peptide GQ377562_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J97). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFP
YIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRVRVHPTARRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGSI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTAITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPPTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377563_Pol_P-C Product feature CHAIN GQ377563_Pol_P-C of FT:mat_peptide GQ377563_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J98). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
FLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377570_Pol_P-C Product feature CHAIN GQ377570_Pol_P-C of FT:mat_peptide GQ377570_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J110). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHDIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARITGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377571_Pol_P-C Product feature CHAIN GQ377571_Pol_P-C of FT:mat_peptide GQ377571_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J112). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGSCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPGSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLIEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYNHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|GQ377572_Pol_P-C Product feature CHAIN GQ377572_Pol_P-C of FT:mat_peptide GQ377572_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J113). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSACSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377574_Pol_P-C Product feature CHAIN GQ377574_Pol_P-C of FT:mat_peptide GQ377574_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J115). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377575_Pol_P-C Product feature CHAIN GQ377575_Pol_P-C of FT:mat_peptide GQ377575_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J116). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLQLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVEFHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377576_Pol_P-C Product feature CHAIN GQ377576_Pol_P-C of FT:mat_peptide GQ377576_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J117). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLQLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHVDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377577_Pol_P-C Product feature CHAIN GQ377577_Pol_P-C of FT:mat_peptide GQ377577_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J118). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFFGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
FSCWWLQFRNNKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHN
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377578_Pol_P-C Product feature CHAIN GQ377578_Pol_P-C of FT:mat_peptide GQ377578_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J125). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSMARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCFHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKIKQCFRKLPVNRPIDWKVCQKIGGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377579_Pol_P-C Product feature CHAIN GQ377579_Pol_P-C of FT:mat_peptide GQ377579_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J126). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSFRARVHPTTRRSFGVEPSGSGHTDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGATLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377580_Pol_P-C Product feature CHAIN GQ377580_Pol_P-C of FT:mat_peptide GQ377580_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J127). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSVCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCNEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLQLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377583_Pol_P-C Product feature CHAIN GQ377583_Pol_P-C of FT:mat_peptide GQ377583_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J132). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFRSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRHLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377584_Pol_P-C Product feature CHAIN GQ377584_Pol_P-C of FT:mat_peptide GQ377584_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J133). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIIDRCQQYVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDKSFCAQSSGILSRSPVGPCVRSQFKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGPI
FSCWWLQFRNRKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377585_Pol_P-C Product feature CHAIN GQ377585_Pol_P-C of FT:mat_peptide GQ377585_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J134). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
NIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSKSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIHSKQAFTFSPTYKAFLWQQYMHLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377586_Pol_P-C Product feature CHAIN GQ377586_Pol_P-C of FT:mat_peptide GQ377586_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J135). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFP
HIHLQEDISNRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQPSGILSRSPVGPGIRSQFKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSSSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FPCWWLQFRNSKPCSDHCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTEARLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGPQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377591_Pol_P-C Product feature CHAIN GQ377591_Pol_P-C of FT:mat_peptide GQ377591_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J148). Complete genome. [Hepadnaviridae] (length=841 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPVDKGIKPYYPEHTVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESLCSQSSGILSRSPVGPCIRSQLKQSRLGLQPQQGSLARSKSGRS
GSIRARVHPTTRQSFGVEPSGSGHIDNRASSAPLLTSAVRKTAYSHFSTSKRQSSSGHAVELHNFPPSSARSQSEGPLLS
CWWLQFRNSKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSTHV
SWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSTSRNINYQHGAMQDLHDSC
SRNLYVSLMLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQH
LESLFTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLLGF
AAPFTQCGYPALMPLYACIQSKQAFTFSPTYKSFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFVAP
LPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLL
RLPFRPTTGRTSLYAVSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377593_Pol_P-C Product feature CHAIN GQ377593_Pol_P-C of FT:mat_peptide GQ377593_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J150). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGESGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTASCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
SSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHSIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVTKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377597_Pol_P-C Product feature CHAIN GQ377597_Pol_P-C of FT:mat_peptide GQ377597_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J157). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGPIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARPQSEGAI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGTLPQEHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLHLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ377598_Pol_P-C Product feature CHAIN GQ377598_Pol_P-C of FT:mat_peptide GQ377598_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J158). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPAYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYQHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVQKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLRLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377599_Pol_P-C Product feature CHAIN GQ377599_Pol_P-C of FT:mat_peptide GQ377599_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J160). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPGVRSQLKQSRLGLQPQQGSLARGKSGRS
GSIRARAHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRKTAYAHLSTSKRQSPSGHAVELHHIPPSSARPQSEGPI
LSCWWLQFRNSKPCSDYCLTHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYNHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQDHIVLKIKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLLLPFRPTTGRTSLYAVSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|GQ377600_Pol_P-C Product feature CHAIN GQ377600_Pol_P-C of FT:mat_peptide GQ377600_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J161). Complete genome. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGESGRS
GSIRARVHPTTRRSFGVEPSGSGHINNSASSTASCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNSKPCSDYCLXHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSRNINYHHGTMQDLHD
SCSRNLYVSLLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSV
QHLESLFTSITNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGTLPQEHIVLKLKQCFRKLPVNRPIDWKVCQRIVGLL
GFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGVCQVFADATPTGWGLAIGHRRMRGTFV
APLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
LLXLPFRPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377601_Pol_P-C Product feature CHAIN GQ377601_Pol_P-C of FT:mat_peptide GQ377601_Pol_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J164). Non-functional genomic sequence. [Hepadnaviridae] (length=843 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFP
HIHLQEDIINRCQQYVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLVFQTSTRHGDESFCSQSSGILSRSPVGPCVRSQLKQSRLGLQPQQGSLARGKSGGS
GSIRARVHPTTRRSFGVEPSGSGHIDNSASSTSSCLHQSAVRETAYSHLSTSKRQSSSGHAVELHNIPPSSARSQSEGPI
FSCWWLQFRNNKPCSDYCLSHIVNLLEDWGPCTEHGEHNIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGST
HVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLPRYVARLSSTSR