HBVdb

Dataset for protein SHBs of genotype C

[Download (right click)] [Alignment] [Repertoires]

9468 sequence(s)

>gnl|hbvpro|AB014360_SHBs_P-C Product feature CHAIN AB014360_SHBs_P-C of FT:mat_peptide AB014360_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D01HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTCNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLSNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB014361_SHBs_P-C Product feature CHAIN AB014361_SHBs_P-C of FT:mat_peptide AB014361_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 02D02HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014362_SHBs_P-C Product feature CHAIN AB014362_SHBs_P-C of FT:mat_peptide AB014362_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 03D03HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB014363_SHBs_P-C Product feature CHAIN AB014363_SHBs_P-C of FT:mat_peptide AB014363_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 04D04HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLBSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSIFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|AB014364_SHBs_P-C Product feature CHAIN AB014364_SHBs_P-C of FT:mat_peptide AB014364_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 05D05HCC). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGXSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB014365_SHBs_P-C Product feature CHAIN AB014365_SHBs_P-C of FT:mat_peptide AB014365_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 01D06HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
METTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB014367_SHBs_P-C Product feature CHAIN AB014367_SHBs_P-C of FT:mat_peptide AB014367_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08D08HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGTCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014368_SHBs_P-C Product feature CHAIN AB014368_SHBs_P-C of FT:mat_peptide AB014368_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 09D09HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014369_SHBs_P-C Product feature CHAIN AB014369_SHBs_P-C of FT:mat_peptide AB014369_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10D10HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGEAPXCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLXDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014371_SHBs_P-C Product feature CHAIN AB014371_SHBs_P-C of FT:mat_peptide AB014371_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 12D12HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014372_SHBs_P-C Product feature CHAIN AB014372_SHBs_P-C of FT:mat_peptide AB014372_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 13D13HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFSLLTKILTIPQSLBSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGNSTIPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014373_SHBs_P-C Product feature CHAIN AB014373_SHBs_P-C of FT:mat_peptide AB014373_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 14D14HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTTPAQNTSGIPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB014374_SHBs_P-C Product feature CHAIN AB014374_SHBs_P-C of FT:mat_peptide AB014374_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 15D15HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014376_SHBs_P-C Product feature CHAIN AB014376_SHBs_P-C of FT:mat_peptide AB014376_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 17T02HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014377_SHBs_P-C Product feature CHAIN AB014377_SHBs_P-C of FT:mat_peptide AB014377_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18T03HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014378_SHBs_P-C Product feature CHAIN AB014378_SHBs_P-C of FT:mat_peptide AB014378_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 19Y01HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSRYNIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014379_SHBs_P-C Product feature CHAIN AB014379_SHBs_P-C of FT:mat_peptide AB014379_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 20Y02HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTXTTSTGPCKTCTSPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014380_SHBs_P-C Product feature CHAIN AB014380_SHBs_P-C of FT:mat_peptide AB014380_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 21Y03HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRIRTIPQSLDSWWTSLNFLGGVPKCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB014381_SHBs_P-C Product feature CHAIN AB014381_SHBs_P-C of FT:mat_peptide AB014381_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 22Y04HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014382_SHBs_P-C Product feature CHAIN AB014382_SHBs_P-C of FT:mat_peptide AB014382_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 23Y05HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPARNTSIFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014383_SHBs_P-C Product feature CHAIN AB014383_SHBs_P-C of FT:mat_peptide AB014383_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 24Y06HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014384_SHBs_P-C Product feature CHAIN AB014384_SHBs_P-C of FT:mat_peptide AB014384_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 25Y07HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014385_SHBs_P-C Product feature CHAIN AB014385_SHBs_P-C of FT:mat_peptide AB014385_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26Y08HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014387_SHBs_P-C Product feature CHAIN AB014387_SHBs_P-C of FT:mat_peptide AB014387_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 28Y10HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGEVPKCPGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTNSTGPCKTCTIPAQNTSMFPSCCCTKPSDRNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVXI
>gnl|hbvpro|AB014388_SHBs_P-C Product feature CHAIN AB014388_SHBs_P-C of FT:mat_peptide AB014388_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 29Y11HCC). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLBSWWTSLSFLGGAPKCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLRPFIPLLLIFFCLWVYI
>gnl|hbvpro|AB014389_SHBs_P-C Product feature CHAIN AB014389_SHBs_P-C of FT:mat_peptide AB014389_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 30Y12HCC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCXPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014390_SHBs_P-C Product feature CHAIN AB014390_SHBs_P-C of FT:mat_peptide AB014390_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 31Y13HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB014391_SHBs_P-C Product feature CHAIN AB014391_SHBs_P-C of FT:mat_peptide AB014391_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 32Y14HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGRNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQNNSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSXLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB014392_SHBs_P-C Product feature CHAIN AB014392_SHBs_P-C of FT:mat_peptide AB014392_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 33Y15HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB014393_SHBs_P-C Product feature CHAIN AB014393_SHBs_P-C of FT:mat_peptide AB014393_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 34Y16HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLILLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014394_SHBs_P-C Product feature CHAIN AB014394_SHBs_P-C of FT:mat_peptide AB014394_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 35Y17HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014396_SHBs_P-C Product feature CHAIN AB014396_SHBs_P-C of FT:mat_peptide AB014396_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 37Y19HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQSTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014397_SHBs_P-C Product feature CHAIN AB014397_SHBs_P-C of FT:mat_peptide AB014397_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 38Y20HCC). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014398_SHBs_P-C Product feature CHAIN AB014398_SHBs_P-C of FT:mat_peptide AB014398_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 39Y21HCC). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB014399_SHBs_P-C Product feature CHAIN AB014399_SHBs_P-C of FT:mat_peptide AB014399_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 40Y22HCC). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB026811_SHBs_P-C Product feature CHAIN AB026811_SHBs_P-C of FT:mat_peptide AB026811_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Feb.). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026812_SHBs_P-C Product feature CHAIN AB026812_SHBs_P-C of FT:mat_peptide AB026812_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;98.May). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026813_SHBs_P-C Product feature CHAIN AB026813_SHBs_P-C of FT:mat_peptide AB026813_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 3;97.Sep.). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026814_SHBs_P-C Product feature CHAIN AB026814_SHBs_P-C of FT:mat_peptide AB026814_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Donor 3;98.May). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB026815_SHBs_P-C Product feature CHAIN AB026815_SHBs_P-C of FT:mat_peptide AB026815_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Recipient 2:full). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029950_SHBs_P-C Product feature CHAIN AB029950_SHBs_P-C of FT:mat_peptide AB029950_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029951_SHBs_P-C Product feature CHAIN AB029951_SHBs_P-C of FT:mat_peptide AB029951_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWAYI
>gnl|hbvpro|AB029952_SHBs_P-C Product feature CHAIN AB029952_SHBs_P-C of FT:mat_peptide AB029952_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVTWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029953_SHBs_P-C Product feature CHAIN AB029953_SHBs_P-C of FT:mat_peptide AB029953_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRLF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTISTGPCKTCTIPAQGNSSFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029954_SHBs_P-C Product feature CHAIN AB029954_SHBs_P-C of FT:mat_peptide AB029954_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029955_SHBs_P-C Product feature CHAIN AB029955_SHBs_P-C of FT:mat_peptide AB029955_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029956_SHBs_P-C Product feature CHAIN AB029956_SHBs_P-C of FT:mat_peptide AB029956_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029957_SHBs_P-C Product feature CHAIN AB029957_SHBs_P-C of FT:mat_peptide AB029957_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029958_SHBs_P-C Product feature CHAIN AB029958_SHBs_P-C of FT:mat_peptide AB029958_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029959_SHBs_P-C Product feature CHAIN AB029959_SHBs_P-C of FT:mat_peptide AB029959_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMKHSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLPPTVWLSVIWMMWYWGPSLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029960_SHBs_P-C Product feature CHAIN AB029960_SHBs_P-C of FT:mat_peptide AB029960_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029961_SHBs_P-C Product feature CHAIN AB029961_SHBs_P-C of FT:mat_peptide AB029961_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029962_SHBs_P-C Product feature CHAIN AB029962_SHBs_P-C of FT:mat_peptide AB029962_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029963_SHBs_P-C Product feature CHAIN AB029963_SHBs_P-C of FT:mat_peptide AB029963_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029964_SHBs_P-C Product feature CHAIN AB029964_SHBs_P-C of FT:mat_peptide AB029964_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWVSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029965_SHBs_P-C Product feature CHAIN AB029965_SHBs_P-C of FT:mat_peptide AB029965_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029966_SHBs_P-C Product feature CHAIN AB029966_SHBs_P-C of FT:mat_peptide AB029966_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029967_SHBs_P-C Product feature CHAIN AB029967_SHBs_P-C of FT:mat_peptide AB029967_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029968_SHBs_P-C Product feature CHAIN AB029968_SHBs_P-C of FT:mat_peptide AB029968_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029969_SHBs_P-C Product feature CHAIN AB029969_SHBs_P-C of FT:mat_peptide AB029969_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029970_SHBs_P-C Product feature CHAIN AB029970_SHBs_P-C of FT:mat_peptide AB029970_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029971_SHBs_P-C Product feature CHAIN AB029971_SHBs_P-C of FT:mat_peptide AB029971_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029972_SHBs_P-C Product feature CHAIN AB029972_SHBs_P-C of FT:mat_peptide AB029972_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029973_SHBs_P-C Product feature CHAIN AB029973_SHBs_P-C of FT:mat_peptide AB029973_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029974_SHBs_P-C Product feature CHAIN AB029974_SHBs_P-C of FT:mat_peptide AB029974_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029975_SHBs_P-C Product feature CHAIN AB029975_SHBs_P-C of FT:mat_peptide AB029975_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029976_SHBs_P-C Product feature CHAIN AB029976_SHBs_P-C of FT:mat_peptide AB029976_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029977_SHBs_P-C Product feature CHAIN AB029977_SHBs_P-C of FT:mat_peptide AB029977_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029978_SHBs_P-C Product feature CHAIN AB029978_SHBs_P-C of FT:mat_peptide AB029978_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029979_SHBs_P-C Product feature CHAIN AB029979_SHBs_P-C of FT:mat_peptide AB029979_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029980_SHBs_P-C Product feature CHAIN AB029980_SHBs_P-C of FT:mat_peptide AB029980_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029981_SHBs_P-C Product feature CHAIN AB029981_SHBs_P-C of FT:mat_peptide AB029981_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029982_SHBs_P-C Product feature CHAIN AB029982_SHBs_P-C of FT:mat_peptide AB029982_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029983_SHBs_P-C Product feature CHAIN AB029983_SHBs_P-C of FT:mat_peptide AB029983_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029984_SHBs_P-C Product feature CHAIN AB029984_SHBs_P-C of FT:mat_peptide AB029984_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029985_SHBs_P-C Product feature CHAIN AB029985_SHBs_P-C of FT:mat_peptide AB029985_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029986_SHBs_P-C Product feature CHAIN AB029986_SHBs_P-C of FT:mat_peptide AB029986_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029987_SHBs_P-C Product feature CHAIN AB029987_SHBs_P-C of FT:mat_peptide AB029987_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029988_SHBs_P-C Product feature CHAIN AB029988_SHBs_P-C of FT:mat_peptide AB029988_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029989_SHBs_P-C Product feature CHAIN AB029989_SHBs_P-C of FT:mat_peptide AB029989_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029990_SHBs_P-C Product feature CHAIN AB029990_SHBs_P-C of FT:mat_peptide AB029990_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB029991_SHBs_P-C Product feature CHAIN AB029991_SHBs_P-C of FT:mat_peptide AB029991_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB030507_SHBs_P-C Product feature CHAIN AB030507_SHBs_P-C of FT:mat_peptide AB030507_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBNP1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB030508_SHBs_P-C Product feature CHAIN AB030508_SHBs_P-C of FT:mat_peptide AB030508_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBNP2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB030510_SHBs_P-C Product feature CHAIN AB030510_SHBs_P-C of FT:mat_peptide AB030510_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBNP4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB030511_SHBs_P-C Product feature CHAIN AB030511_SHBs_P-C of FT:mat_peptide AB030511_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBNP5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGFRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB030512_SHBs_P-C Product feature CHAIN AB030512_SHBs_P-C of FT:mat_peptide AB030512_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBNP6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYKGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB030514_SHBs_P-C Product feature CHAIN AB030514_SHBs_P-C of FT:mat_peptide AB030514_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBNP8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB030515_SHBs_P-C Product feature CHAIN AB030515_SHBs_P-C of FT:mat_peptide AB030515_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBNP9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB030516_SHBs_P-C Product feature CHAIN AB030516_SHBs_P-C of FT:mat_peptide AB030516_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBNP10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB030517_SHBs_P-C Product feature CHAIN AB030517_SHBs_P-C of FT:mat_peptide AB030517_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBNP11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB031262_SHBs_P-C Product feature CHAIN AB031262_SHBs_P-C of FT:mat_peptide AB031262_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV VietA-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPALGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB033550_SHBs_P-C Product feature CHAIN AB033550_SHBs_P-C of FT:mat_peptide AB033550_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NDR260). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB033551_SHBs_P-C Product feature CHAIN AB033551_SHBs_P-C of FT:mat_peptide AB033551_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK300). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKNRTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB033552_SHBs_P-C Product feature CHAIN AB033552_SHBs_P-C of FT:mat_peptide AB033552_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK494). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB033553_SHBs_P-C Product feature CHAIN AB033553_SHBs_P-C of FT:mat_peptide AB033553_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SK619). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB033556_SHBs_P-C Product feature CHAIN AB033556_SHBs_P-C of FT:mat_peptide AB033556_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate AK66). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB039740_SHBs_P-C Product feature CHAIN AB039740_SHBs_P-C of FT:mat_peptide AB039740_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKPCTIPALGAFKFPSCGGTKPSDVDSTSIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYKILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB039741_SHBs_P-C Product feature CHAIN AB039741_SHBs_P-C of FT:mat_peptide AB039741_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRHF
IISLFILLLCLISLLVLLDYQGMLPVCPLLPETSTTSTGTCKTCTIPAHGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSHTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB039742_SHBs_P-C Product feature CHAIN AB039742_SHBs_P-C of FT:mat_peptide AB039742_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAHTCPGQNSQSPSSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYV
>gnl|hbvpro|AB042282_SHBs_P-C Product feature CHAIN AB042282_SHBs_P-C of FT:mat_peptide AB042282_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB042283_SHBs_P-C Product feature CHAIN AB042283_SHBs_P-C of FT:mat_peptide AB042283_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB042284_SHBs_P-C Product feature CHAIN AB042284_SHBs_P-C of FT:mat_peptide AB042284_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB042285_SHBs_P-C Product feature CHAIN AB042285_SHBs_P-C of FT:mat_peptide AB042285_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NSS-4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB049610_SHBs_P-C Product feature CHAIN AB049610_SHBs_P-C of FT:mat_peptide AB049610_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV AN29). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLSFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB050018_SHBs_P-C Product feature CHAIN AB050018_SHBs_P-C of FT:mat_peptide AB050018_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB074047_SHBs_P-C Product feature CHAIN AB074047_SHBs_P-C of FT:mat_peptide AB074047_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th11). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLREIPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPARNISMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYTIVKPFLPLLPIFFYLWAYI
>gnl|hbvpro|AB074755_SHBs_P-C Product feature CHAIN AB074755_SHBs_P-C of FT:mat_peptide AB074755_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th44). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB074756_SHBs_P-C Product feature CHAIN AB074756_SHBs_P-C of FT:mat_peptide AB074756_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-Th55). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB105173_SHBs_P-C Product feature CHAIN AB105173_SHBs_P-C of FT:mat_peptide AB105173_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 16). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB105174_SHBs_P-C Product feature CHAIN AB105174_SHBs_P-C of FT:mat_peptide AB105174_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Hawaii 60). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB106895_SHBs_P-C Product feature CHAIN AB106895_SHBs_P-C of FT:mat_peptide AB106895_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pHB4-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111114_SHBs_P-C Product feature CHAIN AB111114_SHBs_P-C of FT:mat_peptide AB111114_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB111115_SHBs_P-C Product feature CHAIN AB111115_SHBs_P-C of FT:mat_peptide AB111115_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDKNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB111116_SHBs_P-C Product feature CHAIN AB111116_SHBs_P-C of FT:mat_peptide AB111116_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDKNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB111117_SHBs_P-C Product feature CHAIN AB111117_SHBs_P-C of FT:mat_peptide AB111117_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRSSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111118_SHBs_P-C Product feature CHAIN AB111118_SHBs_P-C of FT:mat_peptide AB111118_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB111119_SHBs_P-C Product feature CHAIN AB111119_SHBs_P-C of FT:mat_peptide AB111119_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111120_SHBs_P-C Product feature CHAIN AB111120_SHBs_P-C of FT:mat_peptide AB111120_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111121_SHBs_P-C Product feature CHAIN AB111121_SHBs_P-C of FT:mat_peptide AB111121_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111122_SHBs_P-C Product feature CHAIN AB111122_SHBs_P-C of FT:mat_peptide AB111122_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSHTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111123_SHBs_P-C Product feature CHAIN AB111123_SHBs_P-C of FT:mat_peptide AB111123_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111124_SHBs_P-C Product feature CHAIN AB111124_SHBs_P-C of FT:mat_peptide AB111124_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMILYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111125_SHBs_P-C Product feature CHAIN AB111125_SHBs_P-C of FT:mat_peptide AB111125_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMILYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB111946_SHBs_P-C Product feature CHAIN AB111946_SHBs_P-C of FT:mat_peptide AB111946_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT103). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112063_SHBs_P-C Product feature CHAIN AB112063_SHBs_P-C of FT:mat_peptide AB112063_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT101). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCSGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTQPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112065_SHBs_P-C Product feature CHAIN AB112065_SHBs_P-C of FT:mat_peptide AB112065_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VT140). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMWPVCPLLPGTSTTITGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112066_SHBs_P-C Product feature CHAIN AB112066_SHBs_P-C of FT:mat_peptide AB112066_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY624). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTITGPCKTCTNPAQGTSMFPSCCCTKPSDGNGTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112348_SHBs_P-C Product feature CHAIN AB112348_SHBs_P-C of FT:mat_peptide AB112348_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY656). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCSVQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPALGDSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112408_SHBs_P-C Product feature CHAIN AB112408_SHBs_P-C of FT:mat_peptide AB112408_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-MY683). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPALGISMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFRLWVYI
>gnl|hbvpro|AB112471_SHBs_P-C Product feature CHAIN AB112471_SHBs_P-C of FT:mat_peptide AB112471_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH123). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTWTNPAQGTSMFPSCWWTKPWDGKCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB112472_SHBs_P-C Product feature CHAIN AB112472_SHBs_P-C of FT:mat_peptide AB112472_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TH124). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB113875_SHBs_P-C Product feature CHAIN AB113875_SHBs_P-C of FT:mat_peptide AB113875_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB113876_SHBs_P-C Product feature CHAIN AB113876_SHBs_P-C of FT:mat_peptide AB113876_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB113877_SHBs_P-C Product feature CHAIN AB113877_SHBs_P-C of FT:mat_peptide AB113877_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLNNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB113878_SHBs_P-C Product feature CHAIN AB113878_SHBs_P-C of FT:mat_peptide AB113878_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB113879_SHBs_P-C Product feature CHAIN AB113879_SHBs_P-C of FT:mat_peptide AB113879_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB115417_SHBs_P-C Product feature CHAIN AB115417_SHBs_P-C of FT:mat_peptide AB115417_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-O47). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSHSFLGGTPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLVVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQSTSMFPSWWWTKPSDGNCTCIPIPSSWAFAR
ILWEWASVRFSWLSLLVPFVQWFVGLPPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB115418_SHBs_P-C Product feature CHAIN AB115418_SHBs_P-C of FT:mat_peptide AB115418_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-O55). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLNFLGGAPTCPGQNSQSPTSNHSPTCCPPTCPGYRWMCLRRY
IIFLFMLLLCLIFLWVLLDYQGMSPVGPLLPGTSTTSTGPCKTCTIPAQGTSMFPFCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGLSLYNIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB117758_SHBs_P-C Product feature CHAIN AB117758_SHBs_P-C of FT:mat_peptide AB117758_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CB10). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB176642_SHBs_P-C Product feature CHAIN AB176642_SHBs_P-C of FT:mat_peptide AB176642_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-115). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQXAFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRX
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLLNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB176643_SHBs_P-C Product feature CHAIN AB176643_SHBs_P-C of FT:mat_peptide AB176643_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-NK1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MESTTSGFPGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGEAPXCPGQNSQSPTSNHSPTSCPPIXPGYRWMCLRRF
IIFLFILRLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGXSMSPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMXXYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB182589_SHBs_P-C Product feature CHAIN AB182589_SHBs_P-C of FT:mat_peptide AB182589_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CH:Mat-Ko). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTLCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195930_SHBs_P-C Product feature CHAIN AB195930_SHBs_P-C of FT:mat_peptide AB195930_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FVWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195931_SHBs_P-C Product feature CHAIN AB195931_SHBs_P-C of FT:mat_peptide AB195931_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195932_SHBs_P-C Product feature CHAIN AB195932_SHBs_P-C of FT:mat_peptide AB195932_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASFRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195936_SHBs_P-C Product feature CHAIN AB195936_SHBs_P-C of FT:mat_peptide AB195936_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195937_SHBs_P-C Product feature CHAIN AB195937_SHBs_P-C of FT:mat_peptide AB195937_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195938_SHBs_P-C Product feature CHAIN AB195938_SHBs_P-C of FT:mat_peptide AB195938_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195942_SHBs_P-C Product feature CHAIN AB195942_SHBs_P-C of FT:mat_peptide AB195942_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPISPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195943_SHBs_P-C Product feature CHAIN AB195943_SHBs_P-C of FT:mat_peptide AB195943_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195944_SHBs_P-C Product feature CHAIN AB195944_SHBs_P-C of FT:mat_peptide AB195944_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195945_SHBs_P-C Product feature CHAIN AB195945_SHBs_P-C of FT:mat_peptide AB195945_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195946_SHBs_P-C Product feature CHAIN AB195946_SHBs_P-C of FT:mat_peptide AB195946_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195947_SHBs_P-C Product feature CHAIN AB195947_SHBs_P-C of FT:mat_peptide AB195947_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195948_SHBs_P-C Product feature CHAIN AB195948_SHBs_P-C of FT:mat_peptide AB195948_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195949_SHBs_P-C Product feature CHAIN AB195949_SHBs_P-C of FT:mat_peptide AB195949_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195952_SHBs_P-C Product feature CHAIN AB195952_SHBs_P-C of FT:mat_peptide AB195952_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195953_SHBs_P-C Product feature CHAIN AB195953_SHBs_P-C of FT:mat_peptide AB195953_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB195954_SHBs_P-C Product feature CHAIN AB195954_SHBs_P-C of FT:mat_peptide AB195954_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198076_SHBs_P-C Product feature CHAIN AB198076_SHBs_P-C of FT:mat_peptide AB198076_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198077_SHBs_P-C Product feature CHAIN AB198077_SHBs_P-C of FT:mat_peptide AB198077_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198078_SHBs_P-C Product feature CHAIN AB198078_SHBs_P-C of FT:mat_peptide AB198078_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198079_SHBs_P-C Product feature CHAIN AB198079_SHBs_P-C of FT:mat_peptide AB198079_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198080_SHBs_P-C Product feature CHAIN AB198080_SHBs_P-C of FT:mat_peptide AB198080_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198081_SHBs_P-C Product feature CHAIN AB198081_SHBs_P-C of FT:mat_peptide AB198081_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198082_SHBs_P-C Product feature CHAIN AB198082_SHBs_P-C of FT:mat_peptide AB198082_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB198083_SHBs_P-C Product feature CHAIN AB198083_SHBs_P-C of FT:mat_peptide AB198083_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB202071_SHBs_P-C Product feature CHAIN AB202071_SHBs_P-C of FT:mat_peptide AB202071_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB202072_SHBs_P-C Product feature CHAIN AB202072_SHBs_P-C of FT:mat_peptide AB202072_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205123_SHBs_P-C Product feature CHAIN AB205123_SHBs_P-C of FT:mat_peptide AB205123_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-CN578-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTPTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205124_SHBs_P-C Product feature CHAIN AB205124_SHBs_P-C of FT:mat_peptide AB205124_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-TJ3-1-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205125_SHBs_P-C Product feature CHAIN AB205125_SHBs_P-C of FT:mat_peptide AB205125_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-VH34-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222714_SHBs_P-C Product feature CHAIN AB222714_SHBs_P-C of FT:mat_peptide AB222714_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222715_SHBs_P-C Product feature CHAIN AB222715_SHBs_P-C of FT:mat_peptide AB222715_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UZNVC7M). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222716_SHBs_P-C Product feature CHAIN AB222716_SHBs_P-C of FT:mat_peptide AB222716_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF688). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222717_SHBs_P-C Product feature CHAIN AB222717_SHBs_P-C of FT:mat_peptide AB222717_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF689). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVXLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222718_SHBs_P-C Product feature CHAIN AB222718_SHBs_P-C of FT:mat_peptide AB222718_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF690). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222719_SHBs_P-C Product feature CHAIN AB222719_SHBs_P-C of FT:mat_peptide AB222719_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF691). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGLNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222720_SHBs_P-C Product feature CHAIN AB222720_SHBs_P-C of FT:mat_peptide AB222720_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGLNSQSPTSNHSPISCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222721_SHBs_P-C Product feature CHAIN AB222721_SHBs_P-C of FT:mat_peptide AB222721_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF693). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222722_SHBs_P-C Product feature CHAIN AB222722_SHBs_P-C of FT:mat_peptide AB222722_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF694). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222723_SHBs_P-C Product feature CHAIN AB222723_SHBs_P-C of FT:mat_peptide AB222723_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF695). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222724_SHBs_P-C Product feature CHAIN AB222724_SHBs_P-C of FT:mat_peptide AB222724_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF696). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222725_SHBs_P-C Product feature CHAIN AB222725_SHBs_P-C of FT:mat_peptide AB222725_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF697). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222726_SHBs_P-C Product feature CHAIN AB222726_SHBs_P-C of FT:mat_peptide AB222726_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF698). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222727_SHBs_P-C Product feature CHAIN AB222727_SHBs_P-C of FT:mat_peptide AB222727_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF699). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222728_SHBs_P-C Product feature CHAIN AB222728_SHBs_P-C of FT:mat_peptide AB222728_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF700). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222729_SHBs_P-C Product feature CHAIN AB222729_SHBs_P-C of FT:mat_peptide AB222729_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF701). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222730_SHBs_P-C Product feature CHAIN AB222730_SHBs_P-C of FT:mat_peptide AB222730_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF702). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222731_SHBs_P-C Product feature CHAIN AB222731_SHBs_P-C of FT:mat_peptide AB222731_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF703). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222732_SHBs_P-C Product feature CHAIN AB222732_SHBs_P-C of FT:mat_peptide AB222732_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF704). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222733_SHBs_P-C Product feature CHAIN AB222733_SHBs_P-C of FT:mat_peptide AB222733_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF706). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222734_SHBs_P-C Product feature CHAIN AB222734_SHBs_P-C of FT:mat_peptide AB222734_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF708). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222735_SHBs_P-C Product feature CHAIN AB222735_SHBs_P-C of FT:mat_peptide AB222735_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF709). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222736_SHBs_P-C Product feature CHAIN AB222736_SHBs_P-C of FT:mat_peptide AB222736_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF710). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222737_SHBs_P-C Product feature CHAIN AB222737_SHBs_P-C of FT:mat_peptide AB222737_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF711). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222738_SHBs_P-C Product feature CHAIN AB222738_SHBs_P-C of FT:mat_peptide AB222738_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF712). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222739_SHBs_P-C Product feature CHAIN AB222739_SHBs_P-C of FT:mat_peptide AB222739_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF717). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB222740_SHBs_P-C Product feature CHAIN AB222740_SHBs_P-C of FT:mat_peptide AB222740_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF719). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222741_SHBs_P-C Product feature CHAIN AB222741_SHBs_P-C of FT:mat_peptide AB222741_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IF721). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222743_SHBs_P-C Product feature CHAIN AB222743_SHBs_P-C of FT:mat_peptide AB222743_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN415). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTXXCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222744_SHBs_P-C Product feature CHAIN AB222744_SHBs_P-C of FT:mat_peptide AB222744_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN420). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222745_SHBs_P-C Product feature CHAIN AB222745_SHBs_P-C of FT:mat_peptide AB222745_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN446). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222746_SHBs_P-C Product feature CHAIN AB222746_SHBs_P-C of FT:mat_peptide AB222746_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN448). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222747_SHBs_P-C Product feature CHAIN AB222747_SHBs_P-C of FT:mat_peptide AB222747_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN465). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFXLLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222748_SHBs_P-C Product feature CHAIN AB222748_SHBs_P-C of FT:mat_peptide AB222748_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN482). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222749_SHBs_P-C Product feature CHAIN AB222749_SHBs_P-C of FT:mat_peptide AB222749_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN485). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222750_SHBs_P-C Product feature CHAIN AB222750_SHBs_P-C of FT:mat_peptide AB222750_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN486). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MXDTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222751_SHBs_P-C Product feature CHAIN AB222751_SHBs_P-C of FT:mat_peptide AB222751_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN492). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222752_SHBs_P-C Product feature CHAIN AB222752_SHBs_P-C of FT:mat_peptide AB222752_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN493). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222753_SHBs_P-C Product feature CHAIN AB222753_SHBs_P-C of FT:mat_peptide AB222753_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN496). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSQTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222754_SHBs_P-C Product feature CHAIN AB222754_SHBs_P-C of FT:mat_peptide AB222754_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN497). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222755_SHBs_P-C Product feature CHAIN AB222755_SHBs_P-C of FT:mat_peptide AB222755_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN498). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222756_SHBs_P-C Product feature CHAIN AB222756_SHBs_P-C of FT:mat_peptide AB222756_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN500). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222757_SHBs_P-C Product feature CHAIN AB222757_SHBs_P-C of FT:mat_peptide AB222757_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN502). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222758_SHBs_P-C Product feature CHAIN AB222758_SHBs_P-C of FT:mat_peptide AB222758_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN503). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222759_SHBs_P-C Product feature CHAIN AB222759_SHBs_P-C of FT:mat_peptide AB222759_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN504). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222760_SHBs_P-C Product feature CHAIN AB222760_SHBs_P-C of FT:mat_peptide AB222760_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN505). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMLPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222761_SHBs_P-C Product feature CHAIN AB222761_SHBs_P-C of FT:mat_peptide AB222761_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN506). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222762_SHBs_P-C Product feature CHAIN AB222762_SHBs_P-C of FT:mat_peptide AB222762_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN507). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222763_SHBs_P-C Product feature CHAIN AB222763_SHBs_P-C of FT:mat_peptide AB222763_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN508). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222764_SHBs_P-C Product feature CHAIN AB222764_SHBs_P-C of FT:mat_peptide AB222764_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN509). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222765_SHBs_P-C Product feature CHAIN AB222765_SHBs_P-C of FT:mat_peptide AB222765_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN510). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222766_SHBs_P-C Product feature CHAIN AB222766_SHBs_P-C of FT:mat_peptide AB222766_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN511). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222767_SHBs_P-C Product feature CHAIN AB222767_SHBs_P-C of FT:mat_peptide AB222767_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN512). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222768_SHBs_P-C Product feature CHAIN AB222768_SHBs_P-C of FT:mat_peptide AB222768_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN515). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222769_SHBs_P-C Product feature CHAIN AB222769_SHBs_P-C of FT:mat_peptide AB222769_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN517). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222770_SHBs_P-C Product feature CHAIN AB222770_SHBs_P-C of FT:mat_peptide AB222770_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN520). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTAGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222771_SHBs_P-C Product feature CHAIN AB222771_SHBs_P-C of FT:mat_peptide AB222771_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN523). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222772_SHBs_P-C Product feature CHAIN AB222772_SHBs_P-C of FT:mat_peptide AB222772_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN524). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB222773_SHBs_P-C Product feature CHAIN AB222773_SHBs_P-C of FT:mat_peptide AB222773_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN525). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222774_SHBs_P-C Product feature CHAIN AB222774_SHBs_P-C of FT:mat_peptide AB222774_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN526). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGXSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222775_SHBs_P-C Product feature CHAIN AB222775_SHBs_P-C of FT:mat_peptide AB222775_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN527). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTXGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222776_SHBs_P-C Product feature CHAIN AB222776_SHBs_P-C of FT:mat_peptide AB222776_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN530). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222777_SHBs_P-C Product feature CHAIN AB222777_SHBs_P-C of FT:mat_peptide AB222777_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN531). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWPSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNISNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222778_SHBs_P-C Product feature CHAIN AB222778_SHBs_P-C of FT:mat_peptide AB222778_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN532). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222779_SHBs_P-C Product feature CHAIN AB222779_SHBs_P-C of FT:mat_peptide AB222779_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN533). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222780_SHBs_P-C Product feature CHAIN AB222780_SHBs_P-C of FT:mat_peptide AB222780_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN534). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222781_SHBs_P-C Product feature CHAIN AB222781_SHBs_P-C of FT:mat_peptide AB222781_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CN598). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHXPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232089_SHBs_P-C Product feature CHAIN AB232089_SHBs_P-C of FT:mat_peptide AB232089_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY268). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232090_SHBs_P-C Product feature CHAIN AB232090_SHBs_P-C of FT:mat_peptide AB232090_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY270). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232091_SHBs_P-C Product feature CHAIN AB232091_SHBs_P-C of FT:mat_peptide AB232091_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY325). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPNVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232092_SHBs_P-C Product feature CHAIN AB232092_SHBs_P-C of FT:mat_peptide AB232092_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY344). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232093_SHBs_P-C Product feature CHAIN AB232093_SHBs_P-C of FT:mat_peptide AB232093_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY346). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232094_SHBs_P-C Product feature CHAIN AB232094_SHBs_P-C of FT:mat_peptide AB232094_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY347). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232095_SHBs_P-C Product feature CHAIN AB232095_SHBs_P-C of FT:mat_peptide AB232095_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY354). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232096_SHBs_P-C Product feature CHAIN AB232096_SHBs_P-C of FT:mat_peptide AB232096_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY362). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232097_SHBs_P-C Product feature CHAIN AB232097_SHBs_P-C of FT:mat_peptide AB232097_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY374). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232098_SHBs_P-C Product feature CHAIN AB232098_SHBs_P-C of FT:mat_peptide AB232098_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY494). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSAGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232099_SHBs_P-C Product feature CHAIN AB232099_SHBs_P-C of FT:mat_peptide AB232099_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY496). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232100_SHBs_P-C Product feature CHAIN AB232100_SHBs_P-C of FT:mat_peptide AB232100_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY505). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPPLVLQAGFSLLTRILTIPKSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTIWNPFLPLLLIFFCLWVYI
>gnl|hbvpro|AB232101_SHBs_P-C Product feature CHAIN AB232101_SHBs_P-C of FT:mat_peptide AB232101_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY515). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSQTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232102_SHBs_P-C Product feature CHAIN AB232102_SHBs_P-C of FT:mat_peptide AB232102_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY521). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232103_SHBs_P-C Product feature CHAIN AB232103_SHBs_P-C of FT:mat_peptide AB232103_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY532). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSYWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232104_SHBs_P-C Product feature CHAIN AB232104_SHBs_P-C of FT:mat_peptide AB232104_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY568). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232105_SHBs_P-C Product feature CHAIN AB232105_SHBs_P-C of FT:mat_peptide AB232105_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY573). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232106_SHBs_P-C Product feature CHAIN AB232106_SHBs_P-C of FT:mat_peptide AB232106_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY577). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVRPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232107_SHBs_P-C Product feature CHAIN AB232107_SHBs_P-C of FT:mat_peptide AB232107_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY586). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232108_SHBs_P-C Product feature CHAIN AB232108_SHBs_P-C of FT:mat_peptide AB232108_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY604). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSXGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232109_SHBs_P-C Product feature CHAIN AB232109_SHBs_P-C of FT:mat_peptide AB232109_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY607). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232110_SHBs_P-C Product feature CHAIN AB232110_SHBs_P-C of FT:mat_peptide AB232110_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY681). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232111_SHBs_P-C Product feature CHAIN AB232111_SHBs_P-C of FT:mat_peptide AB232111_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY632). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFIPPLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232113_SHBs_P-C Product feature CHAIN AB232113_SHBs_P-C of FT:mat_peptide AB232113_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MY838). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVHLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232502_SHBs_P-C Product feature CHAIN AB232502_SHBs_P-C of FT:mat_peptide AB232502_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH77). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232503_SHBs_P-C Product feature CHAIN AB232503_SHBs_P-C of FT:mat_peptide AB232503_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH78). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232504_SHBs_P-C Product feature CHAIN AB232504_SHBs_P-C of FT:mat_peptide AB232504_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH79). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232505_SHBs_P-C Product feature CHAIN AB232505_SHBs_P-C of FT:mat_peptide AB232505_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH80). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232507_SHBs_P-C Product feature CHAIN AB232507_SHBs_P-C of FT:mat_peptide AB232507_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH81). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYTILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232508_SHBs_P-C Product feature CHAIN AB232508_SHBs_P-C of FT:mat_peptide AB232508_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLNNILNPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB232509_SHBs_P-C Product feature CHAIN AB232509_SHBs_P-C of FT:mat_peptide AB232509_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH93). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232510_SHBs_P-C Product feature CHAIN AB232510_SHBs_P-C of FT:mat_peptide AB232510_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH94). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232511_SHBs_P-C Product feature CHAIN AB232511_SHBs_P-C of FT:mat_peptide AB232511_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH103). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232512_SHBs_P-C Product feature CHAIN AB232512_SHBs_P-C of FT:mat_peptide AB232512_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH104). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232513_SHBs_P-C Product feature CHAIN AB232513_SHBs_P-C of FT:mat_peptide AB232513_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH108). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDCQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232514_SHBs_P-C Product feature CHAIN AB232514_SHBs_P-C of FT:mat_peptide AB232514_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH109). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232515_SHBs_P-C Product feature CHAIN AB232515_SHBs_P-C of FT:mat_peptide AB232515_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH111). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232516_SHBs_P-C Product feature CHAIN AB232516_SHBs_P-C of FT:mat_peptide AB232516_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232517_SHBs_P-C Product feature CHAIN AB232517_SHBs_P-C of FT:mat_peptide AB232517_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232518_SHBs_P-C Product feature CHAIN AB232518_SHBs_P-C of FT:mat_peptide AB232518_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH39). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232520_SHBs_P-C Product feature CHAIN AB232520_SHBs_P-C of FT:mat_peptide AB232520_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH64). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTGPAQGTSMKHSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232521_SHBs_P-C Product feature CHAIN AB232521_SHBs_P-C of FT:mat_peptide AB232521_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH65). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLGLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLSILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232522_SHBs_P-C Product feature CHAIN AB232522_SHBs_P-C of FT:mat_peptide AB232522_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH67). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNISSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232523_SHBs_P-C Product feature CHAIN AB232523_SHBs_P-C of FT:mat_peptide AB232523_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TH74). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNISSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB232524_SHBs_P-C Product feature CHAIN AB232524_SHBs_P-C of FT:mat_peptide AB232524_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate VT1027). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB241110_SHBs_P-C Product feature CHAIN AB241110_SHBs_P-C of FT:mat_peptide AB241110_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC03). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB241111_SHBs_P-C Product feature CHAIN AB241111_SHBs_P-C of FT:mat_peptide AB241111_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhLC14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB241112_SHBs_P-C Product feature CHAIN AB241112_SHBs_P-C of FT:mat_peptide AB241112_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhHCC15). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTNPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB241113_SHBs_P-C Product feature CHAIN AB241113_SHBs_P-C of FT:mat_peptide AB241113_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PhHCC13). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246344_SHBs_P-C Product feature CHAIN AB246344_SHBs_P-C of FT:mat_peptide AB246344_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMILYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246345_SHBs_P-C Product feature CHAIN AB246345_SHBs_P-C of FT:mat_peptide AB246345_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246346_SHBs_P-C Product feature CHAIN AB246346_SHBs_P-C of FT:mat_peptide AB246346_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLFPIFFCLWVYI
>gnl|hbvpro|AB247916_SHBs_P-C Product feature CHAIN AB247916_SHBs_P-C of FT:mat_peptide AB247916_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSLLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB250109_SHBs_P-C Product feature CHAIN AB250109_SHBs_P-C of FT:mat_peptide AB250109_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IH030213). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNTLRPFLPLLPIFFFLWVYI
>gnl|hbvpro|AB253407_SHBs_P-C Product feature CHAIN AB253407_SHBs_P-C of FT:mat_peptide AB253407_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate VC60). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTXTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCVPIPSSWAFAR
FLWEWASVRFSWLXLLVPFVQWFVXLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB253408_SHBs_P-C Product feature CHAIN AB253408_SHBs_P-C of FT:mat_peptide AB253408_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate VC61). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB253409_SHBs_P-C Product feature CHAIN AB253409_SHBs_P-C of FT:mat_peptide AB253409_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate VC66). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MECTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB253411_SHBs_P-C Product feature CHAIN AB253411_SHBs_P-C of FT:mat_peptide AB253411_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate VC72). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLXXLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB253412_SHBs_P-C Product feature CHAIN AB253412_SHBs_P-C of FT:mat_peptide AB253412_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate VC91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB253611_SHBs_P-C Product feature CHAIN AB253611_SHBs_P-C of FT:mat_peptide AB253611_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TV82). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCRIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB253612_SHBs_P-C Product feature CHAIN AB253612_SHBs_P-C of FT:mat_peptide AB253612_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TV83). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWICLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB253615_SHBs_P-C Product feature CHAIN AB253615_SHBs_P-C of FT:mat_peptide AB253615_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TV87). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB253620_SHBs_P-C Product feature CHAIN AB253620_SHBs_P-C of FT:mat_peptide AB253620_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TV93). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB284371_SHBs_P-C Product feature CHAIN AB284371_SHBs_P-C of FT:mat_peptide AB284371_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTISAQGTSMFPSCCCTKPSDGNCTCIPIPSSWASAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB288026_SHBs_P-C Product feature CHAIN AB288026_SHBs_P-C of FT:mat_peptide AB288026_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNWQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB298720_SHBs_P-C Product feature CHAIN AB298720_SHBs_P-C of FT:mat_peptide AB298720_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1S). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB298721_SHBs_P-C Product feature CHAIN AB298721_SHBs_P-C of FT:mat_peptide AB298721_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BAJT2006-1C). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB299858_SHBs_P-C Product feature CHAIN AB299858_SHBs_P-C of FT:mat_peptide AB299858_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB300359_SHBs_P-C Product feature CHAIN AB300359_SHBs_P-C of FT:mat_peptide AB300359_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300360_SHBs_P-C Product feature CHAIN AB300360_SHBs_P-C of FT:mat_peptide AB300360_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPGLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300361_SHBs_P-C Product feature CHAIN AB300361_SHBs_P-C of FT:mat_peptide AB300361_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300362_SHBs_P-C Product feature CHAIN AB300362_SHBs_P-C of FT:mat_peptide AB300362_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300363_SHBs_P-C Product feature CHAIN AB300363_SHBs_P-C of FT:mat_peptide AB300363_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300365_SHBs_P-C Product feature CHAIN AB300365_SHBs_P-C of FT:mat_peptide AB300365_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient7). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300368_SHBs_P-C Product feature CHAIN AB300368_SHBs_P-C of FT:mat_peptide AB300368_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient10). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300372_SHBs_P-C Product feature CHAIN AB300372_SHBs_P-C of FT:mat_peptide AB300372_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient14). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWASAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB300373_SHBs_P-C Product feature CHAIN AB300373_SHBs_P-C of FT:mat_peptide AB300373_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient15). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB362932_SHBs_P-C Product feature CHAIN AB362932_SHBs_P-C of FT:mat_peptide AB362932_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB365438_SHBs_P-C Product feature CHAIN AB365438_SHBs_P-C of FT:mat_peptide AB365438_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL123). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB365439_SHBs_P-C Product feature CHAIN AB365439_SHBs_P-C of FT:mat_peptide AB365439_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL182). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB365440_SHBs_P-C Product feature CHAIN AB365440_SHBs_P-C of FT:mat_peptide AB365440_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL414). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB365442_SHBs_P-C Product feature CHAIN AB365442_SHBs_P-C of FT:mat_peptide AB365442_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL583). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB365451_SHBs_P-C Product feature CHAIN AB365451_SHBs_P-C of FT:mat_peptide AB365451_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BOL196). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367392_SHBs_P-C Product feature CHAIN AB367392_SHBs_P-C of FT:mat_peptide AB367392_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTKILTIPQSLDLWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWFWGRSLYNILSPFLPLLPIFFRLWVYI
>gnl|hbvpro|AB367394_SHBs_P-C Product feature CHAIN AB367394_SHBs_P-C of FT:mat_peptide AB367394_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 3/Adefovir-treated Pt. 8). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367395_SHBs_P-C Product feature CHAIN AB367395_SHBs_P-C of FT:mat_peptide AB367395_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367396_SHBs_P-C Product feature CHAIN AB367396_SHBs_P-C of FT:mat_peptide AB367396_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367397_SHBs_P-C Product feature CHAIN AB367397_SHBs_P-C of FT:mat_peptide AB367397_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367398_SHBs_P-C Product feature CHAIN AB367398_SHBs_P-C of FT:mat_peptide AB367398_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 7/Adefovir-treated Pt. 20). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367399_SHBs_P-C Product feature CHAIN AB367399_SHBs_P-C of FT:mat_peptide AB367399_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 8/Adefovir-treated Pt. 29). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367401_SHBs_P-C Product feature CHAIN AB367401_SHBs_P-C of FT:mat_peptide AB367401_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 10/Adefovir-treated Pt. 9). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB367402_SHBs_P-C Product feature CHAIN AB367402_SHBs_P-C of FT:mat_peptide AB367402_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 11). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367403_SHBs_P-C Product feature CHAIN AB367403_SHBs_P-C of FT:mat_peptide AB367403_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 12/Adefovir-treated Pt. 17). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367404_SHBs_P-C Product feature CHAIN AB367404_SHBs_P-C of FT:mat_peptide AB367404_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 13/Adefovir-treated Pt. 22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367405_SHBs_P-C Product feature CHAIN AB367405_SHBs_P-C of FT:mat_peptide AB367405_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 14/Adefovir-treated Pt. 25). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGQSLYNTLSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367406_SHBs_P-C Product feature CHAIN AB367406_SHBs_P-C of FT:mat_peptide AB367406_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 15/Adefovir-treated Pt. 7). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTCNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367407_SHBs_P-C Product feature CHAIN AB367407_SHBs_P-C of FT:mat_peptide AB367407_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 16/Adefovir-treated Pt. 11). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367408_SHBs_P-C Product feature CHAIN AB367408_SHBs_P-C of FT:mat_peptide AB367408_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 17/Adefovir-treated Pt. 14). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367409_SHBs_P-C Product feature CHAIN AB367409_SHBs_P-C of FT:mat_peptide AB367409_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 18). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCMTCTTPAHGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367410_SHBs_P-C Product feature CHAIN AB367410_SHBs_P-C of FT:mat_peptide AB367410_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 19/Adefovir-treated Pt. 19). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMWLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367411_SHBs_P-C Product feature CHAIN AB367411_SHBs_P-C of FT:mat_peptide AB367411_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWFSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB367412_SHBs_P-C Product feature CHAIN AB367412_SHBs_P-C of FT:mat_peptide AB367412_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 21). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367413_SHBs_P-C Product feature CHAIN AB367413_SHBs_P-C of FT:mat_peptide AB367413_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 22/Adefovir-treated Pt. 4). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367414_SHBs_P-C Product feature CHAIN AB367414_SHBs_P-C of FT:mat_peptide AB367414_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 23/Adefovir-treated Pt. 3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367416_SHBs_P-C Product feature CHAIN AB367416_SHBs_P-C of FT:mat_peptide AB367416_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMWLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367417_SHBs_P-C Product feature CHAIN AB367417_SHBs_P-C of FT:mat_peptide AB367417_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPISFCLWVYI
>gnl|hbvpro|AB367418_SHBs_P-C Product feature CHAIN AB367418_SHBs_P-C of FT:mat_peptide AB367418_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 27/Adefovir-treated Pt. 21). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGTCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMIWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367420_SHBs_P-C Product feature CHAIN AB367420_SHBs_P-C of FT:mat_peptide AB367420_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPNLYNILSPFLPLLPIFCLLWVYI
>gnl|hbvpro|AB367422_SHBs_P-C Product feature CHAIN AB367422_SHBs_P-C of FT:mat_peptide AB367422_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 31/Adefovir-treated Pt. 12). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367423_SHBs_P-C Product feature CHAIN AB367423_SHBs_P-C of FT:mat_peptide AB367423_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 32/Adefovir-treated Pt. 28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367424_SHBs_P-C Product feature CHAIN AB367424_SHBs_P-C of FT:mat_peptide AB367424_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 33). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367425_SHBs_P-C Product feature CHAIN AB367425_SHBs_P-C of FT:mat_peptide AB367425_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 34/Adefovir-treated Pt. 15). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367426_SHBs_P-C Product feature CHAIN AB367426_SHBs_P-C of FT:mat_peptide AB367426_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 35). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGRNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWASAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367427_SHBs_P-C Product feature CHAIN AB367427_SHBs_P-C of FT:mat_peptide AB367427_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 36/Adefovir-treated Pt. 18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB367428_SHBs_P-C Product feature CHAIN AB367428_SHBs_P-C of FT:mat_peptide AB367428_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 37/Adefovir-treated Pt. 10). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWIYI
>gnl|hbvpro|AB367429_SHBs_P-C Product feature CHAIN AB367429_SHBs_P-C of FT:mat_peptide AB367429_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 38). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGISMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILRPFIPLLPIFFFLWVYI
>gnl|hbvpro|AB367430_SHBs_P-C Product feature CHAIN AB367430_SHBs_P-C of FT:mat_peptide AB367430_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 39/Adefovir-treated Pt. 5). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLVPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367431_SHBs_P-C Product feature CHAIN AB367431_SHBs_P-C of FT:mat_peptide AB367431_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 40). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367432_SHBs_P-C Product feature CHAIN AB367432_SHBs_P-C of FT:mat_peptide AB367432_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 41). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367433_SHBs_P-C Product feature CHAIN AB367433_SHBs_P-C of FT:mat_peptide AB367433_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 42/Adefovir-treated Pt. 27). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLSILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367434_SHBs_P-C Product feature CHAIN AB367434_SHBs_P-C of FT:mat_peptide AB367434_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 43/Adefovir-treated Pt. 26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGRNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB367435_SHBs_P-C Product feature CHAIN AB367435_SHBs_P-C of FT:mat_peptide AB367435_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate LAMr Pt. 44/Adefovir-treated Pt. 23). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPRLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB367801_SHBs_P-C Product feature CHAIN AB367801_SHBs_P-C of FT:mat_peptide AB367801_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 30). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGRNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWASAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367802_SHBs_P-C Product feature CHAIN AB367802_SHBs_P-C of FT:mat_peptide AB367802_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 16). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB367803_SHBs_P-C Product feature CHAIN AB367803_SHBs_P-C of FT:mat_peptide AB367803_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMWLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB367804_SHBs_P-C Product feature CHAIN AB367804_SHBs_P-C of FT:mat_peptide AB367804_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ADVT Pt. 6). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB368297_SHBs_P-C Product feature CHAIN AB368297_SHBs_P-C of FT:mat_peptide AB368297_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB426467_SHBs_P-C Product feature CHAIN AB426467_SHBs_P-C of FT:mat_peptide AB426467_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB471848_SHBs_P-C Product feature CHAIN AB471848_SHBs_P-C of FT:mat_peptide AB471848_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-F). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471849_SHBs_P-C Product feature CHAIN AB471849_SHBs_P-C of FT:mat_peptide AB471849_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471850_SHBs_P-C Product feature CHAIN AB471850_SHBs_P-C of FT:mat_peptide AB471850_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F1S-C1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471851_SHBs_P-C Product feature CHAIN AB471851_SHBs_P-C of FT:mat_peptide AB471851_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2NK-F). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471852_SHBs_P-C Product feature CHAIN AB471852_SHBs_P-C of FT:mat_peptide AB471852_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471853_SHBs_P-C Product feature CHAIN AB471853_SHBs_P-C of FT:mat_peptide AB471853_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F2S-C3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB485808_SHBs_P-C Product feature CHAIN AB485808_SHBs_P-C of FT:mat_peptide AB485808_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HBV-IT). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB485810_SHBs_P-C Product feature CHAIN AB485810_SHBs_P-C of FT:mat_peptide AB485810_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FEP2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB493839_SHBs_P-C Product feature CHAIN AB493839_SHBs_P-C of FT:mat_peptide AB493839_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 08UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB493844_SHBs_P-C Product feature CHAIN AB493844_SHBs_P-C of FT:mat_peptide AB493844_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 43UC). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB640730_SHBs_P-C Product feature CHAIN AB640730_SHBs_P-C of FT:mat_peptide AB640730_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ehime-EPCH-HBV-C1-HN). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642095_SHBs_P-C Product feature CHAIN AB642095_SHBs_P-C of FT:mat_peptide AB642095_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2000-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642097_SHBs_P-C Product feature CHAIN AB642097_SHBs_P-C of FT:mat_peptide AB642097_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2003-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGYFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642099_SHBs_P-C Product feature CHAIN AB642099_SHBs_P-C of FT:mat_peptide AB642099_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2005-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB642100_SHBs_P-C Product feature CHAIN AB642100_SHBs_P-C of FT:mat_peptide AB642100_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate BFJT2006-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670237_SHBs_P-C Product feature CHAIN AB670237_SHBs_P-C of FT:mat_peptide AB670237_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHXPTSCPPTXPGYRWMCLXRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQXTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFXCLWVYI
>gnl|hbvpro|AB670238_SHBs_P-C Product feature CHAIN AB670238_SHBs_P-C of FT:mat_peptide AB670238_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSLTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670239_SHBs_P-C Product feature CHAIN AB670239_SHBs_P-C of FT:mat_peptide AB670239_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB670240_SHBs_P-C Product feature CHAIN AB670240_SHBs_P-C of FT:mat_peptide AB670240_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB670241_SHBs_P-C Product feature CHAIN AB670241_SHBs_P-C of FT:mat_peptide AB670241_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFXGLSPTVWLSVIWMXWYWGXSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB670242_SHBs_P-C Product feature CHAIN AB670242_SHBs_P-C of FT:mat_peptide AB670242_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.6). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670243_SHBs_P-C Product feature CHAIN AB670243_SHBs_P-C of FT:mat_peptide AB670243_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.7). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670247_SHBs_P-C Product feature CHAIN AB670247_SHBs_P-C of FT:mat_peptide AB670247_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.11). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670249_SHBs_P-C Product feature CHAIN AB670249_SHBs_P-C of FT:mat_peptide AB670249_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670251_SHBs_P-C Product feature CHAIN AB670251_SHBs_P-C of FT:mat_peptide AB670251_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670252_SHBs_P-C Product feature CHAIN AB670252_SHBs_P-C of FT:mat_peptide AB670252_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.16). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670253_SHBs_P-C Product feature CHAIN AB670253_SHBs_P-C of FT:mat_peptide AB670253_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLALQAGFFLLTRILTILKNLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670255_SHBs_P-C Product feature CHAIN AB670255_SHBs_P-C of FT:mat_peptide AB670255_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.19). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670256_SHBs_P-C Product feature CHAIN AB670256_SHBs_P-C of FT:mat_peptide AB670256_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.20). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670258_SHBs_P-C Product feature CHAIN AB670258_SHBs_P-C of FT:mat_peptide AB670258_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.22). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMWLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670259_SHBs_P-C Product feature CHAIN AB670259_SHBs_P-C of FT:mat_peptide AB670259_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.23). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPKCLGQSSQSPTCNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670260_SHBs_P-C Product feature CHAIN AB670260_SHBs_P-C of FT:mat_peptide AB670260_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.24). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSGIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670261_SHBs_P-C Product feature CHAIN AB670261_SHBs_P-C of FT:mat_peptide AB670261_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670262_SHBs_P-C Product feature CHAIN AB670262_SHBs_P-C of FT:mat_peptide AB670262_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.26). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670263_SHBs_P-C Product feature CHAIN AB670263_SHBs_P-C of FT:mat_peptide AB670263_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.27). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670264_SHBs_P-C Product feature CHAIN AB670264_SHBs_P-C of FT:mat_peptide AB670264_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB670265_SHBs_P-C Product feature CHAIN AB670265_SHBs_P-C of FT:mat_peptide AB670265_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.29). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGRNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670266_SHBs_P-C Product feature CHAIN AB670266_SHBs_P-C of FT:mat_peptide AB670266_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.30). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670267_SHBs_P-C Product feature CHAIN AB670267_SHBs_P-C of FT:mat_peptide AB670267_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.31). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCXTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670268_SHBs_P-C Product feature CHAIN AB670268_SHBs_P-C of FT:mat_peptide AB670268_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.32). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPACRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLSNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670269_SHBs_P-C Product feature CHAIN AB670269_SHBs_P-C of FT:mat_peptide AB670269_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.33). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB670270_SHBs_P-C Product feature CHAIN AB670270_SHBs_P-C of FT:mat_peptide AB670270_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB670272_SHBs_P-C Product feature CHAIN AB670272_SHBs_P-C of FT:mat_peptide AB670272_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVISMMWFWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670273_SHBs_P-C Product feature CHAIN AB670273_SHBs_P-C of FT:mat_peptide AB670273_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HCC pt No.37). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670274_SHBs_P-C Product feature CHAIN AB670274_SHBs_P-C of FT:mat_peptide AB670274_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCQRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWYWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670275_SHBs_P-C Product feature CHAIN AB670275_SHBs_P-C of FT:mat_peptide AB670275_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|AB670276_SHBs_P-C Product feature CHAIN AB670276_SHBs_P-C of FT:mat_peptide AB670276_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670277_SHBs_P-C Product feature CHAIN AB670277_SHBs_P-C of FT:mat_peptide AB670277_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTSPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670278_SHBs_P-C Product feature CHAIN AB670278_SHBs_P-C of FT:mat_peptide AB670278_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670279_SHBs_P-C Product feature CHAIN AB670279_SHBs_P-C of FT:mat_peptide AB670279_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTAAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670281_SHBs_P-C Product feature CHAIN AB670281_SHBs_P-C of FT:mat_peptide AB670281_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.8). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670282_SHBs_P-C Product feature CHAIN AB670282_SHBs_P-C of FT:mat_peptide AB670282_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.9). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670283_SHBs_P-C Product feature CHAIN AB670283_SHBs_P-C of FT:mat_peptide AB670283_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.10). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670285_SHBs_P-C Product feature CHAIN AB670285_SHBs_P-C of FT:mat_peptide AB670285_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILXLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670287_SHBs_P-C Product feature CHAIN AB670287_SHBs_P-C of FT:mat_peptide AB670287_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.14). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670288_SHBs_P-C Product feature CHAIN AB670288_SHBs_P-C of FT:mat_peptide AB670288_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.15). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670289_SHBs_P-C Product feature CHAIN AB670289_SHBs_P-C of FT:mat_peptide AB670289_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRXLTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670290_SHBs_P-C Product feature CHAIN AB670290_SHBs_P-C of FT:mat_peptide AB670290_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.17). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPPLPIFFCLWVYI
>gnl|hbvpro|AB670291_SHBs_P-C Product feature CHAIN AB670291_SHBs_P-C of FT:mat_peptide AB670291_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.18). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670292_SHBs_P-C Product feature CHAIN AB670292_SHBs_P-C of FT:mat_peptide AB670292_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.19). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670295_SHBs_P-C Product feature CHAIN AB670295_SHBs_P-C of FT:mat_peptide AB670295_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.22). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670297_SHBs_P-C Product feature CHAIN AB670297_SHBs_P-C of FT:mat_peptide AB670297_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.24). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670298_SHBs_P-C Product feature CHAIN AB670298_SHBs_P-C of FT:mat_peptide AB670298_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.25). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPANGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWFWGRSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB670300_SHBs_P-C Product feature CHAIN AB670300_SHBs_P-C of FT:mat_peptide AB670300_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.27). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGRNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670301_SHBs_P-C Product feature CHAIN AB670301_SHBs_P-C of FT:mat_peptide AB670301_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.28). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670302_SHBs_P-C Product feature CHAIN AB670302_SHBs_P-C of FT:mat_peptide AB670302_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB670304_SHBs_P-C Product feature CHAIN AB670304_SHBs_P-C of FT:mat_peptide AB670304_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.31). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670305_SHBs_P-C Product feature CHAIN AB670305_SHBs_P-C of FT:mat_peptide AB670305_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670306_SHBs_P-C Product feature CHAIN AB670306_SHBs_P-C of FT:mat_peptide AB670306_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.33). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRRMCLRRF
IIFLFILLLCLIFLWVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670307_SHBs_P-C Product feature CHAIN AB670307_SHBs_P-C of FT:mat_peptide AB670307_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.34). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670308_SHBs_P-C Product feature CHAIN AB670308_SHBs_P-C of FT:mat_peptide AB670308_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.35). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCFIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|AB670310_SHBs_P-C Product feature CHAIN AB670310_SHBs_P-C of FT:mat_peptide AB670310_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.37). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB670311_SHBs_P-C Product feature CHAIN AB670311_SHBs_P-C of FT:mat_peptide AB670311_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Non-HCC pt No.38). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB675674_SHBs_P-C Product feature CHAIN AB675674_SHBs_P-C of FT:mat_peptide AB675674_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A33). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTIPAQGPSMFPSCCCSKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|AB675675_SHBs_P-C Product feature CHAIN AB675675_SHBs_P-C of FT:mat_peptide AB675675_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A34). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTIPAQGPSMFPSCCCSKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|AB675677_SHBs_P-C Product feature CHAIN AB675677_SHBs_P-C of FT:mat_peptide AB675677_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 10A39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697490_SHBs_P-C Product feature CHAIN AB697490_SHBs_P-C of FT:mat_peptide AB697490_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697494_SHBs_P-C Product feature CHAIN AB697494_SHBs_P-C of FT:mat_peptide AB697494_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No9). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697500_SHBs_P-C Product feature CHAIN AB697500_SHBs_P-C of FT:mat_peptide AB697500_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No17). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697502_SHBs_P-C Product feature CHAIN AB697502_SHBs_P-C of FT:mat_peptide AB697502_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No20). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXXGPRLYTILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB697510_SHBs_P-C Product feature CHAIN AB697510_SHBs_P-C of FT:mat_peptide AB697510_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate No33). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB713885_SHBs_P-C Product feature CHAIN AB713885_SHBs_P-C of FT:mat_peptide AB713885_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YOGHhbv84). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLRCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRVSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB713890_SHBs_P-C Product feature CHAIN AB713890_SHBs_P-C of FT:mat_peptide AB713890_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate YOGHhbv105). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|AB809473_SHBs_P-C Product feature CHAIN AB809473_SHBs_P-C of FT:mat_peptide AB809473_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUR13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|AB809475_SHBs_P-C Product feature CHAIN AB809475_SHBs_P-C of FT:mat_peptide AB809475_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWFSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809525_SHBs_P-C Product feature CHAIN AB809525_SHBs_P-C of FT:mat_peptide AB809525_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Kagoshima-S-2006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGPNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMLPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFFWLSLPVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809527_SHBs_P-C Product feature CHAIN AB809527_SHBs_P-C of FT:mat_peptide AB809527_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Miyazaki-S-2006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEITTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSKGPCRTCTIPAPGTSMFPSCCCTKPSDANCTCIPIPSSWAFGK
FLWESASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|AB809530_SHBs_P-C Product feature CHAIN AB809530_SHBs_P-C of FT:mat_peptide AB809530_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi2-S-2006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809531_SHBs_P-C Product feature CHAIN AB809531_SHBs_P-C of FT:mat_peptide AB809531_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi1-S-2007). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKNCTIPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809535_SHBs_P-C Product feature CHAIN AB809535_SHBs_P-C of FT:mat_peptide AB809535_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi1-S-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809536_SHBs_P-C Product feature CHAIN AB809536_SHBs_P-C of FT:mat_peptide AB809536_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi2-S-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLSILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809539_SHBs_P-C Product feature CHAIN AB809539_SHBs_P-C of FT:mat_peptide AB809539_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Osaka3-S-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809540_SHBs_P-C Product feature CHAIN AB809540_SHBs_P-C of FT:mat_peptide AB809540_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Osaka4-S-2008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809545_SHBs_P-C Product feature CHAIN AB809545_SHBs_P-C of FT:mat_peptide AB809545_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi2-S-2009). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809546_SHBs_P-C Product feature CHAIN AB809546_SHBs_P-C of FT:mat_peptide AB809546_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi3-S-2009). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809548_SHBs_P-C Product feature CHAIN AB809548_SHBs_P-C of FT:mat_peptide AB809548_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Gifu-S-2009). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTKILTMPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSHTVWLLVIWMMWYWGPNLYNTLSPFLHLLPIFCCLWVYI
>gnl|hbvpro|AB809549_SHBs_P-C Product feature CHAIN AB809549_SHBs_P-C of FT:mat_peptide AB809549_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Wakayama-S-2010). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809550_SHBs_P-C Product feature CHAIN AB809550_SHBs_P-C of FT:mat_peptide AB809550_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Okayama-S-2010). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNTLSPSLPLLPIFFCLWVYI
>gnl|hbvpro|AB809551_SHBs_P-C Product feature CHAIN AB809551_SHBs_P-C of FT:mat_peptide AB809551_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi1-S-2011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLISLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB809553_SHBs_P-C Product feature CHAIN AB809553_SHBs_P-C of FT:mat_peptide AB809553_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi3-S-2011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809554_SHBs_P-C Product feature CHAIN AB809554_SHBs_P-C of FT:mat_peptide AB809554_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi4-S-2011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809555_SHBs_P-C Product feature CHAIN AB809555_SHBs_P-C of FT:mat_peptide AB809555_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi5-S-2011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
METTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLSFLGGAHACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFRGMLPVCPLLPGTSTTSTGPCRTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809556_SHBs_P-C Product feature CHAIN AB809556_SHBs_P-C of FT:mat_peptide AB809556_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi6-S-2011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTTPAANISMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB809557_SHBs_P-C Product feature CHAIN AB809557_SHBs_P-C of FT:mat_peptide AB809557_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Aichi7-S-2011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900099_SHBs_P-C Product feature CHAIN AB900099_SHBs_P-C of FT:mat_peptide AB900099_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900109_SHBs_P-C Product feature CHAIN AB900109_SHBs_P-C of FT:mat_peptide AB900109_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPACRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|AB900113_SHBs_P-C Product feature CHAIN AB900113_SHBs_P-C of FT:mat_peptide AB900113_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGAPTCPGQNSQCPTSNHSPTSCPPICPGYRWMCLRHF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900115_SHBs_P-C Product feature CHAIN AB900115_SHBs_P-C of FT:mat_peptide AB900115_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB900116_SHBs_P-C Product feature CHAIN AB900116_SHBs_P-C of FT:mat_peptide AB900116_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB931170_SHBs_P-C Product feature CHAIN AB931170_SHBs_P-C of FT:mat_peptide AB931170_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2P_HB11-0921). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDWKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB931171_SHBs_P-C Product feature CHAIN AB931171_SHBs_P-C of FT:mat_peptide AB931171_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2S_HB11-0922). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB971714_SHBs_P-C Product feature CHAIN AB971714_SHBs_P-C of FT:mat_peptide AB971714_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1026). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB971715_SHBs_P-C Product feature CHAIN AB971715_SHBs_P-C of FT:mat_peptide AB971715_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HB11-1027). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTTLVQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF013631_SHBs_P-C Product feature CHAIN AF013631_SHBs_P-C of FT:mat_peptide AF013631_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPAYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF036236_SHBs_P-C Product feature CHAIN AF036236_SHBs_P-C of FT:mat_peptide AF036236_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPAYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF036237_SHBs_P-C Product feature CHAIN AF036237_SHBs_P-C of FT:mat_peptide AF036237_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPAYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF036238_SHBs_P-C Product feature CHAIN AF036238_SHBs_P-C of FT:mat_peptide AF036238_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPAYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF036239_SHBs_P-C Product feature CHAIN AF036239_SHBs_P-C of FT:mat_peptide AF036239_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTCNHSPTSCPPICPAYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF068756_SHBs_P-C Product feature CHAIN AF068756_SHBs_P-C of FT:mat_peptide AF068756_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF134139_SHBs_P-C Product feature CHAIN AF134139_SHBs_P-C of FT:mat_peptide AF134139_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF182802_SHBs_P-C Product feature CHAIN AF182802_SHBs_P-C of FT:mat_peptide AF182802_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MQNTTSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASIRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|AF182803_SHBs_P-C Product feature CHAIN AF182803_SHBs_P-C of FT:mat_peptide AF182803_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLVFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASIRFSWLSLLVPFVQWVVRLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|AF182804_SHBs_P-C Product feature CHAIN AF182804_SHBs_P-C of FT:mat_peptide AF182804_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|AF208867_SHBs_P-C Product feature CHAIN AF208867_SHBs_P-C of FT:mat_peptide AF208867_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate gk4422). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCHIFLLVLLDYQGILPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF208868_SHBs_P-C Product feature CHAIN AF208868_SHBs_P-C of FT:mat_peptide AF208868_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate gs817). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCHIFLLVLLDYQGILPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF208869_SHBs_P-C Product feature CHAIN AF208869_SHBs_P-C of FT:mat_peptide AF208869_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ib2556). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCHIFLLVLLDYQGILPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF208876_SHBs_P-C Product feature CHAIN AF208876_SHBs_P-C of FT:mat_peptide AF208876_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate pal6191). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFRSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPLIPLLPIFFCLWVYI
>gnl|hbvpro|AF209390_SHBs_P-C Product feature CHAIN AF209390_SHBs_P-C of FT:mat_peptide AF209390_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ab9932). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MECTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGAPTCLGHNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTGTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEGASVRFSLLSLLVPFVQWFAGLSPTVWLSLIWMMWYGGPSLYSILSPFLPRLPIFFCLWVYI
>gnl|hbvpro|AF209402_SHBs_P-C Product feature CHAIN AF209402_SHBs_P-C of FT:mat_peptide AF209402_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate sc036). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF223954_SHBs_P-C Product feature CHAIN AF223954_SHBs_P-C of FT:mat_peptide AF223954_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223955_SHBs_P-C Product feature CHAIN AF223955_SHBs_P-C of FT:mat_peptide AF223955_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223956_SHBs_P-C Product feature CHAIN AF223956_SHBs_P-C of FT:mat_peptide AF223956_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223957_SHBs_P-C Product feature CHAIN AF223957_SHBs_P-C of FT:mat_peptide AF223957_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea4). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223958_SHBs_P-C Product feature CHAIN AF223958_SHBs_P-C of FT:mat_peptide AF223958_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223959_SHBs_P-C Product feature CHAIN AF223959_SHBs_P-C of FT:mat_peptide AF223959_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea6). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223960_SHBs_P-C Product feature CHAIN AF223960_SHBs_P-C of FT:mat_peptide AF223960_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea7). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF223961_SHBs_P-C Product feature CHAIN AF223961_SHBs_P-C of FT:mat_peptide AF223961_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ea8). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF241410_SHBs_P-C Product feature CHAIN AF241410_SHBs_P-C of FT:mat_peptide AF241410_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3270). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF241411_SHBs_P-C Product feature CHAIN AF241411_SHBs_P-C of FT:mat_peptide AF241411_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8290). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXXSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF286594_SHBs_P-C Product feature CHAIN AF286594_SHBs_P-C of FT:mat_peptide AF286594_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF329858_SHBs_P-C Product feature CHAIN AF329858_SHBs_P-C of FT:mat_peptide AF329858_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTRTGPCKNCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFAQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF329861_SHBs_P-C Product feature CHAIN AF329861_SHBs_P-C of FT:mat_peptide AF329861_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFAQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF329862_SHBs_P-C Product feature CHAIN AF329862_SHBs_P-C of FT:mat_peptide AF329862_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF329864_SHBs_P-C Product feature CHAIN AF329864_SHBs_P-C of FT:mat_peptide AF329864_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF329865_SHBs_P-C Product feature CHAIN AF329865_SHBs_P-C of FT:mat_peptide AF329865_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF335735_SHBs_P-C Product feature CHAIN AF335735_SHBs_P-C of FT:mat_peptide AF335735_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 702). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=223 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGNSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLW
EWASVRFSWLSLLVPFAQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF335736_SHBs_P-C Product feature CHAIN AF335736_SHBs_P-C of FT:mat_peptide AF335736_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 702). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=223 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLW
EWASVRFSWLSLLVPFAQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF363961_SHBs_P-C Product feature CHAIN AF363961_SHBs_P-C of FT:mat_peptide AF363961_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWASAR
FLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF384371_SHBs_P-C Product feature CHAIN AF384371_SHBs_P-C of FT:mat_peptide AF384371_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|AF384372_SHBs_P-C Product feature CHAIN AF384372_SHBs_P-C of FT:mat_peptide AF384372_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G376-A6). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=228 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAF
ARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF411408_SHBs_P-C Product feature CHAIN AF411408_SHBs_P-C of FT:mat_peptide AF411408_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF411410_SHBs_P-C Product feature CHAIN AF411410_SHBs_P-C of FT:mat_peptide AF411410_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPPPWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF411411_SHBs_P-C Product feature CHAIN AF411411_SHBs_P-C of FT:mat_peptide AF411411_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF411412_SHBs_P-C Product feature CHAIN AF411412_SHBs_P-C of FT:mat_peptide AF411412_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF415218_SHBs_P-C Product feature CHAIN AF415218_SHBs_P-C of FT:mat_peptide AF415218_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICLGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTEPSDGNFTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLSLLPIFFCLWVYI
>gnl|hbvpro|AF415219_SHBs_P-C Product feature CHAIN AF415219_SHBs_P-C of FT:mat_peptide AF415219_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGNSTFPSCCCTKPSDRNRTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF415220_SHBs_P-C Product feature CHAIN AF415220_SHBs_P-C of FT:mat_peptide AF415220_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTASTGPCKACMIPAQGNSTFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF415223_SHBs_P-C Product feature CHAIN AF415223_SHBs_P-C of FT:mat_peptide AF415223_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCNTCTIPANGTSMFPSCYCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLMPFIQWFVGLSPTVWLSVIWMMWYXGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF458664_SHBs_P-C Product feature CHAIN AF458664_SHBs_P-C of FT:mat_peptide AF458664_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C84). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF458665_SHBs_P-C Product feature CHAIN AF458665_SHBs_P-C of FT:mat_peptide AF458665_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C733). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTTGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRCF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461357_SHBs_P-C Product feature CHAIN AF461357_SHBs_P-C of FT:mat_peptide AF461357_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPCLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461358_SHBs_P-C Product feature CHAIN AF461358_SHBs_P-C of FT:mat_peptide AF461358_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH8). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCAIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461359_SHBs_P-C Product feature CHAIN AF461359_SHBs_P-C of FT:mat_peptide AF461359_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate c16). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCAIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF461363_SHBs_P-C Product feature CHAIN AF461363_SHBs_P-C of FT:mat_peptide AF461363_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPCLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF473543_SHBs_P-C Product feature CHAIN AF473543_SHBs_P-C of FT:mat_peptide AF473543_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2e). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF533983_SHBs_P-C Product feature CHAIN AF533983_SHBs_P-C of FT:mat_peptide AF533983_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTVPQSLDSRWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWTCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ748098_SHBs_P-C Product feature CHAIN AJ748098_SHBs_P-C of FT:mat_peptide AJ748098_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient Z1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011097_SHBs_P-C Product feature CHAIN AP011097_SHBs_P-C of FT:mat_peptide AP011097_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011098_SHBs_P-C Product feature CHAIN AP011098_SHBs_P-C of FT:mat_peptide AP011098_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011099_SHBs_P-C Product feature CHAIN AP011099_SHBs_P-C of FT:mat_peptide AP011099_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011100_SHBs_P-C Product feature CHAIN AP011100_SHBs_P-C of FT:mat_peptide AP011100_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011101_SHBs_P-C Product feature CHAIN AP011101_SHBs_P-C of FT:mat_peptide AP011101_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011106_SHBs_P-C Product feature CHAIN AP011106_SHBs_P-C of FT:mat_peptide AP011106_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AP011107_SHBs_P-C Product feature CHAIN AP011107_SHBs_P-C of FT:mat_peptide AP011107_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY057947_SHBs_P-C Product feature CHAIN AY057947_SHBs_P-C of FT:mat_peptide AY057947_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Tibet705). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY066028_SHBs_P-C Product feature CHAIN AY066028_SHBs_P-C of FT:mat_peptide AY066028_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate FH4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122487_SHBs_P-C Product feature CHAIN AY122487_SHBs_P-C of FT:mat_peptide AY122487_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F010). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122488_SHBs_P-C Product feature CHAIN AY122488_SHBs_P-C of FT:mat_peptide AY122488_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F078). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVK
FLWEWASVRFSWLSSLAPFVHWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122489_SHBs_P-C Product feature CHAIN AY122489_SHBs_P-C of FT:mat_peptide AY122489_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F105). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122490_SHBs_P-C Product feature CHAIN AY122490_SHBs_P-C of FT:mat_peptide AY122490_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F123). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSPSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122491_SHBs_P-C Product feature CHAIN AY122491_SHBs_P-C of FT:mat_peptide AY122491_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F131). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122492_SHBs_P-C Product feature CHAIN AY122492_SHBs_P-C of FT:mat_peptide AY122492_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F139). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122493_SHBs_P-C Product feature CHAIN AY122493_SHBs_P-C of FT:mat_peptide AY122493_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F157). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122494_SHBs_P-C Product feature CHAIN AY122494_SHBs_P-C of FT:mat_peptide AY122494_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F204). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122495_SHBs_P-C Product feature CHAIN AY122495_SHBs_P-C of FT:mat_peptide AY122495_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F211). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122496_SHBs_P-C Product feature CHAIN AY122496_SHBs_P-C of FT:mat_peptide AY122496_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F254). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122497_SHBs_P-C Product feature CHAIN AY122497_SHBs_P-C of FT:mat_peptide AY122497_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F261). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLREAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122498_SHBs_P-C Product feature CHAIN AY122498_SHBs_P-C of FT:mat_peptide AY122498_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F265). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPGLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122499_SHBs_P-C Product feature CHAIN AY122499_SHBs_P-C of FT:mat_peptide AY122499_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F266). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGEAPVCPGQNSPSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122500_SHBs_P-C Product feature CHAIN AY122500_SHBs_P-C of FT:mat_peptide AY122500_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F283). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLNLLAPFVQWFVGLSPTVWLSVIWMMWYWGQSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122501_SHBs_P-C Product feature CHAIN AY122501_SHBs_P-C of FT:mat_peptide AY122501_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F284). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122502_SHBs_P-C Product feature CHAIN AY122502_SHBs_P-C of FT:mat_peptide AY122502_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F287). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLREAPVCPGQNSPSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122503_SHBs_P-C Product feature CHAIN AY122503_SHBs_P-C of FT:mat_peptide AY122503_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F291). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122504_SHBs_P-C Product feature CHAIN AY122504_SHBs_P-C of FT:mat_peptide AY122504_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F292). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122505_SHBs_P-C Product feature CHAIN AY122505_SHBs_P-C of FT:mat_peptide AY122505_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F296). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGHLLGLQAVFFLLTRILTIPQSLDSWWTSLNFLGETPVCPGQNSPSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLLIFFCLWVYI
>gnl|hbvpro|AY122506_SHBs_P-C Product feature CHAIN AY122506_SHBs_P-C of FT:mat_peptide AY122506_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate F298). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122507_SHBs_P-C Product feature CHAIN AY122507_SHBs_P-C of FT:mat_peptide AY122507_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate K086). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122508_SHBs_P-C Product feature CHAIN AY122508_SHBs_P-C of FT:mat_peptide AY122508_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate K136). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122509_SHBs_P-C Product feature CHAIN AY122509_SHBs_P-C of FT:mat_peptide AY122509_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate K240). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122510_SHBs_P-C Product feature CHAIN AY122510_SHBs_P-C of FT:mat_peptide AY122510_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate K271). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MDNTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122511_SHBs_P-C Product feature CHAIN AY122511_SHBs_P-C of FT:mat_peptide AY122511_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T002). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122512_SHBs_P-C Product feature CHAIN AY122512_SHBs_P-C of FT:mat_peptide AY122512_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQNLDSWWTSLNFLGEPPVCHGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122513_SHBs_P-C Product feature CHAIN AY122513_SHBs_P-C of FT:mat_peptide AY122513_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T015). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122514_SHBs_P-C Product feature CHAIN AY122514_SHBs_P-C of FT:mat_peptide AY122514_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T016). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122515_SHBs_P-C Product feature CHAIN AY122515_SHBs_P-C of FT:mat_peptide AY122515_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T017). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122516_SHBs_P-C Product feature CHAIN AY122516_SHBs_P-C of FT:mat_peptide AY122516_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T127). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122517_SHBs_P-C Product feature CHAIN AY122517_SHBs_P-C of FT:mat_peptide AY122517_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T134). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122518_SHBs_P-C Product feature CHAIN AY122518_SHBs_P-C of FT:mat_peptide AY122518_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T144). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSQTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122519_SHBs_P-C Product feature CHAIN AY122519_SHBs_P-C of FT:mat_peptide AY122519_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T190). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122520_SHBs_P-C Product feature CHAIN AY122520_SHBs_P-C of FT:mat_peptide AY122520_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T226). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122521_SHBs_P-C Product feature CHAIN AY122521_SHBs_P-C of FT:mat_peptide AY122521_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T230). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122522_SHBs_P-C Product feature CHAIN AY122522_SHBs_P-C of FT:mat_peptide AY122522_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T233). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122523_SHBs_P-C Product feature CHAIN AY122523_SHBs_P-C of FT:mat_peptide AY122523_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T241). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPRSLDLWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122524_SHBs_P-C Product feature CHAIN AY122524_SHBs_P-C of FT:mat_peptide AY122524_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T242). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122525_SHBs_P-C Product feature CHAIN AY122525_SHBs_P-C of FT:mat_peptide AY122525_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T243). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122526_SHBs_P-C Product feature CHAIN AY122526_SHBs_P-C of FT:mat_peptide AY122526_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T252). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122527_SHBs_P-C Product feature CHAIN AY122527_SHBs_P-C of FT:mat_peptide AY122527_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T253). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEALVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122528_SHBs_P-C Product feature CHAIN AY122528_SHBs_P-C of FT:mat_peptide AY122528_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T267). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122529_SHBs_P-C Product feature CHAIN AY122529_SHBs_P-C of FT:mat_peptide AY122529_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T275). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122530_SHBs_P-C Product feature CHAIN AY122530_SHBs_P-C of FT:mat_peptide AY122530_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate T285). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122531_SHBs_P-C Product feature CHAIN AY122531_SHBs_P-C of FT:mat_peptide AY122531_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V074). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122532_SHBs_P-C Product feature CHAIN AY122532_SHBs_P-C of FT:mat_peptide AY122532_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V075). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122533_SHBs_P-C Product feature CHAIN AY122533_SHBs_P-C of FT:mat_peptide AY122533_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V102). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122534_SHBs_P-C Product feature CHAIN AY122534_SHBs_P-C of FT:mat_peptide AY122534_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V116). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122535_SHBs_P-C Product feature CHAIN AY122535_SHBs_P-C of FT:mat_peptide AY122535_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V124). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122536_SHBs_P-C Product feature CHAIN AY122536_SHBs_P-C of FT:mat_peptide AY122536_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V125). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122537_SHBs_P-C Product feature CHAIN AY122537_SHBs_P-C of FT:mat_peptide AY122537_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V132). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122538_SHBs_P-C Product feature CHAIN AY122538_SHBs_P-C of FT:mat_peptide AY122538_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V133). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122539_SHBs_P-C Product feature CHAIN AY122539_SHBs_P-C of FT:mat_peptide AY122539_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V141). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122540_SHBs_P-C Product feature CHAIN AY122540_SHBs_P-C of FT:mat_peptide AY122540_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V143). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122541_SHBs_P-C Product feature CHAIN AY122541_SHBs_P-C of FT:mat_peptide AY122541_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V150). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122542_SHBs_P-C Product feature CHAIN AY122542_SHBs_P-C of FT:mat_peptide AY122542_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V158). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122543_SHBs_P-C Product feature CHAIN AY122543_SHBs_P-C of FT:mat_peptide AY122543_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V159). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122544_SHBs_P-C Product feature CHAIN AY122544_SHBs_P-C of FT:mat_peptide AY122544_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V178). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTISAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMIWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122545_SHBs_P-C Product feature CHAIN AY122545_SHBs_P-C of FT:mat_peptide AY122545_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V185). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122546_SHBs_P-C Product feature CHAIN AY122546_SHBs_P-C of FT:mat_peptide AY122546_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V221). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122547_SHBs_P-C Product feature CHAIN AY122547_SHBs_P-C of FT:mat_peptide AY122547_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V235). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122548_SHBs_P-C Product feature CHAIN AY122548_SHBs_P-C of FT:mat_peptide AY122548_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V245). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRVLTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122549_SHBs_P-C Product feature CHAIN AY122549_SHBs_P-C of FT:mat_peptide AY122549_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V288). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSSLAPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122550_SHBs_P-C Product feature CHAIN AY122550_SHBs_P-C of FT:mat_peptide AY122550_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate V290). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122577_SHBs_P-C Product feature CHAIN AY122577_SHBs_P-C of FT:mat_peptide AY122577_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P014). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTXPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFCCLWVYI
>gnl|hbvpro|AY122578_SHBs_P-C Product feature CHAIN AY122578_SHBs_P-C of FT:mat_peptide AY122578_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P217). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122579_SHBs_P-C Product feature CHAIN AY122579_SHBs_P-C of FT:mat_peptide AY122579_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P398). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122580_SHBs_P-C Product feature CHAIN AY122580_SHBs_P-C of FT:mat_peptide AY122580_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P585). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122581_SHBs_P-C Product feature CHAIN AY122581_SHBs_P-C of FT:mat_peptide AY122581_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P619). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFPGEAPACPGQNSQSPTSNHSQTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122582_SHBs_P-C Product feature CHAIN AY122582_SHBs_P-C of FT:mat_peptide AY122582_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PH046). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLVVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWGYI
>gnl|hbvpro|AY122583_SHBs_P-C Product feature CHAIN AY122583_SHBs_P-C of FT:mat_peptide AY122583_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PH006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122584_SHBs_P-C Product feature CHAIN AY122584_SHBs_P-C of FT:mat_peptide AY122584_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate PQ046). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY122586_SHBs_P-C Product feature CHAIN AY122586_SHBs_P-C of FT:mat_peptide AY122586_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate P058). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY167090_SHBs_P-C Product feature CHAIN AY167090_SHBs_P-C of FT:mat_peptide AY167090_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|AY167091_SHBs_P-C Product feature CHAIN AY167091_SHBs_P-C of FT:mat_peptide AY167091_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ic). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY167092_SHBs_P-C Product feature CHAIN AY167092_SHBs_P-C of FT:mat_peptide AY167092_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Id). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPRCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY167096_SHBs_P-C Product feature CHAIN AY167096_SHBs_P-C of FT:mat_peptide AY167096_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IIIa). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY167099_SHBs_P-C Product feature CHAIN AY167099_SHBs_P-C of FT:mat_peptide AY167099_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate IVb). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGKCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206376_SHBs_P-C Product feature CHAIN AY206376_SHBs_P-C of FT:mat_peptide AY206376_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKACTTPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206378_SHBs_P-C Product feature CHAIN AY206378_SHBs_P-C of FT:mat_peptide AY206378_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AY206379_SHBs_P-C Product feature CHAIN AY206379_SHBs_P-C of FT:mat_peptide AY206379_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKACTTPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206381_SHBs_P-C Product feature CHAIN AY206381_SHBs_P-C of FT:mat_peptide AY206381_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLALQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206382_SHBs_P-C Product feature CHAIN AY206382_SHBs_P-C of FT:mat_peptide AY206382_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFFWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPTFFCLWVYI
>gnl|hbvpro|AY206384_SHBs_P-C Product feature CHAIN AY206384_SHBs_P-C of FT:mat_peptide AY206384_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWKCASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206385_SHBs_P-C Product feature CHAIN AY206385_SHBs_P-C of FT:mat_peptide AY206385_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206386_SHBs_P-C Product feature CHAIN AY206386_SHBs_P-C of FT:mat_peptide AY206386_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVXLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206389_SHBs_P-C Product feature CHAIN AY206389_SHBs_P-C of FT:mat_peptide AY206389_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFTLLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY206392_SHBs_P-C Product feature CHAIN AY206392_SHBs_P-C of FT:mat_peptide AY206392_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY220699_SHBs_P-C Product feature CHAIN AY220699_SHBs_P-C of FT:mat_peptide AY220699_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|AY247031_SHBs_P-C Product feature CHAIN AY247031_SHBs_P-C of FT:mat_peptide AY247031_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB84). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY247032_SHBs_P-C Product feature CHAIN AY247032_SHBs_P-C of FT:mat_peptide AY247032_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate KUHB95). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY306136_SHBs_P-C Product feature CHAIN AY306136_SHBs_P-C of FT:mat_peptide AY306136_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H85). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY345162_SHBs_P-C Product feature CHAIN AY345162_SHBs_P-C of FT:mat_peptide AY345162_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGNSMFPSCCCTKPSDRNCTCFPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVRLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFLCLWVYI
>gnl|hbvpro|AY345163_SHBs_P-C Product feature CHAIN AY345163_SHBs_P-C of FT:mat_peptide AY345163_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGILGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVRLSPTVWLSVIWMMWNWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY582136_SHBs_P-C Product feature CHAIN AY582136_SHBs_P-C of FT:mat_peptide AY582136_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY596107_SHBs_P-C Product feature CHAIN AY596107_SHBs_P-C of FT:mat_peptide AY596107_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-1). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY596108_SHBs_P-C Product feature CHAIN AY596108_SHBs_P-C of FT:mat_peptide AY596108_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Ib-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641558_SHBs_P-C Product feature CHAIN AY641558_SHBs_P-C of FT:mat_peptide AY641558_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He74). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641559_SHBs_P-C Product feature CHAIN AY641559_SHBs_P-C of FT:mat_peptide AY641559_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He53). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLPIFLCLWVYI
>gnl|hbvpro|AY641560_SHBs_P-C Product feature CHAIN AY641560_SHBs_P-C of FT:mat_peptide AY641560_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He100). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641561_SHBs_P-C Product feature CHAIN AY641561_SHBs_P-C of FT:mat_peptide AY641561_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He127). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY641562_SHBs_P-C Product feature CHAIN AY641562_SHBs_P-C of FT:mat_peptide AY641562_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He82). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQNTSIFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY641563_SHBs_P-C Product feature CHAIN AY641563_SHBs_P-C of FT:mat_peptide AY641563_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate He52). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWYWGPNLYNIWSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY646444_SHBs_P-C Product feature CHAIN AY646444_SHBs_P-C of FT:mat_peptide AY646444_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738823_SHBs_P-C Product feature CHAIN AY738823_SHBs_P-C of FT:mat_peptide AY738823_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSQTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGRSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQSFVGLSPTVWLSVIWIMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738824_SHBs_P-C Product feature CHAIN AY738824_SHBs_P-C of FT:mat_peptide AY738824_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQRFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738825_SHBs_P-C Product feature CHAIN AY738825_SHBs_P-C of FT:mat_peptide AY738825_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGESPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSKGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738826_SHBs_P-C Product feature CHAIN AY738826_SHBs_P-C of FT:mat_peptide AY738826_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738827_SHBs_P-C Product feature CHAIN AY738827_SHBs_P-C of FT:mat_peptide AY738827_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPGQSSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738828_SHBs_P-C Product feature CHAIN AY738828_SHBs_P-C of FT:mat_peptide AY738828_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQPVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTRTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738829_SHBs_P-C Product feature CHAIN AY738829_SHBs_P-C of FT:mat_peptide AY738829_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSAIWMMWYWGPSLYTCLSPFIPLLPIFFCLWVYT
>gnl|hbvpro|AY738830_SHBs_P-C Product feature CHAIN AY738830_SHBs_P-C of FT:mat_peptide AY738830_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFHGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVCLSAIWIMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738831_SHBs_P-C Product feature CHAIN AY738831_SHBs_P-C of FT:mat_peptide AY738831_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFSGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738832_SHBs_P-C Product feature CHAIN AY738832_SHBs_P-C of FT:mat_peptide AY738832_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738833_SHBs_P-C Product feature CHAIN AY738833_SHBs_P-C of FT:mat_peptide AY738833_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQSFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738834_SHBs_P-C Product feature CHAIN AY738834_SHBs_P-C of FT:mat_peptide AY738834_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLAPFVQWFDGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738835_SHBs_P-C Product feature CHAIN AY738835_SHBs_P-C of FT:mat_peptide AY738835_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTLGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLQRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAT
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738836_SHBs_P-C Product feature CHAIN AY738836_SHBs_P-C of FT:mat_peptide AY738836_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738837_SHBs_P-C Product feature CHAIN AY738837_SHBs_P-C of FT:mat_peptide AY738837_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738838_SHBs_P-C Product feature CHAIN AY738838_SHBs_P-C of FT:mat_peptide AY738838_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGKNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738839_SHBs_P-C Product feature CHAIN AY738839_SHBs_P-C of FT:mat_peptide AY738839_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTVPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738840_SHBs_P-C Product feature CHAIN AY738840_SHBs_P-C of FT:mat_peptide AY738840_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738841_SHBs_P-C Product feature CHAIN AY738841_SHBs_P-C of FT:mat_peptide AY738841_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQSFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738842_SHBs_P-C Product feature CHAIN AY738842_SHBs_P-C of FT:mat_peptide AY738842_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MDKTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738843_SHBs_P-C Product feature CHAIN AY738843_SHBs_P-C of FT:mat_peptide AY738843_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTCCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738844_SHBs_P-C Product feature CHAIN AY738844_SHBs_P-C of FT:mat_peptide AY738844_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMIWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738845_SHBs_P-C Product feature CHAIN AY738845_SHBs_P-C of FT:mat_peptide AY738845_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLAVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738846_SHBs_P-C Product feature CHAIN AY738846_SHBs_P-C of FT:mat_peptide AY738846_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738847_SHBs_P-C Product feature CHAIN AY738847_SHBs_P-C of FT:mat_peptide AY738847_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY862869_SHBs_P-C Product feature CHAIN AY862869_SHBs_P-C of FT:mat_peptide AY862869_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H8). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|D00630_SHBs_P-C Product feature CHAIN D00630_SHBs_P-C of FT:mat_peptide D00630_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGPNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D10055_SHBs_P-C Product feature CHAIN D10055_SHBs_P-C of FT:mat_peptide D10055_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLNLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D12980_SHBs_P-C Product feature CHAIN D12980_SHBs_P-C of FT:mat_peptide D12980_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCWCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D23681_SHBs_P-C Product feature CHAIN D23681_SHBs_P-C of FT:mat_peptide D23681_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C4-HBVST2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMLPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|D23682_SHBs_P-C Product feature CHAIN D23682_SHBs_P-C of FT:mat_peptide D23682_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B5-HBVKO1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFSLTRIHTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D23683_SHBs_P-C Product feature CHAIN D23683_SHBs_P-C of FT:mat_peptide D23683_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C5-HBVKO2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAVFFSLTRIHTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGQGLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|D23684_SHBs_P-C Product feature CHAIN D23684_SHBs_P-C of FT:mat_peptide D23684_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C6-TKB588). Complete genome. [Hepadnaviridae] (length=226 residues).
METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D28880_SHBs_P-C Product feature CHAIN D28880_SHBs_P-C of FT:mat_peptide D28880_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Plasma 1992-085-9434). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPKCPGLNSQSPTSNHSPTSCPPICPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTPTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCICIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50517_SHBs_P-C Product feature CHAIN D50517_SHBs_P-C of FT:mat_peptide D50517_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50518_SHBs_P-C Product feature CHAIN D50518_SHBs_P-C of FT:mat_peptide D50518_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50519_SHBs_P-C Product feature CHAIN D50519_SHBs_P-C of FT:mat_peptide D50519_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWVSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|D50520_SHBs_P-C Product feature CHAIN D50520_SHBs_P-C of FT:mat_peptide D50520_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089756_SHBs_P-C Product feature CHAIN DQ089756_SHBs_P-C of FT:mat_peptide DQ089756_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK75). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089757_SHBs_P-C Product feature CHAIN DQ089757_SHBs_P-C of FT:mat_peptide DQ089757_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2342). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGXNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPXVWLSVIWMMWYWGPSLYNXLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089758_SHBs_P-C Product feature CHAIN DQ089758_SHBs_P-C of FT:mat_peptide DQ089758_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1733). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089760_SHBs_P-C Product feature CHAIN DQ089760_SHBs_P-C of FT:mat_peptide DQ089760_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK454). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089761_SHBs_P-C Product feature CHAIN DQ089761_SHBs_P-C of FT:mat_peptide DQ089761_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK515). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089762_SHBs_P-C Product feature CHAIN DQ089762_SHBs_P-C of FT:mat_peptide DQ089762_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1644). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089763_SHBs_P-C Product feature CHAIN DQ089763_SHBs_P-C of FT:mat_peptide DQ089763_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1048). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPTCPGYRLMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089764_SHBs_P-C Product feature CHAIN DQ089764_SHBs_P-C of FT:mat_peptide DQ089764_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK967). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089765_SHBs_P-C Product feature CHAIN DQ089765_SHBs_P-C of FT:mat_peptide DQ089765_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK428). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089766_SHBs_P-C Product feature CHAIN DQ089766_SHBs_P-C of FT:mat_peptide DQ089766_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK553). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYXGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFXR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089767_SHBs_P-C Product feature CHAIN DQ089767_SHBs_P-C of FT:mat_peptide DQ089767_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1663). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSGPPXCPGYRWMCLRRX
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPXLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089768_SHBs_P-C Product feature CHAIN DQ089768_SHBs_P-C of FT:mat_peptide DQ089768_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1814). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTFCPPTCPGYRWMCLRRX
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089769_SHBs_P-C Product feature CHAIN DQ089769_SHBs_P-C of FT:mat_peptide DQ089769_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK430). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089770_SHBs_P-C Product feature CHAIN DQ089770_SHBs_P-C of FT:mat_peptide DQ089770_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1272). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089771_SHBs_P-C Product feature CHAIN DQ089771_SHBs_P-C of FT:mat_peptide DQ089771_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1629). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089772_SHBs_P-C Product feature CHAIN DQ089772_SHBs_P-C of FT:mat_peptide DQ089772_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK910). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|DQ089773_SHBs_P-C Product feature CHAIN DQ089773_SHBs_P-C of FT:mat_peptide DQ089773_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1193). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089775_SHBs_P-C Product feature CHAIN DQ089775_SHBs_P-C of FT:mat_peptide DQ089775_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK290). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILXLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLLVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089776_SHBs_P-C Product feature CHAIN DQ089776_SHBs_P-C of FT:mat_peptide DQ089776_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK884). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089777_SHBs_P-C Product feature CHAIN DQ089777_SHBs_P-C of FT:mat_peptide DQ089777_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1159). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089778_SHBs_P-C Product feature CHAIN DQ089778_SHBs_P-C of FT:mat_peptide DQ089778_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1442). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ089779_SHBs_P-C Product feature CHAIN DQ089779_SHBs_P-C of FT:mat_peptide DQ089779_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK554). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089780_SHBs_P-C Product feature CHAIN DQ089780_SHBs_P-C of FT:mat_peptide DQ089780_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK947). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLVVLXDYRGMLPVCPXLPGTSTTSXGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089781_SHBs_P-C Product feature CHAIN DQ089781_SHBs_P-C of FT:mat_peptide DQ089781_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1476). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089782_SHBs_P-C Product feature CHAIN DQ089782_SHBs_P-C of FT:mat_peptide DQ089782_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2032). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089783_SHBs_P-C Product feature CHAIN DQ089783_SHBs_P-C of FT:mat_peptide DQ089783_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1402). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089784_SHBs_P-C Product feature CHAIN DQ089784_SHBs_P-C of FT:mat_peptide DQ089784_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1285). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089785_SHBs_P-C Product feature CHAIN DQ089785_SHBs_P-C of FT:mat_peptide DQ089785_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1386). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ089786_SHBs_P-C Product feature CHAIN DQ089786_SHBs_P-C of FT:mat_peptide DQ089786_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2074). Complete genome. [Hepadnaviridae] (length=226 residues).
MESISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089787_SHBs_P-C Product feature CHAIN DQ089787_SHBs_P-C of FT:mat_peptide DQ089787_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK352). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089788_SHBs_P-C Product feature CHAIN DQ089788_SHBs_P-C of FT:mat_peptide DQ089788_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK820). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IISLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWSWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ089789_SHBs_P-C Product feature CHAIN DQ089789_SHBs_P-C of FT:mat_peptide DQ089789_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK926). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089790_SHBs_P-C Product feature CHAIN DQ089790_SHBs_P-C of FT:mat_peptide DQ089790_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1248). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWVSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089791_SHBs_P-C Product feature CHAIN DQ089791_SHBs_P-C of FT:mat_peptide DQ089791_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1205). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXNILNPFLPLLPIFFXLWVYI
>gnl|hbvpro|DQ089792_SHBs_P-C Product feature CHAIN DQ089792_SHBs_P-C of FT:mat_peptide DQ089792_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK870). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILNPFXPLLPIFFXLWVYI
>gnl|hbvpro|DQ089793_SHBs_P-C Product feature CHAIN DQ089793_SHBs_P-C of FT:mat_peptide DQ089793_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK343). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089794_SHBs_P-C Product feature CHAIN DQ089794_SHBs_P-C of FT:mat_peptide DQ089794_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1896). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ089795_SHBs_P-C Product feature CHAIN DQ089795_SHBs_P-C of FT:mat_peptide DQ089795_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1465). Complete genome. [Hepadnaviridae] (length=227 residues).
MENTISXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGNSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFA
RFLWEWXSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089796_SHBs_P-C Product feature CHAIN DQ089796_SHBs_P-C of FT:mat_peptide DQ089796_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK751). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSRSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089797_SHBs_P-C Product feature CHAIN DQ089797_SHBs_P-C of FT:mat_peptide DQ089797_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1169). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSXHSLISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWSWGPXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089799_SHBs_P-C Product feature CHAIN DQ089799_SHBs_P-C of FT:mat_peptide DQ089799_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK734). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089800_SHBs_P-C Product feature CHAIN DQ089800_SHBs_P-C of FT:mat_peptide DQ089800_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK741). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089801_SHBs_P-C Product feature CHAIN DQ089801_SHBs_P-C of FT:mat_peptide DQ089801_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK2100). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089802_SHBs_P-C Product feature CHAIN DQ089802_SHBs_P-C of FT:mat_peptide DQ089802_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK1371). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089803_SHBs_P-C Product feature CHAIN DQ089803_SHBs_P-C of FT:mat_peptide DQ089803_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK931). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ089804_SHBs_P-C Product feature CHAIN DQ089804_SHBs_P-C of FT:mat_peptide DQ089804_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate HK262). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLXPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFSLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFLCLWVYI
>gnl|hbvpro|DQ141656_SHBs_P-C Product feature CHAIN DQ141656_SHBs_P-C of FT:mat_peptide DQ141656_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIH46AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141657_SHBs_P-C Product feature CHAIN DQ141657_SHBs_P-C of FT:mat_peptide DQ141657_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2051Java). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQGFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLIPIFFCLWVYI
>gnl|hbvpro|DQ141658_SHBs_P-C Product feature CHAIN DQ141658_SHBs_P-C of FT:mat_peptide DQ141658_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Alr016East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCWTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|DQ141659_SHBs_P-C Product feature CHAIN DQ141659_SHBs_P-C of FT:mat_peptide DQ141659_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Alr062East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCWTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPLFFCLWVYI
>gnl|hbvpro|DQ141660_SHBs_P-C Product feature CHAIN DQ141660_SHBs_P-C of FT:mat_peptide DQ141660_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Alr198East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141661_SHBs_P-C Product feature CHAIN DQ141661_SHBs_P-C of FT:mat_peptide DQ141661_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SBT35East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|DQ141662_SHBs_P-C Product feature CHAIN DQ141662_SHBs_P-C of FT:mat_peptide DQ141662_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2076Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141663_SHBs_P-C Product feature CHAIN DQ141663_SHBs_P-C of FT:mat_peptide DQ141663_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2074Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141664_SHBs_P-C Product feature CHAIN DQ141664_SHBs_P-C of FT:mat_peptide DQ141664_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIHM5Chinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSGWTSLNFLGGTPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141665_SHBs_P-C Product feature CHAIN DQ141665_SHBs_P-C of FT:mat_peptide DQ141665_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EIH40AChinese). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141667_SHBs_P-C Product feature CHAIN DQ141667_SHBs_P-C of FT:mat_peptide DQ141667_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Alr006East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSQTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNISKPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ141668_SHBs_P-C Product feature CHAIN DQ141668_SHBs_P-C of FT:mat_peptide DQ141668_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SBT47East). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ246215_SHBs_P-C Product feature CHAIN DQ246215_SHBs_P-C of FT:mat_peptide DQ246215_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPYVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ315781_SHBs_P-C Product feature CHAIN DQ315781_SHBs_P-C of FT:mat_peptide DQ315781_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI0398). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ315782_SHBs_P-C Product feature CHAIN DQ315782_SHBs_P-C of FT:mat_peptide DQ315782_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI0423). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMTWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ315783_SHBs_P-C Product feature CHAIN DQ315783_SHBs_P-C of FT:mat_peptide DQ315783_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate EI03188). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ361526_SHBs_P-C Product feature CHAIN DQ361526_SHBs_P-C of FT:mat_peptide DQ361526_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate NK-586). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ361533_SHBs_P-C Product feature CHAIN DQ361533_SHBs_P-C of FT:mat_peptide DQ361533_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate UDV-039). Partial genome (Contains: HBe, HBc, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ361534_SHBs_P-C Product feature CHAIN DQ361534_SHBs_P-C of FT:mat_peptide DQ361534_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CR-081). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ370438_SHBs_P-C Product feature CHAIN DQ370438_SHBs_P-C of FT:mat_peptide DQ370438_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z6-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGTCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYIR
>gnl|hbvpro|DQ370439_SHBs_P-C Product feature CHAIN DQ370439_SHBs_P-C of FT:mat_peptide DQ370439_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Z6-2). Partial genome (Contains: MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAHACPGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPDCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377161_SHBs_P-C Product feature CHAIN DQ377161_SHBs_P-C of FT:mat_peptide DQ377161_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT14). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLQGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377162_SHBs_P-C Product feature CHAIN DQ377162_SHBs_P-C of FT:mat_peptide DQ377162_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT20). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILPLRLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377163_SHBs_P-C Product feature CHAIN DQ377163_SHBs_P-C of FT:mat_peptide DQ377163_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT32). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSQTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377164_SHBs_P-C Product feature CHAIN DQ377164_SHBs_P-C of FT:mat_peptide DQ377164_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT5). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPVQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
SLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ377165_SHBs_P-C Product feature CHAIN DQ377165_SHBs_P-C of FT:mat_peptide DQ377165_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate WJT35). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTRTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRLSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412229_SHBs_P-C Product feature CHAIN DQ412229_SHBs_P-C of FT:mat_peptide DQ412229_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S02006856). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412230_SHBs_P-C Product feature CHAIN DQ412230_SHBs_P-C of FT:mat_peptide DQ412230_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S02011114). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLXPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSQTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFLCLWVYI
>gnl|hbvpro|DQ412231_SHBs_P-C Product feature CHAIN DQ412231_SHBs_P-C of FT:mat_peptide DQ412231_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s02015687). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412232_SHBs_P-C Product feature CHAIN DQ412232_SHBs_P-C of FT:mat_peptide DQ412232_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s02016679). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412233_SHBs_P-C Product feature CHAIN DQ412233_SHBs_P-C of FT:mat_peptide DQ412233_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s02019165). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412234_SHBs_P-C Product feature CHAIN DQ412234_SHBs_P-C of FT:mat_peptide DQ412234_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S02022149). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGEVPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMLPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412235_SHBs_P-C Product feature CHAIN DQ412235_SHBs_P-C of FT:mat_peptide DQ412235_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S02023962). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412236_SHBs_P-C Product feature CHAIN DQ412236_SHBs_P-C of FT:mat_peptide DQ412236_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s03000465). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWGYI
>gnl|hbvpro|DQ412237_SHBs_P-C Product feature CHAIN DQ412237_SHBs_P-C of FT:mat_peptide DQ412237_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s03001914). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412238_SHBs_P-C Product feature CHAIN DQ412238_SHBs_P-C of FT:mat_peptide DQ412238_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S03003110). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNLQSPTSNHSPTSCPPSCPGYHWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412239_SHBs_P-C Product feature CHAIN DQ412239_SHBs_P-C of FT:mat_peptide DQ412239_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s03003846). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
METTTSGFLGPLRVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGALMCPGQNLQSPTSNHSPTSCPPIYPGYRLIYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPXDGNCTCIPIPSSWAFXR
FLWEWASVRFSWXSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412240_SHBs_P-C Product feature CHAIN DQ412240_SHBs_P-C of FT:mat_peptide DQ412240_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S03006015). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412241_SHBs_P-C Product feature CHAIN DQ412241_SHBs_P-C of FT:mat_peptide DQ412241_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S03012130). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFPGPLRVLQEGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCQRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCQTCTTPAQGTSMFPSCCCTKPSDENCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVFI
>gnl|hbvpro|DQ412242_SHBs_P-C Product feature CHAIN DQ412242_SHBs_P-C of FT:mat_peptide DQ412242_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S03014552). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
XLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412243_SHBs_P-C Product feature CHAIN DQ412243_SHBs_P-C of FT:mat_peptide DQ412243_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S03015182). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNXQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412244_SHBs_P-C Product feature CHAIN DQ412244_SHBs_P-C of FT:mat_peptide DQ412244_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S03018054). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412245_SHBs_P-C Product feature CHAIN DQ412245_SHBs_P-C of FT:mat_peptide DQ412245_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S03020213). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLXSWWTSLNFLGEXPXCPGQNLQSPTSNHSPTSCPPTCPGYRLMCLRRF
IXFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNIVKPFLPLLPIFFXLWVYI
>gnl|hbvpro|DQ412246_SHBs_P-C Product feature CHAIN DQ412246_SHBs_P-C of FT:mat_peptide DQ412246_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s03023664). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNXQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412247_SHBs_P-C Product feature CHAIN DQ412247_SHBs_P-C of FT:mat_peptide DQ412247_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s03023763). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCXRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412248_SHBs_P-C Product feature CHAIN DQ412248_SHBs_P-C of FT:mat_peptide DQ412248_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S03024904). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412249_SHBs_P-C Product feature CHAIN DQ412249_SHBs_P-C of FT:mat_peptide DQ412249_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s04008403). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412250_SHBs_P-C Product feature CHAIN DQ412250_SHBs_P-C of FT:mat_peptide DQ412250_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s04012010). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412252_SHBs_P-C Product feature CHAIN DQ412252_SHBs_P-C of FT:mat_peptide DQ412252_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S04014089). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLXGLQAGFSLLTRILTIPQSLDSWWTSLNFPGGTPKCPGXNSQSPTSNHSLTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVTWMMWYWGPSLYNILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|DQ412253_SHBs_P-C Product feature CHAIN DQ412253_SHBs_P-C of FT:mat_peptide DQ412253_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s04017049). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412254_SHBs_P-C Product feature CHAIN DQ412254_SHBs_P-C of FT:mat_peptide DQ412254_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s04020623). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPIXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412255_SHBs_P-C Product feature CHAIN DQ412255_SHBs_P-C of FT:mat_peptide DQ412255_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s04021028). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWGYI
>gnl|hbvpro|DQ412256_SHBs_P-C Product feature CHAIN DQ412256_SHBs_P-C of FT:mat_peptide DQ412256_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S04023536). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
TESTTSGFPGPLRVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLICLLVLLDYQGMLPVCPLLPGTSTTSTGPCQTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFVS
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWVPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412257_SHBs_P-C Product feature CHAIN DQ412257_SHBs_P-C of FT:mat_peptide DQ412257_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s04023537). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPIXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYIL
>gnl|hbvpro|DQ412258_SHBs_P-C Product feature CHAIN DQ412258_SHBs_P-C of FT:mat_peptide DQ412258_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S04024246). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412259_SHBs_P-C Product feature CHAIN DQ412259_SHBs_P-C of FT:mat_peptide DQ412259_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s04024338). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412260_SHBs_P-C Product feature CHAIN DQ412260_SHBs_P-C of FT:mat_peptide DQ412260_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s04024460). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412261_SHBs_P-C Product feature CHAIN DQ412261_SHBs_P-C of FT:mat_peptide DQ412261_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S04024773). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGXFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSQTSCPPXCPGYRWMCXRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNIVKPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412262_SHBs_P-C Product feature CHAIN DQ412262_SHBs_P-C of FT:mat_peptide DQ412262_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S04026172). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412263_SHBs_P-C Product feature CHAIN DQ412263_SHBs_P-C of FT:mat_peptide DQ412263_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S04026935). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412264_SHBs_P-C Product feature CHAIN DQ412264_SHBs_P-C of FT:mat_peptide DQ412264_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s05000569). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MXTQPSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412265_SHBs_P-C Product feature CHAIN DQ412265_SHBs_P-C of FT:mat_peptide DQ412265_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S05007223). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412266_SHBs_P-C Product feature CHAIN DQ412266_SHBs_P-C of FT:mat_peptide DQ412266_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S05012582). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWXSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412267_SHBs_P-C Product feature CHAIN DQ412267_SHBs_P-C of FT:mat_peptide DQ412267_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S05014765). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412268_SHBs_P-C Product feature CHAIN DQ412268_SHBs_P-C of FT:mat_peptide DQ412268_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S05014766). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412269_SHBs_P-C Product feature CHAIN DQ412269_SHBs_P-C of FT:mat_peptide DQ412269_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s05015378). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXXPXCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412270_SHBs_P-C Product feature CHAIN DQ412270_SHBs_P-C of FT:mat_peptide DQ412270_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S05016361). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGXSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412271_SHBs_P-C Product feature CHAIN DQ412271_SHBs_P-C of FT:mat_peptide DQ412271_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s05019936). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412273_SHBs_P-C Product feature CHAIN DQ412273_SHBs_P-C of FT:mat_peptide DQ412273_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s05023214). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412274_SHBs_P-C Product feature CHAIN DQ412274_SHBs_P-C of FT:mat_peptide DQ412274_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s06001514). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412275_SHBs_P-C Product feature CHAIN DQ412275_SHBs_P-C of FT:mat_peptide DQ412275_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s06001518). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412276_SHBs_P-C Product feature CHAIN DQ412276_SHBs_P-C of FT:mat_peptide DQ412276_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate s06002114). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQENSXXPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478885_SHBs_P-C Product feature CHAIN DQ478885_SHBs_P-C of FT:mat_peptide DQ478885_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQSMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478899_SHBs_P-C Product feature CHAIN DQ478899_SHBs_P-C of FT:mat_peptide DQ478899_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-D20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IILLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRSSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478900_SHBs_P-C Product feature CHAIN DQ478900_SHBs_P-C of FT:mat_peptide DQ478900_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H172). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILQLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ478901_SHBs_P-C Product feature CHAIN DQ478901_SHBs_P-C of FT:mat_peptide DQ478901_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CHN-H155). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
NIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSTWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWRMWYWGPRLYNILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ536410_SHBs_P-C Product feature CHAIN DQ536410_SHBs_P-C of FT:mat_peptide DQ536410_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ536411_SHBs_P-C Product feature CHAIN DQ536411_SHBs_P-C of FT:mat_peptide DQ536411_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ536412_SHBs_P-C Product feature CHAIN DQ536412_SHBs_P-C of FT:mat_peptide DQ536412_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JeF339). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFPFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ683578_SHBs_P-C Product feature CHAIN DQ683578_SHBs_P-C of FT:mat_peptide DQ683578_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVK
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ890381_SHBs_P-C Product feature CHAIN DQ890381_SHBs_P-C of FT:mat_peptide DQ890381_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ922649_SHBs_P-C Product feature CHAIN DQ922649_SHBs_P-C of FT:mat_peptide DQ922649_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ922650_SHBs_P-C Product feature CHAIN DQ922650_SHBs_P-C of FT:mat_peptide DQ922650_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ922651_SHBs_P-C Product feature CHAIN DQ922651_SHBs_P-C of FT:mat_peptide DQ922651_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ975272_SHBs_P-C Product feature CHAIN DQ975272_SHBs_P-C of FT:mat_peptide DQ975272_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ975273_SHBs_P-C Product feature CHAIN DQ975273_SHBs_P-C of FT:mat_peptide DQ975273_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ980547_SHBs_P-C Product feature CHAIN DQ980547_SHBs_P-C of FT:mat_peptide DQ980547_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGACKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ980549_SHBs_P-C Product feature CHAIN DQ980549_SHBs_P-C of FT:mat_peptide DQ980549_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPPCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWALVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ980550_SHBs_P-C Product feature CHAIN DQ980550_SHBs_P-C of FT:mat_peptide DQ980550_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ980551_SHBs_P-C Product feature CHAIN DQ980551_SHBs_P-C of FT:mat_peptide DQ980551_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSPNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ986375_SHBs_P-C Product feature CHAIN DQ986375_SHBs_P-C of FT:mat_peptide DQ986375_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGISMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ986376_SHBs_P-C Product feature CHAIN DQ986376_SHBs_P-C of FT:mat_peptide DQ986376_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMSPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ993691_SHBs_P-C Product feature CHAIN DQ993691_SHBs_P-C of FT:mat_peptide DQ993691_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0803-Nature2.2-unSero). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ993692_SHBs_P-C Product feature CHAIN DQ993692_SHBs_P-C of FT:mat_peptide DQ993692_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4007-0810-Nature2.1-unSero). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ993693_SHBs_P-C Product feature CHAIN DQ993693_SHBs_P-C of FT:mat_peptide DQ993693_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 232-1125-Nature1.1-unSero). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF137802_SHBs_P-C Product feature CHAIN EF137802_SHBs_P-C of FT:mat_peptide EF137802_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILPLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPTPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNIWSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF137803_SHBs_P-C Product feature CHAIN EF137803_SHBs_P-C of FT:mat_peptide EF137803_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFAQWFAGLSPTVWLSVIWMMWYWGPSLYNIWSPFLPLLPIFFCLWAYI
>gnl|hbvpro|EF384200_SHBs_P-C Product feature CHAIN EF384200_SHBs_P-C of FT:mat_peptide EF384200_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF384204_SHBs_P-C Product feature CHAIN EF384204_SHBs_P-C of FT:mat_peptide EF384204_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-05). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF384206_SHBs_P-C Product feature CHAIN EF384206_SHBs_P-C of FT:mat_peptide EF384206_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CUIT-07). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF494377_SHBs_P-C Product feature CHAIN EF494377_SHBs_P-C of FT:mat_peptide EF494377_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW1138). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
METTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF494379_SHBs_P-C Product feature CHAIN EF494379_SHBs_P-C of FT:mat_peptide EF494379_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate TW8585). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF536065_SHBs_P-C Product feature CHAIN EF536065_SHBs_P-C of FT:mat_peptide EF536065_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTFCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF536066_SHBs_P-C Product feature CHAIN EF536066_SHBs_P-C of FT:mat_peptide EF536066_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPGQNSQSPTSNHSLTFCPLTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF645260_SHBs_P-C Product feature CHAIN EF645260_SHBs_P-C of FT:mat_peptide EF645260_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWTCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGASTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF645261_SHBs_P-C Product feature CHAIN EF645261_SHBs_P-C of FT:mat_peptide EF645261_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAPGTSMFPSCCCTKPSDGICTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF645262_SHBs_P-C Product feature CHAIN EF645262_SHBs_P-C of FT:mat_peptide EF645262_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF645263_SHBs_P-C Product feature CHAIN EF645263_SHBs_P-C of FT:mat_peptide EF645263_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF645264_SHBs_P-C Product feature CHAIN EF645264_SHBs_P-C of FT:mat_peptide EF645264_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSPDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSYWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPHLYNILTPFIPLLPIFLCLWVYI
>gnl|hbvpro|EF645265_SHBs_P-C Product feature CHAIN EF645265_SHBs_P-C of FT:mat_peptide EF645265_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPVLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF645266_SHBs_P-C Product feature CHAIN EF645266_SHBs_P-C of FT:mat_peptide EF645266_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF645267_SHBs_P-C Product feature CHAIN EF645267_SHBs_P-C of FT:mat_peptide EF645267_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF645268_SHBs_P-C Product feature CHAIN EF645268_SHBs_P-C of FT:mat_peptide EF645268_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF645269_SHBs_P-C Product feature CHAIN EF645269_SHBs_P-C of FT:mat_peptide EF645269_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGKAPACPGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFRFCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|EF645270_SHBs_P-C Product feature CHAIN EF645270_SHBs_P-C of FT:mat_peptide EF645270_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCHGMLPVCPLLPGTSTTSTGPCKTCTIPAPGTSMFPSCCCTKPSDRICTCIPIPSYWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF688062_SHBs_P-C Product feature CHAIN EF688062_SHBs_P-C of FT:mat_peptide EF688062_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate GZ28-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075312_SHBs_P-C Product feature CHAIN EU075312_SHBs_P-C of FT:mat_peptide EU075312_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S194-A8). Partial genome (Contains: MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075315_SHBs_P-C Product feature CHAIN EU075315_SHBs_P-C of FT:mat_peptide EU075315_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S194-A11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQAMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075334_SHBs_P-C Product feature CHAIN EU075334_SHBs_P-C of FT:mat_peptide EU075334_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075335_SHBs_P-C Product feature CHAIN EU075335_SHBs_P-C of FT:mat_peptide EU075335_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075336_SHBs_P-C Product feature CHAIN EU075336_SHBs_P-C of FT:mat_peptide EU075336_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-49). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075338_SHBs_P-C Product feature CHAIN EU075338_SHBs_P-C of FT:mat_peptide EU075338_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-B9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU075342_SHBs_P-C Product feature CHAIN EU075342_SHBs_P-C of FT:mat_peptide EU075342_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S216-C14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082428_SHBs_P-C Product feature CHAIN EU082428_SHBs_P-C of FT:mat_peptide EU082428_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-A1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082429_SHBs_P-C Product feature CHAIN EU082429_SHBs_P-C of FT:mat_peptide EU082429_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-A2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082430_SHBs_P-C Product feature CHAIN EU082430_SHBs_P-C of FT:mat_peptide EU082430_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-A3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082431_SHBs_P-C Product feature CHAIN EU082431_SHBs_P-C of FT:mat_peptide EU082431_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-B4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082432_SHBs_P-C Product feature CHAIN EU082432_SHBs_P-C of FT:mat_peptide EU082432_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-B6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
ITFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU082435_SHBs_P-C Product feature CHAIN EU082435_SHBs_P-C of FT:mat_peptide EU082435_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S245-B12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTWPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086837_SHBs_P-C Product feature CHAIN EU086837_SHBs_P-C of FT:mat_peptide EU086837_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S246-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086839_SHBs_P-C Product feature CHAIN EU086839_SHBs_P-C of FT:mat_peptide EU086839_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S246-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086840_SHBs_P-C Product feature CHAIN EU086840_SHBs_P-C of FT:mat_peptide EU086840_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086841_SHBs_P-C Product feature CHAIN EU086841_SHBs_P-C of FT:mat_peptide EU086841_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086842_SHBs_P-C Product feature CHAIN EU086842_SHBs_P-C of FT:mat_peptide EU086842_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086843_SHBs_P-C Product feature CHAIN EU086843_SHBs_P-C of FT:mat_peptide EU086843_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086844_SHBs_P-C Product feature CHAIN EU086844_SHBs_P-C of FT:mat_peptide EU086844_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-A12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086845_SHBs_P-C Product feature CHAIN EU086845_SHBs_P-C of FT:mat_peptide EU086845_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-B3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPPCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086846_SHBs_P-C Product feature CHAIN EU086846_SHBs_P-C of FT:mat_peptide EU086846_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-B4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU086847_SHBs_P-C Product feature CHAIN EU086847_SHBs_P-C of FT:mat_peptide EU086847_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S249-B7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093883_SHBs_P-C Product feature CHAIN EU093883_SHBs_P-C of FT:mat_peptide EU093883_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S385-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093884_SHBs_P-C Product feature CHAIN EU093884_SHBs_P-C of FT:mat_peptide EU093884_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S399-1). Partial genome (Contains: MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLLVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093886_SHBs_P-C Product feature CHAIN EU093886_SHBs_P-C of FT:mat_peptide EU093886_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S399-4). Partial genome (Contains: MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICLGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLLVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093887_SHBs_P-C Product feature CHAIN EU093887_SHBs_P-C of FT:mat_peptide EU093887_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S399-5). Partial genome (Contains: MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLLVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093892_SHBs_P-C Product feature CHAIN EU093892_SHBs_P-C of FT:mat_peptide EU093892_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S399-B19). Partial genome (Contains: MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLLVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093895_SHBs_P-C Product feature CHAIN EU093895_SHBs_P-C of FT:mat_peptide EU093895_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S402-13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093896_SHBs_P-C Product feature CHAIN EU093896_SHBs_P-C of FT:mat_peptide EU093896_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S402-14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|EU093898_SHBs_P-C Product feature CHAIN EU093898_SHBs_P-C of FT:mat_peptide EU093898_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S402-4). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093900_SHBs_P-C Product feature CHAIN EU093900_SHBs_P-C of FT:mat_peptide EU093900_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S403-6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMYLRGF
IIFLFILLLCLICLLVLVDSRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093902_SHBs_P-C Product feature CHAIN EU093902_SHBs_P-C of FT:mat_peptide EU093902_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S404-24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVTFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093903_SHBs_P-C Product feature CHAIN EU093903_SHBs_P-C of FT:mat_peptide EU093903_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S406-16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093906_SHBs_P-C Product feature CHAIN EU093906_SHBs_P-C of FT:mat_peptide EU093906_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S406-13). Partial genome (Contains: SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093907_SHBs_P-C Product feature CHAIN EU093907_SHBs_P-C of FT:mat_peptide EU093907_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S408-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093908_SHBs_P-C Product feature CHAIN EU093908_SHBs_P-C of FT:mat_peptide EU093908_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S410-7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093909_SHBs_P-C Product feature CHAIN EU093909_SHBs_P-C of FT:mat_peptide EU093909_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate X441-8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093910_SHBs_P-C Product feature CHAIN EU093910_SHBs_P-C of FT:mat_peptide EU093910_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S205-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093911_SHBs_P-C Product feature CHAIN EU093911_SHBs_P-C of FT:mat_peptide EU093911_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S205-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093912_SHBs_P-C Product feature CHAIN EU093912_SHBs_P-C of FT:mat_peptide EU093912_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S205-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093913_SHBs_P-C Product feature CHAIN EU093913_SHBs_P-C of FT:mat_peptide EU093913_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S259-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093914_SHBs_P-C Product feature CHAIN EU093914_SHBs_P-C of FT:mat_peptide EU093914_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S259-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSIHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093915_SHBs_P-C Product feature CHAIN EU093915_SHBs_P-C of FT:mat_peptide EU093915_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S259-12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWERASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093916_SHBs_P-C Product feature CHAIN EU093916_SHBs_P-C of FT:mat_peptide EU093916_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093917_SHBs_P-C Product feature CHAIN EU093917_SHBs_P-C of FT:mat_peptide EU093917_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILGPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU093918_SHBs_P-C Product feature CHAIN EU093918_SHBs_P-C of FT:mat_peptide EU093918_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU139510_SHBs_P-C Product feature CHAIN EU139510_SHBs_P-C of FT:mat_peptide EU139510_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
SLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWGYI
>gnl|hbvpro|EU139511_SHBs_P-C Product feature CHAIN EU139511_SHBs_P-C of FT:mat_peptide EU139511_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWASLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNISMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139512_SHBs_P-C Product feature CHAIN EU139512_SHBs_P-C of FT:mat_peptide EU139512_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLSFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPSAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWGYI
>gnl|hbvpro|EU139513_SHBs_P-C Product feature CHAIN EU139513_SHBs_P-C of FT:mat_peptide EU139513_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLPCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAELSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWGYI
>gnl|hbvpro|EU139515_SHBs_P-C Product feature CHAIN EU139515_SHBs_P-C of FT:mat_peptide EU139515_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKRLDSWWTSPNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCRCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVVWMMWYWGPSLYNILSPFLPLLPISCCLWGYI
>gnl|hbvpro|EU139516_SHBs_P-C Product feature CHAIN EU139516_SHBs_P-C of FT:mat_peptide EU139516_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139517_SHBs_P-C Product feature CHAIN EU139517_SHBs_P-C of FT:mat_peptide EU139517_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFLLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTARLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139518_SHBs_P-C Product feature CHAIN EU139518_SHBs_P-C of FT:mat_peptide EU139518_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCSKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139520_SHBs_P-C Product feature CHAIN EU139520_SHBs_P-C of FT:mat_peptide EU139520_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNISMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYRGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139521_SHBs_P-C Product feature CHAIN EU139521_SHBs_P-C of FT:mat_peptide EU139521_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWGYI
>gnl|hbvpro|EU139522_SHBs_P-C Product feature CHAIN EU139522_SHBs_P-C of FT:mat_peptide EU139522_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTVPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMSPVCPLPPGTPTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWPSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139523_SHBs_P-C Product feature CHAIN EU139523_SHBs_P-C of FT:mat_peptide EU139523_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWGYI
>gnl|hbvpro|EU139524_SHBs_P-C Product feature CHAIN EU139524_SHBs_P-C of FT:mat_peptide EU139524_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-18). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLSFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139525_SHBs_P-C Product feature CHAIN EU139525_SHBs_P-C of FT:mat_peptide EU139525_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKGLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWPSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139527_SHBs_P-C Product feature CHAIN EU139527_SHBs_P-C of FT:mat_peptide EU139527_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWPSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWGYI
>gnl|hbvpro|EU139528_SHBs_P-C Product feature CHAIN EU139528_SHBs_P-C of FT:mat_peptide EU139528_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWGYI
>gnl|hbvpro|EU139530_SHBs_P-C Product feature CHAIN EU139530_SHBs_P-C of FT:mat_peptide EU139530_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-25). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTVPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMSPVCPLPPGTPTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWPSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139531_SHBs_P-C Product feature CHAIN EU139531_SHBs_P-C of FT:mat_peptide EU139531_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139532_SHBs_P-C Product feature CHAIN EU139532_SHBs_P-C of FT:mat_peptide EU139532_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate hwd-28). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKACTTPARNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFPWLSLLVPFVRWFAGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWVYI
>gnl|hbvpro|EU139536_SHBs_P-C Product feature CHAIN EU139536_SHBs_P-C of FT:mat_peptide EU139536_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate zxq-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSLTSNHSPISCPPICPGYRLMCRQRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU139540_SHBs_P-C Product feature CHAIN EU139540_SHBs_P-C of FT:mat_peptide EU139540_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate zxq-8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLEPLLVLQAGFFLLTRILTIPLSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWAYI
>gnl|hbvpro|EU139541_SHBs_P-C Product feature CHAIN EU139541_SHBs_P-C of FT:mat_peptide EU139541_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate zxq-9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENRTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSLTSNHSQISCPPICPGYRLMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTNSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU305540_SHBs_P-C Product feature CHAIN EU305540_SHBs_P-C of FT:mat_peptide EU305540_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-123). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU305541_SHBs_P-C Product feature CHAIN EU305541_SHBs_P-C of FT:mat_peptide EU305541_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-190). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPLSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU305542_SHBs_P-C Product feature CHAIN EU305542_SHBs_P-C of FT:mat_peptide EU305542_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G67-1251). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVCFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306671_SHBs_P-C Product feature CHAIN EU306671_SHBs_P-C of FT:mat_peptide EU306671_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGCRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306672_SHBs_P-C Product feature CHAIN EU306672_SHBs_P-C of FT:mat_peptide EU306672_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306673_SHBs_P-C Product feature CHAIN EU306673_SHBs_P-C of FT:mat_peptide EU306673_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCPRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306674_SHBs_P-C Product feature CHAIN EU306674_SHBs_P-C of FT:mat_peptide EU306674_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQPPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306675_SHBs_P-C Product feature CHAIN EU306675_SHBs_P-C of FT:mat_peptide EU306675_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306676_SHBs_P-C Product feature CHAIN EU306676_SHBs_P-C of FT:mat_peptide EU306676_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306685_SHBs_P-C Product feature CHAIN EU306685_SHBs_P-C of FT:mat_peptide EU306685_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306687_SHBs_P-C Product feature CHAIN EU306687_SHBs_P-C of FT:mat_peptide EU306687_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306688_SHBs_P-C Product feature CHAIN EU306688_SHBs_P-C of FT:mat_peptide EU306688_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306689_SHBs_P-C Product feature CHAIN EU306689_SHBs_P-C of FT:mat_peptide EU306689_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306690_SHBs_P-C Product feature CHAIN EU306690_SHBs_P-C of FT:mat_peptide EU306690_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESATSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306691_SHBs_P-C Product feature CHAIN EU306691_SHBs_P-C of FT:mat_peptide EU306691_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPISCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306694_SHBs_P-C Product feature CHAIN EU306694_SHBs_P-C of FT:mat_peptide EU306694_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306713_SHBs_P-C Product feature CHAIN EU306713_SHBs_P-C of FT:mat_peptide EU306713_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLPCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306714_SHBs_P-C Product feature CHAIN EU306714_SHBs_P-C of FT:mat_peptide EU306714_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306719_SHBs_P-C Product feature CHAIN EU306719_SHBs_P-C of FT:mat_peptide EU306719_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLSVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306720_SHBs_P-C Product feature CHAIN EU306720_SHBs_P-C of FT:mat_peptide EU306720_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306721_SHBs_P-C Product feature CHAIN EU306721_SHBs_P-C of FT:mat_peptide EU306721_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGSCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306722_SHBs_P-C Product feature CHAIN EU306722_SHBs_P-C of FT:mat_peptide EU306722_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306725_SHBs_P-C Product feature CHAIN EU306725_SHBs_P-C of FT:mat_peptide EU306725_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306726_SHBs_P-C Product feature CHAIN EU306726_SHBs_P-C of FT:mat_peptide EU306726_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306727_SHBs_P-C Product feature CHAIN EU306727_SHBs_P-C of FT:mat_peptide EU306727_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSQTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWPSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU306728_SHBs_P-C Product feature CHAIN EU306728_SHBs_P-C of FT:mat_peptide EU306728_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU410079_SHBs_P-C Product feature CHAIN EU410079_SHBs_P-C of FT:mat_peptide EU410079_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph109). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU410080_SHBs_P-C Product feature CHAIN EU410080_SHBs_P-C of FT:mat_peptide EU410080_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph76). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU410081_SHBs_P-C Product feature CHAIN EU410081_SHBs_P-C of FT:mat_peptide EU410081_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph80). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU439009_SHBs_P-C Product feature CHAIN EU439009_SHBs_P-C of FT:mat_peptide EU439009_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFSLTRILSIPQSLDSWWTSLNFLGGAPTCPGQNSQSLTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU439015_SHBs_P-C Product feature CHAIN EU439015_SHBs_P-C of FT:mat_peptide EU439015_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU498227_SHBs_P-C Product feature CHAIN EU498227_SHBs_P-C of FT:mat_peptide EU498227_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate JL). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTTTTSRGPCRTCTTPAQGTSMFPSCCCTKLSDANCTCIPIPTSGAFAK
FLWGSASVRFSWLNSLVPFVQWFEELSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU522068_SHBs_P-C Product feature CHAIN EU522068_SHBs_P-C of FT:mat_peptide EU522068_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 5N). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDSRGMLRVCPLLPGTSTTSTGPCKTCTIPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU522071_SHBs_P-C Product feature CHAIN EU522071_SHBs_P-C of FT:mat_peptide EU522071_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient 7T). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTLPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU547559_SHBs_P-C Product feature CHAIN EU547559_SHBs_P-C of FT:mat_peptide EU547559_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MC02). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU547562_SHBs_P-C Product feature CHAIN EU547562_SHBs_P-C of FT:mat_peptide EU547562_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate MC05). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRXF
IIFLFILLLCLIFLLVLVDXQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554535_SHBs_P-C Product feature CHAIN EU554535_SHBs_P-C of FT:mat_peptide EU554535_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-20). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGASMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554536_SHBs_P-C Product feature CHAIN EU554536_SHBs_P-C of FT:mat_peptide EU554536_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S472-24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGASTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWAPVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554537_SHBs_P-C Product feature CHAIN EU554537_SHBs_P-C of FT:mat_peptide EU554537_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCRTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554538_SHBs_P-C Product feature CHAIN EU554538_SHBs_P-C of FT:mat_peptide EU554538_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554539_SHBs_P-C Product feature CHAIN EU554539_SHBs_P-C of FT:mat_peptide EU554539_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S541-21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554540_SHBs_P-C Product feature CHAIN EU554540_SHBs_P-C of FT:mat_peptide EU554540_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S304-10). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU554541_SHBs_P-C Product feature CHAIN EU554541_SHBs_P-C of FT:mat_peptide EU554541_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWPSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|EU554542_SHBs_P-C Product feature CHAIN EU554542_SHBs_P-C of FT:mat_peptide EU554542_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|EU560438_SHBs_P-C Product feature CHAIN EU560438_SHBs_P-C of FT:mat_peptide EU560438_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2-B74). Complete genome. [Hepadnaviridae] (length=226 residues).
MENAASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVTPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU560439_SHBs_P-C Product feature CHAIN EU560439_SHBs_P-C of FT:mat_peptide EU560439_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7-B74). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSAGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU560440_SHBs_P-C Product feature CHAIN EU560440_SHBs_P-C of FT:mat_peptide EU560440_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-S869). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU560441_SHBs_P-C Product feature CHAIN EU560441_SHBs_P-C of FT:mat_peptide EU560441_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 4-S869). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLSPIFFCLWVYI
>gnl|hbvpro|EU562215_SHBs_P-C Product feature CHAIN EU562215_SHBs_P-C of FT:mat_peptide EU562215_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTYTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU562217_SHBs_P-C Product feature CHAIN EU562217_SHBs_P-C of FT:mat_peptide EU562217_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 16). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU562218_SHBs_P-C Product feature CHAIN EU562218_SHBs_P-C of FT:mat_peptide EU562218_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570067_SHBs_P-C Product feature CHAIN EU570067_SHBs_P-C of FT:mat_peptide EU570067_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 18-S541). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGCRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGDCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU570068_SHBs_P-C Product feature CHAIN EU570068_SHBs_P-C of FT:mat_peptide EU570068_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 26-S541). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570072_SHBs_P-C Product feature CHAIN EU570072_SHBs_P-C of FT:mat_peptide EU570072_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1-B74). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSSHSPTSCPPICPGYRWICLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPLSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570073_SHBs_P-C Product feature CHAIN EU570073_SHBs_P-C of FT:mat_peptide EU570073_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 8-S698). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCIKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU570074_SHBs_P-C Product feature CHAIN EU570074_SHBs_P-C of FT:mat_peptide EU570074_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 11-S698). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGNSTFPSCCCIKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU579442_SHBs_P-C Product feature CHAIN EU579442_SHBs_P-C of FT:mat_peptide EU579442_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|EU579443_SHBs_P-C Product feature CHAIN EU579443_SHBs_P-C of FT:mat_peptide EU579443_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU589336_SHBs_P-C Product feature CHAIN EU589336_SHBs_P-C of FT:mat_peptide EU589336_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1175-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|EU589340_SHBs_P-C Product feature CHAIN EU589340_SHBs_P-C of FT:mat_peptide EU589340_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-7). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|EU589341_SHBs_P-C Product feature CHAIN EU589341_SHBs_P-C of FT:mat_peptide EU589341_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-10). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWLVGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU589342_SHBs_P-C Product feature CHAIN EU589342_SHBs_P-C of FT:mat_peptide EU589342_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S852-13). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMIPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|EU589345_SHBs_P-C Product feature CHAIN EU589345_SHBs_P-C of FT:mat_peptide EU589345_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S624-2). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU670263_SHBs_P-C Product feature CHAIN EU670263_SHBs_P-C of FT:mat_peptide EU670263_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate ph105). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU717212_SHBs_P-C Product feature CHAIN EU717212_SHBs_P-C of FT:mat_peptide EU717212_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D26K-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU717214_SHBs_P-C Product feature CHAIN EU717214_SHBs_P-C of FT:mat_peptide EU717214_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate G62K-8). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLSFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU717215_SHBs_P-C Product feature CHAIN EU717215_SHBs_P-C of FT:mat_peptide EU717215_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q67K-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPANGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU717217_SHBs_P-C Product feature CHAIN EU717217_SHBs_P-C of FT:mat_peptide EU717217_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q53K-4). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLISLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGNSTVPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU717218_SHBs_P-C Product feature CHAIN EU717218_SHBs_P-C of FT:mat_peptide EU717218_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 107-3/C8). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDLWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU796069_SHBs_P-C Product feature CHAIN EU796069_SHBs_P-C of FT:mat_peptide EU796069_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAS
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU796070_SHBs_P-C Product feature CHAIN EU796070_SHBs_P-C of FT:mat_peptide EU796070_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU796072_SHBs_P-C Product feature CHAIN EU796072_SHBs_P-C of FT:mat_peptide EU796072_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871969_SHBs_P-C Product feature CHAIN EU871969_SHBs_P-C of FT:mat_peptide EU871969_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871970_SHBs_P-C Product feature CHAIN EU871970_SHBs_P-C of FT:mat_peptide EU871970_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLHPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871971_SHBs_P-C Product feature CHAIN EU871971_SHBs_P-C of FT:mat_peptide EU871971_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFCCLWVYI
>gnl|hbvpro|EU871972_SHBs_P-C Product feature CHAIN EU871972_SHBs_P-C of FT:mat_peptide EU871972_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLALFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871973_SHBs_P-C Product feature CHAIN EU871973_SHBs_P-C of FT:mat_peptide EU871973_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024-99-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871974_SHBs_P-C Product feature CHAIN EU871974_SHBs_P-C of FT:mat_peptide EU871974_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGRLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPISCCLWAYI
>gnl|hbvpro|EU871975_SHBs_P-C Product feature CHAIN EU871975_SHBs_P-C of FT:mat_peptide EU871975_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 6-024A-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871976_SHBs_P-C Product feature CHAIN EU871976_SHBs_P-C of FT:mat_peptide EU871976_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-04-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871977_SHBs_P-C Product feature CHAIN EU871977_SHBs_P-C of FT:mat_peptide EU871977_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871978_SHBs_P-C Product feature CHAIN EU871978_SHBs_P-C of FT:mat_peptide EU871978_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-2). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQTGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871979_SHBs_P-C Product feature CHAIN EU871979_SHBs_P-C of FT:mat_peptide EU871979_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-95-4). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871980_SHBs_P-C Product feature CHAIN EU871980_SHBs_P-C of FT:mat_peptide EU871980_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-01-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871982_SHBs_P-C Product feature CHAIN EU871982_SHBs_P-C of FT:mat_peptide EU871982_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-96-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU871998_SHBs_P-C Product feature CHAIN EU871998_SHBs_P-C of FT:mat_peptide EU871998_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-00-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872000_SHBs_P-C Product feature CHAIN EU872000_SHBs_P-C of FT:mat_peptide EU872000_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTIWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872001_SHBs_P-C Product feature CHAIN EU872001_SHBs_P-C of FT:mat_peptide EU872001_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-92-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872002_SHBs_P-C Product feature CHAIN EU872002_SHBs_P-C of FT:mat_peptide EU872002_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVCI
>gnl|hbvpro|EU872003_SHBs_P-C Product feature CHAIN EU872003_SHBs_P-C of FT:mat_peptide EU872003_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872004_SHBs_P-C Product feature CHAIN EU872004_SHBs_P-C of FT:mat_peptide EU872004_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 530-97-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872005_SHBs_P-C Product feature CHAIN EU872005_SHBs_P-C of FT:mat_peptide EU872005_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 179-96-1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLSFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872008_SHBs_P-C Product feature CHAIN EU872008_SHBs_P-C of FT:mat_peptide EU872008_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252A-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGNSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872010_SHBs_P-C Product feature CHAIN EU872010_SHBs_P-C of FT:mat_peptide EU872010_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 252-92-3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872012_SHBs_P-C Product feature CHAIN EU872012_SHBs_P-C of FT:mat_peptide EU872012_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-99-5). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLLGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU872013_SHBs_P-C Product feature CHAIN EU872013_SHBs_P-C of FT:mat_peptide EU872013_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 318-99-6). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFPFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGSSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU881996_SHBs_P-C Product feature CHAIN EU881996_SHBs_P-C of FT:mat_peptide EU881996_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGTCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|EU882005_SHBs_P-C Product feature CHAIN EU882005_SHBs_P-C of FT:mat_peptide EU882005_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient22). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916210_SHBs_P-C Product feature CHAIN EU916210_SHBs_P-C of FT:mat_peptide EU916210_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2.4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916211_SHBs_P-C Product feature CHAIN EU916211_SHBs_P-C of FT:mat_peptide EU916211_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916212_SHBs_P-C Product feature CHAIN EU916212_SHBs_P-C of FT:mat_peptide EU916212_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLGYQGMLPVCPLLPGTSTASTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916213_SHBs_P-C Product feature CHAIN EU916213_SHBs_P-C of FT:mat_peptide EU916213_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.3). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916214_SHBs_P-C Product feature CHAIN EU916214_SHBs_P-C of FT:mat_peptide EU916214_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3.4). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916215_SHBs_P-C Product feature CHAIN EU916215_SHBs_P-C of FT:mat_peptide EU916215_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916216_SHBs_P-C Product feature CHAIN EU916216_SHBs_P-C of FT:mat_peptide EU916216_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.2). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAHVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916217_SHBs_P-C Product feature CHAIN EU916217_SHBs_P-C of FT:mat_peptide EU916217_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAHVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916218_SHBs_P-C Product feature CHAIN EU916218_SHBs_P-C of FT:mat_peptide EU916218_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4.4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGRNSQSPTPNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916219_SHBs_P-C Product feature CHAIN EU916219_SHBs_P-C of FT:mat_peptide EU916219_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKICTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916222_SHBs_P-C Product feature CHAIN EU916222_SHBs_P-C of FT:mat_peptide EU916222_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S5.4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916223_SHBs_P-C Product feature CHAIN EU916223_SHBs_P-C of FT:mat_peptide EU916223_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916224_SHBs_P-C Product feature CHAIN EU916224_SHBs_P-C of FT:mat_peptide EU916224_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916225_SHBs_P-C Product feature CHAIN EU916225_SHBs_P-C of FT:mat_peptide EU916225_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S6.3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWERASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSPYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916226_SHBs_P-C Product feature CHAIN EU916226_SHBs_P-C of FT:mat_peptide EU916226_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916227_SHBs_P-C Product feature CHAIN EU916227_SHBs_P-C of FT:mat_peptide EU916227_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7.2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|EU916233_SHBs_P-C Product feature CHAIN EU916233_SHBs_P-C of FT:mat_peptide EU916233_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNRSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916234_SHBs_P-C Product feature CHAIN EU916234_SHBs_P-C of FT:mat_peptide EU916234_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT1.2). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPRKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916237_SHBs_P-C Product feature CHAIN EU916237_SHBs_P-C of FT:mat_peptide EU916237_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU916238_SHBs_P-C Product feature CHAIN EU916238_SHBs_P-C of FT:mat_peptide EU916238_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate SWT2.3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU919165_SHBs_P-C Product feature CHAIN EU919165_SHBs_P-C of FT:mat_peptide EU919165_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient24). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|EU919168_SHBs_P-C Product feature CHAIN EU919168_SHBs_P-C of FT:mat_peptide EU919168_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU919169_SHBs_P-C Product feature CHAIN EU919169_SHBs_P-C of FT:mat_peptide EU919169_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate patient26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTATTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|EU921790_SHBs_P-C Product feature CHAIN EU921790_SHBs_P-C of FT:mat_peptide EU921790_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU921792_SHBs_P-C Product feature CHAIN EU921792_SHBs_P-C of FT:mat_peptide EU921792_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIXMMWXWGPSXYNILRPFLPLLPICFWLWVYI
>gnl|hbvpro|EU921793_SHBs_P-C Product feature CHAIN EU921793_SHBs_P-C of FT:mat_peptide EU921793_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEYTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU921795_SHBs_P-C Product feature CHAIN EU921795_SHBs_P-C of FT:mat_peptide EU921795_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVFI
>gnl|hbvpro|EU921796_SHBs_P-C Product feature CHAIN EU921796_SHBs_P-C of FT:mat_peptide EU921796_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|EU921797_SHBs_P-C Product feature CHAIN EU921797_SHBs_P-C of FT:mat_peptide EU921797_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIXMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU921798_SHBs_P-C Product feature CHAIN EU921798_SHBs_P-C of FT:mat_peptide EU921798_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU921799_SHBs_P-C Product feature CHAIN EU921799_SHBs_P-C of FT:mat_peptide EU921799_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|EU926420_SHBs_P-C Product feature CHAIN EU926420_SHBs_P-C of FT:mat_peptide EU926420_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926421_SHBs_P-C Product feature CHAIN EU926421_SHBs_P-C of FT:mat_peptide EU926421_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926422_SHBs_P-C Product feature CHAIN EU926422_SHBs_P-C of FT:mat_peptide EU926422_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926423_SHBs_P-C Product feature CHAIN EU926423_SHBs_P-C of FT:mat_peptide EU926423_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926424_SHBs_P-C Product feature CHAIN EU926424_SHBs_P-C of FT:mat_peptide EU926424_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926425_SHBs_P-C Product feature CHAIN EU926425_SHBs_P-C of FT:mat_peptide EU926425_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926426_SHBs_P-C Product feature CHAIN EU926426_SHBs_P-C of FT:mat_peptide EU926426_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926427_SHBs_P-C Product feature CHAIN EU926427_SHBs_P-C of FT:mat_peptide EU926427_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926428_SHBs_P-C Product feature CHAIN EU926428_SHBs_P-C of FT:mat_peptide EU926428_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926429_SHBs_P-C Product feature CHAIN EU926429_SHBs_P-C of FT:mat_peptide EU926429_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926430_SHBs_P-C Product feature CHAIN EU926430_SHBs_P-C of FT:mat_peptide EU926430_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926431_SHBs_P-C Product feature CHAIN EU926431_SHBs_P-C of FT:mat_peptide EU926431_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926433_SHBs_P-C Product feature CHAIN EU926433_SHBs_P-C of FT:mat_peptide EU926433_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926435_SHBs_P-C Product feature CHAIN EU926435_SHBs_P-C of FT:mat_peptide EU926435_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926438_SHBs_P-C Product feature CHAIN EU926438_SHBs_P-C of FT:mat_peptide EU926438_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926439_SHBs_P-C Product feature CHAIN EU926439_SHBs_P-C of FT:mat_peptide EU926439_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPIXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926441_SHBs_P-C Product feature CHAIN EU926441_SHBs_P-C of FT:mat_peptide EU926441_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926442_SHBs_P-C Product feature CHAIN EU926442_SHBs_P-C of FT:mat_peptide EU926442_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLFXXYPXTQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|EU926444_SHBs_P-C Product feature CHAIN EU926444_SHBs_P-C of FT:mat_peptide EU926444_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926445_SHBs_P-C Product feature CHAIN EU926445_SHBs_P-C of FT:mat_peptide EU926445_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPTCPGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|EU926446_SHBs_P-C Product feature CHAIN EU926446_SHBs_P-C of FT:mat_peptide EU926446_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPTCPGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|EU926447_SHBs_P-C Product feature CHAIN EU926447_SHBs_P-C of FT:mat_peptide EU926447_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|EU926449_SHBs_P-C Product feature CHAIN EU926449_SHBs_P-C of FT:mat_peptide EU926449_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926451_SHBs_P-C Product feature CHAIN EU926451_SHBs_P-C of FT:mat_peptide EU926451_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU926452_SHBs_P-C Product feature CHAIN EU926452_SHBs_P-C of FT:mat_peptide EU926452_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926453_SHBs_P-C Product feature CHAIN EU926453_SHBs_P-C of FT:mat_peptide EU926453_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTCMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926454_SHBs_P-C Product feature CHAIN EU926454_SHBs_P-C of FT:mat_peptide EU926454_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926456_SHBs_P-C Product feature CHAIN EU926456_SHBs_P-C of FT:mat_peptide EU926456_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLICLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU926457_SHBs_P-C Product feature CHAIN EU926457_SHBs_P-C of FT:mat_peptide EU926457_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGXAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU926458_SHBs_P-C Product feature CHAIN EU926458_SHBs_P-C of FT:mat_peptide EU926458_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926459_SHBs_P-C Product feature CHAIN EU926459_SHBs_P-C of FT:mat_peptide EU926459_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926461_SHBs_P-C Product feature CHAIN EU926461_SHBs_P-C of FT:mat_peptide EU926461_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPIXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPXVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926463_SHBs_P-C Product feature CHAIN EU926463_SHBs_P-C of FT:mat_peptide EU926463_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926466_SHBs_P-C Product feature CHAIN EU926466_SHBs_P-C of FT:mat_peptide EU926466_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926467_SHBs_P-C Product feature CHAIN EU926467_SHBs_P-C of FT:mat_peptide EU926467_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926468_SHBs_P-C Product feature CHAIN EU926468_SHBs_P-C of FT:mat_peptide EU926468_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU926469_SHBs_P-C Product feature CHAIN EU926469_SHBs_P-C of FT:mat_peptide EU926469_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYM
>gnl|hbvpro|EU926472_SHBs_P-C Product feature CHAIN EU926472_SHBs_P-C of FT:mat_peptide EU926472_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927150_SHBs_P-C Product feature CHAIN EU927150_SHBs_P-C of FT:mat_peptide EU927150_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927151_SHBs_P-C Product feature CHAIN EU927151_SHBs_P-C of FT:mat_peptide EU927151_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927152_SHBs_P-C Product feature CHAIN EU927152_SHBs_P-C of FT:mat_peptide EU927152_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPXSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927153_SHBs_P-C Product feature CHAIN EU927153_SHBs_P-C of FT:mat_peptide EU927153_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPXVQWFVGLSPXVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927154_SHBs_P-C Product feature CHAIN EU927154_SHBs_P-C of FT:mat_peptide EU927154_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927157_SHBs_P-C Product feature CHAIN EU927157_SHBs_P-C of FT:mat_peptide EU927157_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927158_SHBs_P-C Product feature CHAIN EU927158_SHBs_P-C of FT:mat_peptide EU927158_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927159_SHBs_P-C Product feature CHAIN EU927159_SHBs_P-C of FT:mat_peptide EU927159_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927160_SHBs_P-C Product feature CHAIN EU927160_SHBs_P-C of FT:mat_peptide EU927160_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927161_SHBs_P-C Product feature CHAIN EU927161_SHBs_P-C of FT:mat_peptide EU927161_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927162_SHBs_P-C Product feature CHAIN EU927162_SHBs_P-C of FT:mat_peptide EU927162_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU927163_SHBs_P-C Product feature CHAIN EU927163_SHBs_P-C of FT:mat_peptide EU927163_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|EU927165_SHBs_P-C Product feature CHAIN EU927165_SHBs_P-C of FT:mat_peptide EU927165_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWIYI
>gnl|hbvpro|EU927166_SHBs_P-C Product feature CHAIN EU927166_SHBs_P-C of FT:mat_peptide EU927166_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927167_SHBs_P-C Product feature CHAIN EU927167_SHBs_P-C of FT:mat_peptide EU927167_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927168_SHBs_P-C Product feature CHAIN EU927168_SHBs_P-C of FT:mat_peptide EU927168_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSQTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927169_SHBs_P-C Product feature CHAIN EU927169_SHBs_P-C of FT:mat_peptide EU927169_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSNHSXTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927170_SHBs_P-C Product feature CHAIN EU927170_SHBs_P-C of FT:mat_peptide EU927170_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927171_SHBs_P-C Product feature CHAIN EU927171_SHBs_P-C of FT:mat_peptide EU927171_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHXXTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTNSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927172_SHBs_P-C Product feature CHAIN EU927172_SHBs_P-C of FT:mat_peptide EU927172_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927173_SHBs_P-C Product feature CHAIN EU927173_SHBs_P-C of FT:mat_peptide EU927173_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927174_SHBs_P-C Product feature CHAIN EU927174_SHBs_P-C of FT:mat_peptide EU927174_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927175_SHBs_P-C Product feature CHAIN EU927175_SHBs_P-C of FT:mat_peptide EU927175_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927176_SHBs_P-C Product feature CHAIN EU927176_SHBs_P-C of FT:mat_peptide EU927176_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927178_SHBs_P-C Product feature CHAIN EU927178_SHBs_P-C of FT:mat_peptide EU927178_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927179_SHBs_P-C Product feature CHAIN EU927179_SHBs_P-C of FT:mat_peptide EU927179_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927180_SHBs_P-C Product feature CHAIN EU927180_SHBs_P-C of FT:mat_peptide EU927180_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927182_SHBs_P-C Product feature CHAIN EU927182_SHBs_P-C of FT:mat_peptide EU927182_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|EU927183_SHBs_P-C Product feature CHAIN EU927183_SHBs_P-C of FT:mat_peptide EU927183_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRLMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927184_SHBs_P-C Product feature CHAIN EU927184_SHBs_P-C of FT:mat_peptide EU927184_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927185_SHBs_P-C Product feature CHAIN EU927185_SHBs_P-C of FT:mat_peptide EU927185_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAX
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927186_SHBs_P-C Product feature CHAIN EU927186_SHBs_P-C of FT:mat_peptide EU927186_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927188_SHBs_P-C Product feature CHAIN EU927188_SHBs_P-C of FT:mat_peptide EU927188_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927193_SHBs_P-C Product feature CHAIN EU927193_SHBs_P-C of FT:mat_peptide EU927193_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFYLWVYI
>gnl|hbvpro|EU927194_SHBs_P-C Product feature CHAIN EU927194_SHBs_P-C of FT:mat_peptide EU927194_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927195_SHBs_P-C Product feature CHAIN EU927195_SHBs_P-C of FT:mat_peptide EU927195_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927196_SHBs_P-C Product feature CHAIN EU927196_SHBs_P-C of FT:mat_peptide EU927196_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927197_SHBs_P-C Product feature CHAIN EU927197_SHBs_P-C of FT:mat_peptide EU927197_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHXPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927199_SHBs_P-C Product feature CHAIN EU927199_SHBs_P-C of FT:mat_peptide EU927199_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927202_SHBs_P-C Product feature CHAIN EU927202_SHBs_P-C of FT:mat_peptide EU927202_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927203_SHBs_P-C Product feature CHAIN EU927203_SHBs_P-C of FT:mat_peptide EU927203_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTASXFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPXVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927204_SHBs_P-C Product feature CHAIN EU927204_SHBs_P-C of FT:mat_peptide EU927204_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927205_SHBs_P-C Product feature CHAIN EU927205_SHBs_P-C of FT:mat_peptide EU927205_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927206_SHBs_P-C Product feature CHAIN EU927206_SHBs_P-C of FT:mat_peptide EU927206_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927207_SHBs_P-C Product feature CHAIN EU927207_SHBs_P-C of FT:mat_peptide EU927207_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927208_SHBs_P-C Product feature CHAIN EU927208_SHBs_P-C of FT:mat_peptide EU927208_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927209_SHBs_P-C Product feature CHAIN EU927209_SHBs_P-C of FT:mat_peptide EU927209_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPLVQWXVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927211_SHBs_P-C Product feature CHAIN EU927211_SHBs_P-C of FT:mat_peptide EU927211_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927212_SHBs_P-C Product feature CHAIN EU927212_SHBs_P-C of FT:mat_peptide EU927212_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927214_SHBs_P-C Product feature CHAIN EU927214_SHBs_P-C of FT:mat_peptide EU927214_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927217_SHBs_P-C Product feature CHAIN EU927217_SHBs_P-C of FT:mat_peptide EU927217_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVXWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927218_SHBs_P-C Product feature CHAIN EU927218_SHBs_P-C of FT:mat_peptide EU927218_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927219_SHBs_P-C Product feature CHAIN EU927219_SHBs_P-C of FT:mat_peptide EU927219_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLRDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927221_SHBs_P-C Product feature CHAIN EU927221_SHBs_P-C of FT:mat_peptide EU927221_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927225_SHBs_P-C Product feature CHAIN EU927225_SHBs_P-C of FT:mat_peptide EU927225_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927227_SHBs_P-C Product feature CHAIN EU927227_SHBs_P-C of FT:mat_peptide EU927227_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927228_SHBs_P-C Product feature CHAIN EU927228_SHBs_P-C of FT:mat_peptide EU927228_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927229_SHBs_P-C Product feature CHAIN EU927229_SHBs_P-C of FT:mat_peptide EU927229_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927230_SHBs_P-C Product feature CHAIN EU927230_SHBs_P-C of FT:mat_peptide EU927230_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLXLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU927232_SHBs_P-C Product feature CHAIN EU927232_SHBs_P-C of FT:mat_peptide EU927232_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927237_SHBs_P-C Product feature CHAIN EU927237_SHBs_P-C of FT:mat_peptide EU927237_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927238_SHBs_P-C Product feature CHAIN EU927238_SHBs_P-C of FT:mat_peptide EU927238_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927240_SHBs_P-C Product feature CHAIN EU927240_SHBs_P-C of FT:mat_peptide EU927240_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927241_SHBs_P-C Product feature CHAIN EU927241_SHBs_P-C of FT:mat_peptide EU927241_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVRLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYL
>gnl|hbvpro|EU927245_SHBs_P-C Product feature CHAIN EU927245_SHBs_P-C of FT:mat_peptide EU927245_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927246_SHBs_P-C Product feature CHAIN EU927246_SHBs_P-C of FT:mat_peptide EU927246_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927248_SHBs_P-C Product feature CHAIN EU927248_SHBs_P-C of FT:mat_peptide EU927248_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLXYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927249_SHBs_P-C Product feature CHAIN EU927249_SHBs_P-C of FT:mat_peptide EU927249_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927250_SHBs_P-C Product feature CHAIN EU927250_SHBs_P-C of FT:mat_peptide EU927250_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927252_SHBs_P-C Product feature CHAIN EU927252_SHBs_P-C of FT:mat_peptide EU927252_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927253_SHBs_P-C Product feature CHAIN EU927253_SHBs_P-C of FT:mat_peptide EU927253_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927254_SHBs_P-C Product feature CHAIN EU927254_SHBs_P-C of FT:mat_peptide EU927254_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927255_SHBs_P-C Product feature CHAIN EU927255_SHBs_P-C of FT:mat_peptide EU927255_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927256_SHBs_P-C Product feature CHAIN EU927256_SHBs_P-C of FT:mat_peptide EU927256_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927257_SHBs_P-C Product feature CHAIN EU927257_SHBs_P-C of FT:mat_peptide EU927257_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927258_SHBs_P-C Product feature CHAIN EU927258_SHBs_P-C of FT:mat_peptide EU927258_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927259_SHBs_P-C Product feature CHAIN EU927259_SHBs_P-C of FT:mat_peptide EU927259_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927260_SHBs_P-C Product feature CHAIN EU927260_SHBs_P-C of FT:mat_peptide EU927260_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927261_SHBs_P-C Product feature CHAIN EU927261_SHBs_P-C of FT:mat_peptide EU927261_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927262_SHBs_P-C Product feature CHAIN EU927262_SHBs_P-C of FT:mat_peptide EU927262_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPGLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927263_SHBs_P-C Product feature CHAIN EU927263_SHBs_P-C of FT:mat_peptide EU927263_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927264_SHBs_P-C Product feature CHAIN EU927264_SHBs_P-C of FT:mat_peptide EU927264_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927265_SHBs_P-C Product feature CHAIN EU927265_SHBs_P-C of FT:mat_peptide EU927265_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927266_SHBs_P-C Product feature CHAIN EU927266_SHBs_P-C of FT:mat_peptide EU927266_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYM
>gnl|hbvpro|EU927267_SHBs_P-C Product feature CHAIN EU927267_SHBs_P-C of FT:mat_peptide EU927267_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927268_SHBs_P-C Product feature CHAIN EU927268_SHBs_P-C of FT:mat_peptide EU927268_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPISNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927269_SHBs_P-C Product feature CHAIN EU927269_SHBs_P-C of FT:mat_peptide EU927269_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927270_SHBs_P-C Product feature CHAIN EU927270_SHBs_P-C of FT:mat_peptide EU927270_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927271_SHBs_P-C Product feature CHAIN EU927271_SHBs_P-C of FT:mat_peptide EU927271_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MGNTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHXPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927273_SHBs_P-C Product feature CHAIN EU927273_SHBs_P-C of FT:mat_peptide EU927273_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIXIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927274_SHBs_P-C Product feature CHAIN EU927274_SHBs_P-C of FT:mat_peptide EU927274_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927275_SHBs_P-C Product feature CHAIN EU927275_SHBs_P-C of FT:mat_peptide EU927275_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927276_SHBs_P-C Product feature CHAIN EU927276_SHBs_P-C of FT:mat_peptide EU927276_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927277_SHBs_P-C Product feature CHAIN EU927277_SHBs_P-C of FT:mat_peptide EU927277_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIXIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927278_SHBs_P-C Product feature CHAIN EU927278_SHBs_P-C of FT:mat_peptide EU927278_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927280_SHBs_P-C Product feature CHAIN EU927280_SHBs_P-C of FT:mat_peptide EU927280_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGXAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927281_SHBs_P-C Product feature CHAIN EU927281_SHBs_P-C of FT:mat_peptide EU927281_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927282_SHBs_P-C Product feature CHAIN EU927282_SHBs_P-C of FT:mat_peptide EU927282_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927283_SHBs_P-C Product feature CHAIN EU927283_SHBs_P-C of FT:mat_peptide EU927283_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU927285_SHBs_P-C Product feature CHAIN EU927285_SHBs_P-C of FT:mat_peptide EU927285_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICRGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVDI
>gnl|hbvpro|EU939536_SHBs_P-C Product feature CHAIN EU939536_SHBs_P-C of FT:mat_peptide EU939536_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939537_SHBs_P-C Product feature CHAIN EU939537_SHBs_P-C of FT:mat_peptide EU939537_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C8). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLXFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939538_SHBs_P-C Product feature CHAIN EU939538_SHBs_P-C of FT:mat_peptide EU939538_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939539_SHBs_P-C Product feature CHAIN EU939539_SHBs_P-C of FT:mat_peptide EU939539_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGRSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|EU939540_SHBs_P-C Product feature CHAIN EU939540_SHBs_P-C of FT:mat_peptide EU939540_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939541_SHBs_P-C Product feature CHAIN EU939541_SHBs_P-C of FT:mat_peptide EU939541_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939542_SHBs_P-C Product feature CHAIN EU939542_SHBs_P-C of FT:mat_peptide EU939542_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVSI
>gnl|hbvpro|EU939543_SHBs_P-C Product feature CHAIN EU939543_SHBs_P-C of FT:mat_peptide EU939543_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C38). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939544_SHBs_P-C Product feature CHAIN EU939544_SHBs_P-C of FT:mat_peptide EU939544_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYT
>gnl|hbvpro|EU939545_SHBs_P-C Product feature CHAIN EU939545_SHBs_P-C of FT:mat_peptide EU939545_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C41). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939546_SHBs_P-C Product feature CHAIN EU939546_SHBs_P-C of FT:mat_peptide EU939546_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939548_SHBs_P-C Product feature CHAIN EU939548_SHBs_P-C of FT:mat_peptide EU939548_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C46). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939550_SHBs_P-C Product feature CHAIN EU939550_SHBs_P-C of FT:mat_peptide EU939550_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C55). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939552_SHBs_P-C Product feature CHAIN EU939552_SHBs_P-C of FT:mat_peptide EU939552_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C57). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939553_SHBs_P-C Product feature CHAIN EU939553_SHBs_P-C of FT:mat_peptide EU939553_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C60). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSXLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939554_SHBs_P-C Product feature CHAIN EU939554_SHBs_P-C of FT:mat_peptide EU939554_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C61). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYHWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939556_SHBs_P-C Product feature CHAIN EU939556_SHBs_P-C of FT:mat_peptide EU939556_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939557_SHBs_P-C Product feature CHAIN EU939557_SHBs_P-C of FT:mat_peptide EU939557_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C65). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTCNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939558_SHBs_P-C Product feature CHAIN EU939558_SHBs_P-C of FT:mat_peptide EU939558_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C66). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGEAPACPGQNSRSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|EU939560_SHBs_P-C Product feature CHAIN EU939560_SHBs_P-C of FT:mat_peptide EU939560_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C69). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939561_SHBs_P-C Product feature CHAIN EU939561_SHBs_P-C of FT:mat_peptide EU939561_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C70). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939562_SHBs_P-C Product feature CHAIN EU939562_SHBs_P-C of FT:mat_peptide EU939562_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C75). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939563_SHBs_P-C Product feature CHAIN EU939563_SHBs_P-C of FT:mat_peptide EU939563_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C76). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLXIFFCLWVYI
>gnl|hbvpro|EU939564_SHBs_P-C Product feature CHAIN EU939564_SHBs_P-C of FT:mat_peptide EU939564_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C77). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939566_SHBs_P-C Product feature CHAIN EU939566_SHBs_P-C of FT:mat_peptide EU939566_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C88). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939567_SHBs_P-C Product feature CHAIN EU939567_SHBs_P-C of FT:mat_peptide EU939567_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C91). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGRSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939568_SHBs_P-C Product feature CHAIN EU939568_SHBs_P-C of FT:mat_peptide EU939568_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C93). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWICLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939570_SHBs_P-C Product feature CHAIN EU939570_SHBs_P-C of FT:mat_peptide EU939570_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C103). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939571_SHBs_P-C Product feature CHAIN EU939571_SHBs_P-C of FT:mat_peptide EU939571_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C104). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939572_SHBs_P-C Product feature CHAIN EU939572_SHBs_P-C of FT:mat_peptide EU939572_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C105). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939573_SHBs_P-C Product feature CHAIN EU939573_SHBs_P-C of FT:mat_peptide EU939573_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C106). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939574_SHBs_P-C Product feature CHAIN EU939574_SHBs_P-C of FT:mat_peptide EU939574_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C109). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939576_SHBs_P-C Product feature CHAIN EU939576_SHBs_P-C of FT:mat_peptide EU939576_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C115). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939578_SHBs_P-C Product feature CHAIN EU939578_SHBs_P-C of FT:mat_peptide EU939578_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C119). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939579_SHBs_P-C Product feature CHAIN EU939579_SHBs_P-C of FT:mat_peptide EU939579_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C120). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPARGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939580_SHBs_P-C Product feature CHAIN EU939580_SHBs_P-C of FT:mat_peptide EU939580_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939582_SHBs_P-C Product feature CHAIN EU939582_SHBs_P-C of FT:mat_peptide EU939582_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939583_SHBs_P-C Product feature CHAIN EU939583_SHBs_P-C of FT:mat_peptide EU939583_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B31). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939585_SHBs_P-C Product feature CHAIN EU939585_SHBs_P-C of FT:mat_peptide EU939585_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B126). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939586_SHBs_P-C Product feature CHAIN EU939586_SHBs_P-C of FT:mat_peptide EU939586_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate B142). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939587_SHBs_P-C Product feature CHAIN EU939587_SHBs_P-C of FT:mat_peptide EU939587_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|EU939588_SHBs_P-C Product feature CHAIN EU939588_SHBs_P-C of FT:mat_peptide EU939588_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C173). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939590_SHBs_P-C Product feature CHAIN EU939590_SHBs_P-C of FT:mat_peptide EU939590_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C127). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939591_SHBs_P-C Product feature CHAIN EU939591_SHBs_P-C of FT:mat_peptide EU939591_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C131). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939592_SHBs_P-C Product feature CHAIN EU939592_SHBs_P-C of FT:mat_peptide EU939592_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C141). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGTPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939593_SHBs_P-C Product feature CHAIN EU939593_SHBs_P-C of FT:mat_peptide EU939593_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C144). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939594_SHBs_P-C Product feature CHAIN EU939594_SHBs_P-C of FT:mat_peptide EU939594_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C146). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939595_SHBs_P-C Product feature CHAIN EU939595_SHBs_P-C of FT:mat_peptide EU939595_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C147). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939596_SHBs_P-C Product feature CHAIN EU939596_SHBs_P-C of FT:mat_peptide EU939596_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C149). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPTCPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939597_SHBs_P-C Product feature CHAIN EU939597_SHBs_P-C of FT:mat_peptide EU939597_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C151). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939599_SHBs_P-C Product feature CHAIN EU939599_SHBs_P-C of FT:mat_peptide EU939599_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C172). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939600_SHBs_P-C Product feature CHAIN EU939600_SHBs_P-C of FT:mat_peptide EU939600_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C176). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939601_SHBs_P-C Product feature CHAIN EU939601_SHBs_P-C of FT:mat_peptide EU939601_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C177). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939603_SHBs_P-C Product feature CHAIN EU939603_SHBs_P-C of FT:mat_peptide EU939603_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C183). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDXNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLXPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939604_SHBs_P-C Product feature CHAIN EU939604_SHBs_P-C of FT:mat_peptide EU939604_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C192). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939605_SHBs_P-C Product feature CHAIN EU939605_SHBs_P-C of FT:mat_peptide EU939605_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C200). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939607_SHBs_P-C Product feature CHAIN EU939607_SHBs_P-C of FT:mat_peptide EU939607_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C207). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSQTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWAFI
>gnl|hbvpro|EU939609_SHBs_P-C Product feature CHAIN EU939609_SHBs_P-C of FT:mat_peptide EU939609_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C209). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939610_SHBs_P-C Product feature CHAIN EU939610_SHBs_P-C of FT:mat_peptide EU939610_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C211). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939611_SHBs_P-C Product feature CHAIN EU939611_SHBs_P-C of FT:mat_peptide EU939611_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C212). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939612_SHBs_P-C Product feature CHAIN EU939612_SHBs_P-C of FT:mat_peptide EU939612_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C213). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939613_SHBs_P-C Product feature CHAIN EU939613_SHBs_P-C of FT:mat_peptide EU939613_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C214). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939614_SHBs_P-C Product feature CHAIN EU939614_SHBs_P-C of FT:mat_peptide EU939614_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C217). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939615_SHBs_P-C Product feature CHAIN EU939615_SHBs_P-C of FT:mat_peptide EU939615_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C226). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939616_SHBs_P-C Product feature CHAIN EU939616_SHBs_P-C of FT:mat_peptide EU939616_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C228). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939617_SHBs_P-C Product feature CHAIN EU939617_SHBs_P-C of FT:mat_peptide EU939617_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C229). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939618_SHBs_P-C Product feature CHAIN EU939618_SHBs_P-C of FT:mat_peptide EU939618_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C230). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939619_SHBs_P-C Product feature CHAIN EU939619_SHBs_P-C of FT:mat_peptide EU939619_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C233). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSRSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939625_SHBs_P-C Product feature CHAIN EU939625_SHBs_P-C of FT:mat_peptide EU939625_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C167). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|EU939626_SHBs_P-C Product feature CHAIN EU939626_SHBs_P-C of FT:mat_peptide EU939626_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D158). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTFCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPXFFCLWVYI
>gnl|hbvpro|EU939640_SHBs_P-C Product feature CHAIN EU939640_SHBs_P-C of FT:mat_peptide EU939640_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C239). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTXNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939641_SHBs_P-C Product feature CHAIN EU939641_SHBs_P-C of FT:mat_peptide EU939641_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D18). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939642_SHBs_P-C Product feature CHAIN EU939642_SHBs_P-C of FT:mat_peptide EU939642_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D20). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939643_SHBs_P-C Product feature CHAIN EU939643_SHBs_P-C of FT:mat_peptide EU939643_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D32). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSSLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939644_SHBs_P-C Product feature CHAIN EU939644_SHBs_P-C of FT:mat_peptide EU939644_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D36). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEVPKCPGQNSQSPTFNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWFSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939645_SHBs_P-C Product feature CHAIN EU939645_SHBs_P-C of FT:mat_peptide EU939645_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D38). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU939647_SHBs_P-C Product feature CHAIN EU939647_SHBs_P-C of FT:mat_peptide EU939647_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D90). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939648_SHBs_P-C Product feature CHAIN EU939648_SHBs_P-C of FT:mat_peptide EU939648_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D96). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939649_SHBs_P-C Product feature CHAIN EU939649_SHBs_P-C of FT:mat_peptide EU939649_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D98). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939651_SHBs_P-C Product feature CHAIN EU939651_SHBs_P-C of FT:mat_peptide EU939651_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D104). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPACPGQNSQSPTSNHLPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTTTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939652_SHBs_P-C Product feature CHAIN EU939652_SHBs_P-C of FT:mat_peptide EU939652_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D107). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939653_SHBs_P-C Product feature CHAIN EU939653_SHBs_P-C of FT:mat_peptide EU939653_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D109). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939654_SHBs_P-C Product feature CHAIN EU939654_SHBs_P-C of FT:mat_peptide EU939654_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D115). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939655_SHBs_P-C Product feature CHAIN EU939655_SHBs_P-C of FT:mat_peptide EU939655_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D116). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939656_SHBs_P-C Product feature CHAIN EU939656_SHBs_P-C of FT:mat_peptide EU939656_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D117). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU939657_SHBs_P-C Product feature CHAIN EU939657_SHBs_P-C of FT:mat_peptide EU939657_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D139). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNTLRPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939659_SHBs_P-C Product feature CHAIN EU939659_SHBs_P-C of FT:mat_peptide EU939659_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate D165). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGAPRCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023639_SHBs_P-C Product feature CHAIN FJ023639_SHBs_P-C of FT:mat_peptide FJ023639_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-0968). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLXEGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023640_SHBs_P-C Product feature CHAIN FJ023640_SHBs_P-C of FT:mat_peptide FJ023640_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1206). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023641_SHBs_P-C Product feature CHAIN FJ023641_SHBs_P-C of FT:mat_peptide FJ023641_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1237). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023642_SHBs_P-C Product feature CHAIN FJ023642_SHBs_P-C of FT:mat_peptide FJ023642_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1257). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023643_SHBs_P-C Product feature CHAIN FJ023643_SHBs_P-C of FT:mat_peptide FJ023643_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1306). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023644_SHBs_P-C Product feature CHAIN FJ023644_SHBs_P-C of FT:mat_peptide FJ023644_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1318). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023645_SHBs_P-C Product feature CHAIN FJ023645_SHBs_P-C of FT:mat_peptide FJ023645_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0071). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFHGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ023646_SHBs_P-C Product feature CHAIN FJ023646_SHBs_P-C of FT:mat_peptide FJ023646_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0201). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023647_SHBs_P-C Product feature CHAIN FJ023647_SHBs_P-C of FT:mat_peptide FJ023647_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0214). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023648_SHBs_P-C Product feature CHAIN FJ023648_SHBs_P-C of FT:mat_peptide FJ023648_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0273). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023649_SHBs_P-C Product feature CHAIN FJ023649_SHBs_P-C of FT:mat_peptide FJ023649_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0289). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023650_SHBs_P-C Product feature CHAIN FJ023650_SHBs_P-C of FT:mat_peptide FJ023650_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0341). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023652_SHBs_P-C Product feature CHAIN FJ023652_SHBs_P-C of FT:mat_peptide FJ023652_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0648). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023653_SHBs_P-C Product feature CHAIN FJ023653_SHBs_P-C of FT:mat_peptide FJ023653_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0909). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023654_SHBs_P-C Product feature CHAIN FJ023654_SHBs_P-C of FT:mat_peptide FJ023654_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_C04-1412). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023655_SHBs_P-C Product feature CHAIN FJ023655_SHBs_P-C of FT:mat_peptide FJ023655_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0754). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCQRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVFI
>gnl|hbvpro|FJ023656_SHBs_P-C Product feature CHAIN FJ023656_SHBs_P-C of FT:mat_peptide FJ023656_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0938). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023657_SHBs_P-C Product feature CHAIN FJ023657_SHBs_P-C of FT:mat_peptide FJ023657_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-0987). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023658_SHBs_P-C Product feature CHAIN FJ023658_SHBs_P-C of FT:mat_peptide FJ023658_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C2_M04-1116). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023695_SHBs_P-C Product feature CHAIN FJ023695_SHBs_P-C of FT:mat_peptide FJ023695_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C04-0204). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023696_SHBs_P-C Product feature CHAIN FJ023696_SHBs_P-C of FT:mat_peptide FJ023696_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C04-0273). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023698_SHBs_P-C Product feature CHAIN FJ023698_SHBs_P-C of FT:mat_peptide FJ023698_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C04-0414). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023699_SHBs_P-C Product feature CHAIN FJ023699_SHBs_P-C of FT:mat_peptide FJ023699_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C04-0530). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023708_SHBs_P-C Product feature CHAIN FJ023708_SHBs_P-C of FT:mat_peptide FJ023708_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C04-1281). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023709_SHBs_P-C Product feature CHAIN FJ023709_SHBs_P-C of FT:mat_peptide FJ023709_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate C04-1608). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSQTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023710_SHBs_P-C Product feature CHAIN FJ023710_SHBs_P-C of FT:mat_peptide FJ023710_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0014). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023711_SHBs_P-C Product feature CHAIN FJ023711_SHBs_P-C of FT:mat_peptide FJ023711_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0093). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023712_SHBs_P-C Product feature CHAIN FJ023712_SHBs_P-C of FT:mat_peptide FJ023712_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0096). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023713_SHBs_P-C Product feature CHAIN FJ023713_SHBs_P-C of FT:mat_peptide FJ023713_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0103). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023714_SHBs_P-C Product feature CHAIN FJ023714_SHBs_P-C of FT:mat_peptide FJ023714_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0111). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023716_SHBs_P-C Product feature CHAIN FJ023716_SHBs_P-C of FT:mat_peptide FJ023716_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0141). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023717_SHBs_P-C Product feature CHAIN FJ023717_SHBs_P-C of FT:mat_peptide FJ023717_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0148). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023719_SHBs_P-C Product feature CHAIN FJ023719_SHBs_P-C of FT:mat_peptide FJ023719_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0233). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023721_SHBs_P-C Product feature CHAIN FJ023721_SHBs_P-C of FT:mat_peptide FJ023721_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0260). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023722_SHBs_P-C Product feature CHAIN FJ023722_SHBs_P-C of FT:mat_peptide FJ023722_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0318). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023725_SHBs_P-C Product feature CHAIN FJ023725_SHBs_P-C of FT:mat_peptide FJ023725_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0428). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023726_SHBs_P-C Product feature CHAIN FJ023726_SHBs_P-C of FT:mat_peptide FJ023726_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0448). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023727_SHBs_P-C Product feature CHAIN FJ023727_SHBs_P-C of FT:mat_peptide FJ023727_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0479). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023728_SHBs_P-C Product feature CHAIN FJ023728_SHBs_P-C of FT:mat_peptide FJ023728_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0483). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023730_SHBs_P-C Product feature CHAIN FJ023730_SHBs_P-C of FT:mat_peptide FJ023730_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0506). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023732_SHBs_P-C Product feature CHAIN FJ023732_SHBs_P-C of FT:mat_peptide FJ023732_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0518). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023733_SHBs_P-C Product feature CHAIN FJ023733_SHBs_P-C of FT:mat_peptide FJ023733_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0531). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023734_SHBs_P-C Product feature CHAIN FJ023734_SHBs_P-C of FT:mat_peptide FJ023734_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0599). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023735_SHBs_P-C Product feature CHAIN FJ023735_SHBs_P-C of FT:mat_peptide FJ023735_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0699). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023736_SHBs_P-C Product feature CHAIN FJ023736_SHBs_P-C of FT:mat_peptide FJ023736_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0731). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAX
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023737_SHBs_P-C Product feature CHAIN FJ023737_SHBs_P-C of FT:mat_peptide FJ023737_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0746). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023740_SHBs_P-C Product feature CHAIN FJ023740_SHBs_P-C of FT:mat_peptide FJ023740_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-0906). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023742_SHBs_P-C Product feature CHAIN FJ023742_SHBs_P-C of FT:mat_peptide FJ023742_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1073). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023744_SHBs_P-C Product feature CHAIN FJ023744_SHBs_P-C of FT:mat_peptide FJ023744_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1203). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGXPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023745_SHBs_P-C Product feature CHAIN FJ023745_SHBs_P-C of FT:mat_peptide FJ023745_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1329). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023747_SHBs_P-C Product feature CHAIN FJ023747_SHBs_P-C of FT:mat_peptide FJ023747_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1427). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023748_SHBs_P-C Product feature CHAIN FJ023748_SHBs_P-C of FT:mat_peptide FJ023748_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1428). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023751_SHBs_P-C Product feature CHAIN FJ023751_SHBs_P-C of FT:mat_peptide FJ023751_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1522). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023752_SHBs_P-C Product feature CHAIN FJ023752_SHBs_P-C of FT:mat_peptide FJ023752_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1524). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023753_SHBs_P-C Product feature CHAIN FJ023753_SHBs_P-C of FT:mat_peptide FJ023753_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1528). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023754_SHBs_P-C Product feature CHAIN FJ023754_SHBs_P-C of FT:mat_peptide FJ023754_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1568). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023755_SHBs_P-C Product feature CHAIN FJ023755_SHBs_P-C of FT:mat_peptide FJ023755_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1606). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023756_SHBs_P-C Product feature CHAIN FJ023756_SHBs_P-C of FT:mat_peptide FJ023756_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1615). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023757_SHBs_P-C Product feature CHAIN FJ023757_SHBs_P-C of FT:mat_peptide FJ023757_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1656). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023758_SHBs_P-C Product feature CHAIN FJ023758_SHBs_P-C of FT:mat_peptide FJ023758_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1694). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023759_SHBs_P-C Product feature CHAIN FJ023759_SHBs_P-C of FT:mat_peptide FJ023759_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1726). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023760_SHBs_P-C Product feature CHAIN FJ023760_SHBs_P-C of FT:mat_peptide FJ023760_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1783). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023761_SHBs_P-C Product feature CHAIN FJ023761_SHBs_P-C of FT:mat_peptide FJ023761_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1914). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023764_SHBs_P-C Product feature CHAIN FJ023764_SHBs_P-C of FT:mat_peptide FJ023764_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1969). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023765_SHBs_P-C Product feature CHAIN FJ023765_SHBs_P-C of FT:mat_peptide FJ023765_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1979). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTMSAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023766_SHBs_P-C Product feature CHAIN FJ023766_SHBs_P-C of FT:mat_peptide FJ023766_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-1987). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023768_SHBs_P-C Product feature CHAIN FJ023768_SHBs_P-C of FT:mat_peptide FJ023768_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-2122). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023769_SHBs_P-C Product feature CHAIN FJ023769_SHBs_P-C of FT:mat_peptide FJ023769_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate CO5-2129). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023774_SHBs_P-C Product feature CHAIN FJ023774_SHBs_P-C of FT:mat_peptide FJ023774_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0142). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023775_SHBs_P-C Product feature CHAIN FJ023775_SHBs_P-C of FT:mat_peptide FJ023775_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0197). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023777_SHBs_P-C Product feature CHAIN FJ023777_SHBs_P-C of FT:mat_peptide FJ023777_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-0982). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023778_SHBs_P-C Product feature CHAIN FJ023778_SHBs_P-C of FT:mat_peptide FJ023778_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1146). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023779_SHBs_P-C Product feature CHAIN FJ023779_SHBs_P-C of FT:mat_peptide FJ023779_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1185). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023780_SHBs_P-C Product feature CHAIN FJ023780_SHBs_P-C of FT:mat_peptide FJ023780_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1243). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023781_SHBs_P-C Product feature CHAIN FJ023781_SHBs_P-C of FT:mat_peptide FJ023781_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1327). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023782_SHBs_P-C Product feature CHAIN FJ023782_SHBs_P-C of FT:mat_peptide FJ023782_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1341). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023783_SHBs_P-C Product feature CHAIN FJ023783_SHBs_P-C of FT:mat_peptide FJ023783_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1352). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023784_SHBs_P-C Product feature CHAIN FJ023784_SHBs_P-C of FT:mat_peptide FJ023784_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1362). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023785_SHBs_P-C Product feature CHAIN FJ023785_SHBs_P-C of FT:mat_peptide FJ023785_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1425). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023786_SHBs_P-C Product feature CHAIN FJ023786_SHBs_P-C of FT:mat_peptide FJ023786_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1441). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHXPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023787_SHBs_P-C Product feature CHAIN FJ023787_SHBs_P-C of FT:mat_peptide FJ023787_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1457). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023788_SHBs_P-C Product feature CHAIN FJ023788_SHBs_P-C of FT:mat_peptide FJ023788_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1506). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023789_SHBs_P-C Product feature CHAIN FJ023789_SHBs_P-C of FT:mat_peptide FJ023789_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1525). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023790_SHBs_P-C Product feature CHAIN FJ023790_SHBs_P-C of FT:mat_peptide FJ023790_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1528). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023791_SHBs_P-C Product feature CHAIN FJ023791_SHBs_P-C of FT:mat_peptide FJ023791_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1569). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023793_SHBs_P-C Product feature CHAIN FJ023793_SHBs_P-C of FT:mat_peptide FJ023793_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1585). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023794_SHBs_P-C Product feature CHAIN FJ023794_SHBs_P-C of FT:mat_peptide FJ023794_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1714). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023795_SHBs_P-C Product feature CHAIN FJ023795_SHBs_P-C of FT:mat_peptide FJ023795_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1724). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCXRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023796_SHBs_P-C Product feature CHAIN FJ023796_SHBs_P-C of FT:mat_peptide FJ023796_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1753). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023798_SHBs_P-C Product feature CHAIN FJ023798_SHBs_P-C of FT:mat_peptide FJ023798_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1789). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023799_SHBs_P-C Product feature CHAIN FJ023799_SHBs_P-C of FT:mat_peptide FJ023799_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1875). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023800_SHBs_P-C Product feature CHAIN FJ023800_SHBs_P-C of FT:mat_peptide FJ023800_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-1882). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPTCPGQNLQSPTSNHSXTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023802_SHBs_P-C Product feature CHAIN FJ023802_SHBs_P-C of FT:mat_peptide FJ023802_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2042). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023804_SHBs_P-C Product feature CHAIN FJ023804_SHBs_P-C of FT:mat_peptide FJ023804_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2069). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVELSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023805_SHBs_P-C Product feature CHAIN FJ023805_SHBs_P-C of FT:mat_peptide FJ023805_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2083). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023806_SHBs_P-C Product feature CHAIN FJ023806_SHBs_P-C of FT:mat_peptide FJ023806_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2091). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023807_SHBs_P-C Product feature CHAIN FJ023807_SHBs_P-C of FT:mat_peptide FJ023807_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2094). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023809_SHBs_P-C Product feature CHAIN FJ023809_SHBs_P-C of FT:mat_peptide FJ023809_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2124). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWAFI
>gnl|hbvpro|FJ023812_SHBs_P-C Product feature CHAIN FJ023812_SHBs_P-C of FT:mat_peptide FJ023812_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2283). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023815_SHBs_P-C Product feature CHAIN FJ023815_SHBs_P-C of FT:mat_peptide FJ023815_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2369). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023818_SHBs_P-C Product feature CHAIN FJ023818_SHBs_P-C of FT:mat_peptide FJ023818_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2469). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023819_SHBs_P-C Product feature CHAIN FJ023819_SHBs_P-C of FT:mat_peptide FJ023819_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2527). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023820_SHBs_P-C Product feature CHAIN FJ023820_SHBs_P-C of FT:mat_peptide FJ023820_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2530). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSXTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLXPIFFCLWVYI
>gnl|hbvpro|FJ023821_SHBs_P-C Product feature CHAIN FJ023821_SHBs_P-C of FT:mat_peptide FJ023821_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2579). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023822_SHBs_P-C Product feature CHAIN FJ023822_SHBs_P-C of FT:mat_peptide FJ023822_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2616). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023823_SHBs_P-C Product feature CHAIN FJ023823_SHBs_P-C of FT:mat_peptide FJ023823_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2648). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023824_SHBs_P-C Product feature CHAIN FJ023824_SHBs_P-C of FT:mat_peptide FJ023824_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2652). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023826_SHBs_P-C Product feature CHAIN FJ023826_SHBs_P-C of FT:mat_peptide FJ023826_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2670). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023827_SHBs_P-C Product feature CHAIN FJ023827_SHBs_P-C of FT:mat_peptide FJ023827_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2700). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023828_SHBs_P-C Product feature CHAIN FJ023828_SHBs_P-C of FT:mat_peptide FJ023828_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2757). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023833_SHBs_P-C Product feature CHAIN FJ023833_SHBs_P-C of FT:mat_peptide FJ023833_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2784). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLNLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023834_SHBs_P-C Product feature CHAIN FJ023834_SHBs_P-C of FT:mat_peptide FJ023834_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2786). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDSQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLLIFFCLWVYI
>gnl|hbvpro|FJ023837_SHBs_P-C Product feature CHAIN FJ023837_SHBs_P-C of FT:mat_peptide FJ023837_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2871). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023839_SHBs_P-C Product feature CHAIN FJ023839_SHBs_P-C of FT:mat_peptide FJ023839_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2903). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023840_SHBs_P-C Product feature CHAIN FJ023840_SHBs_P-C of FT:mat_peptide FJ023840_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2957). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023841_SHBs_P-C Product feature CHAIN FJ023841_SHBs_P-C of FT:mat_peptide FJ023841_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2971). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLXLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023843_SHBs_P-C Product feature CHAIN FJ023843_SHBs_P-C of FT:mat_peptide FJ023843_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3014). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023844_SHBs_P-C Product feature CHAIN FJ023844_SHBs_P-C of FT:mat_peptide FJ023844_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3045). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023845_SHBs_P-C Product feature CHAIN FJ023845_SHBs_P-C of FT:mat_peptide FJ023845_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3053). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023847_SHBs_P-C Product feature CHAIN FJ023847_SHBs_P-C of FT:mat_peptide FJ023847_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3090). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023849_SHBs_P-C Product feature CHAIN FJ023849_SHBs_P-C of FT:mat_peptide FJ023849_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3163). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023851_SHBs_P-C Product feature CHAIN FJ023851_SHBs_P-C of FT:mat_peptide FJ023851_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3189). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023856_SHBs_P-C Product feature CHAIN FJ023856_SHBs_P-C of FT:mat_peptide FJ023856_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3239). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023859_SHBs_P-C Product feature CHAIN FJ023859_SHBs_P-C of FT:mat_peptide FJ023859_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3298). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023861_SHBs_P-C Product feature CHAIN FJ023861_SHBs_P-C of FT:mat_peptide FJ023861_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3313). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ023866_SHBs_P-C Product feature CHAIN FJ023866_SHBs_P-C of FT:mat_peptide FJ023866_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3418). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023868_SHBs_P-C Product feature CHAIN FJ023868_SHBs_P-C of FT:mat_peptide FJ023868_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3436). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023872_SHBs_P-C Product feature CHAIN FJ023872_SHBs_P-C of FT:mat_peptide FJ023872_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3526). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLXLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023874_SHBs_P-C Product feature CHAIN FJ023874_SHBs_P-C of FT:mat_peptide FJ023874_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3637). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023875_SHBs_P-C Product feature CHAIN FJ023875_SHBs_P-C of FT:mat_peptide FJ023875_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3678). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023877_SHBs_P-C Product feature CHAIN FJ023877_SHBs_P-C of FT:mat_peptide FJ023877_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3689). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023886_SHBs_P-C Product feature CHAIN FJ023886_SHBs_P-C of FT:mat_peptide FJ023886_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3696). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|FJ023887_SHBs_P-C Product feature CHAIN FJ023887_SHBs_P-C of FT:mat_peptide FJ023887_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3704). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023890_SHBs_P-C Product feature CHAIN FJ023890_SHBs_P-C of FT:mat_peptide FJ023890_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3721). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023891_SHBs_P-C Product feature CHAIN FJ023891_SHBs_P-C of FT:mat_peptide FJ023891_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3723). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPXCPGYHWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLFNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023892_SHBs_P-C Product feature CHAIN FJ023892_SHBs_P-C of FT:mat_peptide FJ023892_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3731). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023894_SHBs_P-C Product feature CHAIN FJ023894_SHBs_P-C of FT:mat_peptide FJ023894_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3744). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023897_SHBs_P-C Product feature CHAIN FJ023897_SHBs_P-C of FT:mat_peptide FJ023897_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3828). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023898_SHBs_P-C Product feature CHAIN FJ023898_SHBs_P-C of FT:mat_peptide FJ023898_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3833). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023901_SHBs_P-C Product feature CHAIN FJ023901_SHBs_P-C of FT:mat_peptide FJ023901_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-3948). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023904_SHBs_P-C Product feature CHAIN FJ023904_SHBs_P-C of FT:mat_peptide FJ023904_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4027). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023906_SHBs_P-C Product feature CHAIN FJ023906_SHBs_P-C of FT:mat_peptide FJ023906_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4082). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023907_SHBs_P-C Product feature CHAIN FJ023907_SHBs_P-C of FT:mat_peptide FJ023907_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4131). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023908_SHBs_P-C Product feature CHAIN FJ023908_SHBs_P-C of FT:mat_peptide FJ023908_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4140). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023912_SHBs_P-C Product feature CHAIN FJ023912_SHBs_P-C of FT:mat_peptide FJ023912_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4179). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023914_SHBs_P-C Product feature CHAIN FJ023914_SHBs_P-C of FT:mat_peptide FJ023914_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4254). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023917_SHBs_P-C Product feature CHAIN FJ023917_SHBs_P-C of FT:mat_peptide FJ023917_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4286). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023920_SHBs_P-C Product feature CHAIN FJ023920_SHBs_P-C of FT:mat_peptide FJ023920_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4317). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023922_SHBs_P-C Product feature CHAIN FJ023922_SHBs_P-C of FT:mat_peptide FJ023922_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4383). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023926_SHBs_P-C Product feature CHAIN FJ023926_SHBs_P-C of FT:mat_peptide FJ023926_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4494). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023927_SHBs_P-C Product feature CHAIN FJ023927_SHBs_P-C of FT:mat_peptide FJ023927_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4498). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023928_SHBs_P-C Product feature CHAIN FJ023928_SHBs_P-C of FT:mat_peptide FJ023928_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4529). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023929_SHBs_P-C Product feature CHAIN FJ023929_SHBs_P-C of FT:mat_peptide FJ023929_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4589). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023931_SHBs_P-C Product feature CHAIN FJ023931_SHBs_P-C of FT:mat_peptide FJ023931_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4607). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023932_SHBs_P-C Product feature CHAIN FJ023932_SHBs_P-C of FT:mat_peptide FJ023932_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4670). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023935_SHBs_P-C Product feature CHAIN FJ023935_SHBs_P-C of FT:mat_peptide FJ023935_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4738). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023938_SHBs_P-C Product feature CHAIN FJ023938_SHBs_P-C of FT:mat_peptide FJ023938_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4808). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023939_SHBs_P-C Product feature CHAIN FJ023939_SHBs_P-C of FT:mat_peptide FJ023939_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4810). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRLMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPYLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023942_SHBs_P-C Product feature CHAIN FJ023942_SHBs_P-C of FT:mat_peptide FJ023942_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-4949). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023943_SHBs_P-C Product feature CHAIN FJ023943_SHBs_P-C of FT:mat_peptide FJ023943_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-5032). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023944_SHBs_P-C Product feature CHAIN FJ023944_SHBs_P-C of FT:mat_peptide FJ023944_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-5051). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023945_SHBs_P-C Product feature CHAIN FJ023945_SHBs_P-C of FT:mat_peptide FJ023945_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-0061). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGXSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023947_SHBs_P-C Product feature CHAIN FJ023947_SHBs_P-C of FT:mat_peptide FJ023947_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-0158). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023949_SHBs_P-C Product feature CHAIN FJ023949_SHBs_P-C of FT:mat_peptide FJ023949_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-0161). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023955_SHBs_P-C Product feature CHAIN FJ023955_SHBs_P-C of FT:mat_peptide FJ023955_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-0341). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023956_SHBs_P-C Product feature CHAIN FJ023956_SHBs_P-C of FT:mat_peptide FJ023956_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-0373). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023961_SHBs_P-C Product feature CHAIN FJ023961_SHBs_P-C of FT:mat_peptide FJ023961_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-1189). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023966_SHBs_P-C Product feature CHAIN FJ023966_SHBs_P-C of FT:mat_peptide FJ023966_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-1686). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|FJ023967_SHBs_P-C Product feature CHAIN FJ023967_SHBs_P-C of FT:mat_peptide FJ023967_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-1764). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023969_SHBs_P-C Product feature CHAIN FJ023969_SHBs_P-C of FT:mat_peptide FJ023969_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-1843). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023977_SHBs_P-C Product feature CHAIN FJ023977_SHBs_P-C of FT:mat_peptide FJ023977_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2158). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023980_SHBs_P-C Product feature CHAIN FJ023980_SHBs_P-C of FT:mat_peptide FJ023980_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2226). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023985_SHBs_P-C Product feature CHAIN FJ023985_SHBs_P-C of FT:mat_peptide FJ023985_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2384). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023988_SHBs_P-C Product feature CHAIN FJ023988_SHBs_P-C of FT:mat_peptide FJ023988_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2484). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ023991_SHBs_P-C Product feature CHAIN FJ023991_SHBs_P-C of FT:mat_peptide FJ023991_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2498). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024001_SHBs_P-C Product feature CHAIN FJ024001_SHBs_P-C of FT:mat_peptide FJ024001_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2729). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024002_SHBs_P-C Product feature CHAIN FJ024002_SHBs_P-C of FT:mat_peptide FJ024002_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2731). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024003_SHBs_P-C Product feature CHAIN FJ024003_SHBs_P-C of FT:mat_peptide FJ024003_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2740). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024007_SHBs_P-C Product feature CHAIN FJ024007_SHBs_P-C of FT:mat_peptide FJ024007_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2838). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024009_SHBs_P-C Product feature CHAIN FJ024009_SHBs_P-C of FT:mat_peptide FJ024009_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2872). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024011_SHBs_P-C Product feature CHAIN FJ024011_SHBs_P-C of FT:mat_peptide FJ024011_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-2938). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024021_SHBs_P-C Product feature CHAIN FJ024021_SHBs_P-C of FT:mat_peptide FJ024021_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-3509). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024023_SHBs_P-C Product feature CHAIN FJ024023_SHBs_P-C of FT:mat_peptide FJ024023_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-3668). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024024_SHBs_P-C Product feature CHAIN FJ024024_SHBs_P-C of FT:mat_peptide FJ024024_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-3736). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024025_SHBs_P-C Product feature CHAIN FJ024025_SHBs_P-C of FT:mat_peptide FJ024025_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-3815). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024026_SHBs_P-C Product feature CHAIN FJ024026_SHBs_P-C of FT:mat_peptide FJ024026_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-3855). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024028_SHBs_P-C Product feature CHAIN FJ024028_SHBs_P-C of FT:mat_peptide FJ024028_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-3867). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024031_SHBs_P-C Product feature CHAIN FJ024031_SHBs_P-C of FT:mat_peptide FJ024031_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-4146). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024034_SHBs_P-C Product feature CHAIN FJ024034_SHBs_P-C of FT:mat_peptide FJ024034_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-4156). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024035_SHBs_P-C Product feature CHAIN FJ024035_SHBs_P-C of FT:mat_peptide FJ024035_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-4188). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTIPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024037_SHBs_P-C Product feature CHAIN FJ024037_SHBs_P-C of FT:mat_peptide FJ024037_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-4230). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSXTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024039_SHBs_P-C Product feature CHAIN FJ024039_SHBs_P-C of FT:mat_peptide FJ024039_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-4362). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ024043_SHBs_P-C Product feature CHAIN FJ024043_SHBs_P-C of FT:mat_peptide FJ024043_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M05-4455). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032331_SHBs_P-C Product feature CHAIN FJ032331_SHBs_P-C of FT:mat_peptide FJ032331_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S193-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032332_SHBs_P-C Product feature CHAIN FJ032332_SHBs_P-C of FT:mat_peptide FJ032332_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S265-10). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032333_SHBs_P-C Product feature CHAIN FJ032333_SHBs_P-C of FT:mat_peptide FJ032333_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032334_SHBs_P-C Product feature CHAIN FJ032334_SHBs_P-C of FT:mat_peptide FJ032334_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S445-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032336_SHBs_P-C Product feature CHAIN FJ032336_SHBs_P-C of FT:mat_peptide FJ032336_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-4). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTSTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWPSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032338_SHBs_P-C Product feature CHAIN FJ032338_SHBs_P-C of FT:mat_peptide FJ032338_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032339_SHBs_P-C Product feature CHAIN FJ032339_SHBs_P-C of FT:mat_peptide FJ032339_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S462-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032340_SHBs_P-C Product feature CHAIN FJ032340_SHBs_P-C of FT:mat_peptide FJ032340_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVHI
>gnl|hbvpro|FJ032341_SHBs_P-C Product feature CHAIN FJ032341_SHBs_P-C of FT:mat_peptide FJ032341_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S529-6). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032345_SHBs_P-C Product feature CHAIN FJ032345_SHBs_P-C of FT:mat_peptide FJ032345_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S696-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFFLWVYI
>gnl|hbvpro|FJ032346_SHBs_P-C Product feature CHAIN FJ032346_SHBs_P-C of FT:mat_peptide FJ032346_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-3). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVHLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCIKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032347_SHBs_P-C Product feature CHAIN FJ032347_SHBs_P-C of FT:mat_peptide FJ032347_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S732-7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032350_SHBs_P-C Product feature CHAIN FJ032350_SHBs_P-C of FT:mat_peptide FJ032350_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPYKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVMWMMWYWGPSLYNILSPFLPLLPIFWCLWVYI
>gnl|hbvpro|FJ032351_SHBs_P-C Product feature CHAIN FJ032351_SHBs_P-C of FT:mat_peptide FJ032351_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S943-5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWASAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFWCLWAYI
>gnl|hbvpro|FJ032355_SHBs_P-C Product feature CHAIN FJ032355_SHBs_P-C of FT:mat_peptide FJ032355_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032356_SHBs_P-C Product feature CHAIN FJ032356_SHBs_P-C of FT:mat_peptide FJ032356_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1030-9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032359_SHBs_P-C Product feature CHAIN FJ032359_SHBs_P-C of FT:mat_peptide FJ032359_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ032361_SHBs_P-C Product feature CHAIN FJ032361_SHBs_P-C of FT:mat_peptide FJ032361_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1634-7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAS
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349225_SHBs_P-C Product feature CHAIN FJ349225_SHBs_P-C of FT:mat_peptide FJ349225_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H94). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ358595_SHBs_P-C Product feature CHAIN FJ358595_SHBs_P-C of FT:mat_peptide FJ358595_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2769). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPLVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ358596_SHBs_P-C Product feature CHAIN FJ358596_SHBs_P-C of FT:mat_peptide FJ358596_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2769). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQDSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWFWGPRLYNILSPFMPLLPIFFCLWVYI
>gnl|hbvpro|FJ358597_SHBs_P-C Product feature CHAIN FJ358597_SHBs_P-C of FT:mat_peptide FJ358597_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2769). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCXRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ358598_SHBs_P-C Product feature CHAIN FJ358598_SHBs_P-C of FT:mat_peptide FJ358598_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate M04-2769). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386574_SHBs_P-C Product feature CHAIN FJ386574_SHBs_P-C of FT:mat_peptide FJ386574_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1743). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386575_SHBs_P-C Product feature CHAIN FJ386575_SHBs_P-C of FT:mat_peptide FJ386575_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1745). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386576_SHBs_P-C Product feature CHAIN FJ386576_SHBs_P-C of FT:mat_peptide FJ386576_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1746). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386577_SHBs_P-C Product feature CHAIN FJ386577_SHBs_P-C of FT:mat_peptide FJ386577_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1747). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386579_SHBs_P-C Product feature CHAIN FJ386579_SHBs_P-C of FT:mat_peptide FJ386579_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1762). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386587_SHBs_P-C Product feature CHAIN FJ386587_SHBs_P-C of FT:mat_peptide FJ386587_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1812). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386588_SHBs_P-C Product feature CHAIN FJ386588_SHBs_P-C of FT:mat_peptide FJ386588_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1828). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386589_SHBs_P-C Product feature CHAIN FJ386589_SHBs_P-C of FT:mat_peptide FJ386589_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1830). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPTCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386591_SHBs_P-C Product feature CHAIN FJ386591_SHBs_P-C of FT:mat_peptide FJ386591_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1869). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKACTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386592_SHBs_P-C Product feature CHAIN FJ386592_SHBs_P-C of FT:mat_peptide FJ386592_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1870). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLXPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386594_SHBs_P-C Product feature CHAIN FJ386594_SHBs_P-C of FT:mat_peptide FJ386594_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1878). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386595_SHBs_P-C Product feature CHAIN FJ386595_SHBs_P-C of FT:mat_peptide FJ386595_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1879). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386596_SHBs_P-C Product feature CHAIN FJ386596_SHBs_P-C of FT:mat_peptide FJ386596_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1887). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386597_SHBs_P-C Product feature CHAIN FJ386597_SHBs_P-C of FT:mat_peptide FJ386597_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1888). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386598_SHBs_P-C Product feature CHAIN FJ386598_SHBs_P-C of FT:mat_peptide FJ386598_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1889). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPQICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386601_SHBs_P-C Product feature CHAIN FJ386601_SHBs_P-C of FT:mat_peptide FJ386601_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1912). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386602_SHBs_P-C Product feature CHAIN FJ386602_SHBs_P-C of FT:mat_peptide FJ386602_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1914). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLALQAGLFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386603_SHBs_P-C Product feature CHAIN FJ386603_SHBs_P-C of FT:mat_peptide FJ386603_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1949). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386604_SHBs_P-C Product feature CHAIN FJ386604_SHBs_P-C of FT:mat_peptide FJ386604_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1950). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSLAFAR
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386605_SHBs_P-C Product feature CHAIN FJ386605_SHBs_P-C of FT:mat_peptide FJ386605_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1965). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386607_SHBs_P-C Product feature CHAIN FJ386607_SHBs_P-C of FT:mat_peptide FJ386607_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1967). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386609_SHBs_P-C Product feature CHAIN FJ386609_SHBs_P-C of FT:mat_peptide FJ386609_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1999). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386611_SHBs_P-C Product feature CHAIN FJ386611_SHBs_P-C of FT:mat_peptide FJ386611_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2018). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGALTCPGRNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386612_SHBs_P-C Product feature CHAIN FJ386612_SHBs_P-C of FT:mat_peptide FJ386612_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2019). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|FJ386613_SHBs_P-C Product feature CHAIN FJ386613_SHBs_P-C of FT:mat_peptide FJ386613_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2039). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386614_SHBs_P-C Product feature CHAIN FJ386614_SHBs_P-C of FT:mat_peptide FJ386614_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2040). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386616_SHBs_P-C Product feature CHAIN FJ386616_SHBs_P-C of FT:mat_peptide FJ386616_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2064). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386618_SHBs_P-C Product feature CHAIN FJ386618_SHBs_P-C of FT:mat_peptide FJ386618_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2111). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386619_SHBs_P-C Product feature CHAIN FJ386619_SHBs_P-C of FT:mat_peptide FJ386619_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2119). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386620_SHBs_P-C Product feature CHAIN FJ386620_SHBs_P-C of FT:mat_peptide FJ386620_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2121). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386621_SHBs_P-C Product feature CHAIN FJ386621_SHBs_P-C of FT:mat_peptide FJ386621_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2123). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386623_SHBs_P-C Product feature CHAIN FJ386623_SHBs_P-C of FT:mat_peptide FJ386623_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2165). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386624_SHBs_P-C Product feature CHAIN FJ386624_SHBs_P-C of FT:mat_peptide FJ386624_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2187). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386625_SHBs_P-C Product feature CHAIN FJ386625_SHBs_P-C of FT:mat_peptide FJ386625_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2190). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386626_SHBs_P-C Product feature CHAIN FJ386626_SHBs_P-C of FT:mat_peptide FJ386626_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2205). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILQLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386627_SHBs_P-C Product feature CHAIN FJ386627_SHBs_P-C of FT:mat_peptide FJ386627_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2242). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386628_SHBs_P-C Product feature CHAIN FJ386628_SHBs_P-C of FT:mat_peptide FJ386628_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2255). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386629_SHBs_P-C Product feature CHAIN FJ386629_SHBs_P-C of FT:mat_peptide FJ386629_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2286). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386630_SHBs_P-C Product feature CHAIN FJ386630_SHBs_P-C of FT:mat_peptide FJ386630_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2336). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGASMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386631_SHBs_P-C Product feature CHAIN FJ386631_SHBs_P-C of FT:mat_peptide FJ386631_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2359). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386632_SHBs_P-C Product feature CHAIN FJ386632_SHBs_P-C of FT:mat_peptide FJ386632_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2370). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386637_SHBs_P-C Product feature CHAIN FJ386637_SHBs_P-C of FT:mat_peptide FJ386637_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2151). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386639_SHBs_P-C Product feature CHAIN FJ386639_SHBs_P-C of FT:mat_peptide FJ386639_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 1929). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386640_SHBs_P-C Product feature CHAIN FJ386640_SHBs_P-C of FT:mat_peptide FJ386640_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2168). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386641_SHBs_P-C Product feature CHAIN FJ386641_SHBs_P-C of FT:mat_peptide FJ386641_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2236). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMISYWGPSLYNILSRFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386644_SHBs_P-C Product feature CHAIN FJ386644_SHBs_P-C of FT:mat_peptide FJ386644_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S737). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386645_SHBs_P-C Product feature CHAIN FJ386645_SHBs_P-C of FT:mat_peptide FJ386645_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S897). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386647_SHBs_P-C Product feature CHAIN FJ386647_SHBs_P-C of FT:mat_peptide FJ386647_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2400). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FQWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386651_SHBs_P-C Product feature CHAIN FJ386651_SHBs_P-C of FT:mat_peptide FJ386651_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2476). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386652_SHBs_P-C Product feature CHAIN FJ386652_SHBs_P-C of FT:mat_peptide FJ386652_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate 2518). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386653_SHBs_P-C Product feature CHAIN FJ386653_SHBs_P-C of FT:mat_peptide FJ386653_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FJ386657_SHBs_P-C Product feature CHAIN FJ386657_SHBs_P-C of FT:mat_peptide FJ386657_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S165). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386659_SHBs_P-C Product feature CHAIN FJ386659_SHBs_P-C of FT:mat_peptide FJ386659_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S219). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386661_SHBs_P-C Product feature CHAIN FJ386661_SHBs_P-C of FT:mat_peptide FJ386661_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S251). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|FJ386662_SHBs_P-C Product feature CHAIN FJ386662_SHBs_P-C of FT:mat_peptide FJ386662_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S269). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ386663_SHBs_P-C Product feature CHAIN FJ386663_SHBs_P-C of FT:mat_peptide FJ386663_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S307). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386664_SHBs_P-C Product feature CHAIN FJ386664_SHBs_P-C of FT:mat_peptide FJ386664_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S310). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386665_SHBs_P-C Product feature CHAIN FJ386665_SHBs_P-C of FT:mat_peptide FJ386665_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S359). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386667_SHBs_P-C Product feature CHAIN FJ386667_SHBs_P-C of FT:mat_peptide FJ386667_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S379). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386670_SHBs_P-C Product feature CHAIN FJ386670_SHBs_P-C of FT:mat_peptide FJ386670_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S454). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386671_SHBs_P-C Product feature CHAIN FJ386671_SHBs_P-C of FT:mat_peptide FJ386671_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S586). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPISNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386672_SHBs_P-C Product feature CHAIN FJ386672_SHBs_P-C of FT:mat_peptide FJ386672_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S606). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ386673_SHBs_P-C Product feature CHAIN FJ386673_SHBs_P-C of FT:mat_peptide FJ386673_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S633). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILQLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386677_SHBs_P-C Product feature CHAIN FJ386677_SHBs_P-C of FT:mat_peptide FJ386677_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1104). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|FJ386678_SHBs_P-C Product feature CHAIN FJ386678_SHBs_P-C of FT:mat_peptide FJ386678_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1147). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386679_SHBs_P-C Product feature CHAIN FJ386679_SHBs_P-C of FT:mat_peptide FJ386679_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1217). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386685_SHBs_P-C Product feature CHAIN FJ386685_SHBs_P-C of FT:mat_peptide FJ386685_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1568). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386687_SHBs_P-C Product feature CHAIN FJ386687_SHBs_P-C of FT:mat_peptide FJ386687_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1600). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386689_SHBs_P-C Product feature CHAIN FJ386689_SHBs_P-C of FT:mat_peptide FJ386689_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1649). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPKMYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ518813_SHBs_P-C Product feature CHAIN FJ518813_SHBs_P-C of FT:mat_peptide FJ518813_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FJ560988_SHBs_P-C Product feature CHAIN FJ560988_SHBs_P-C of FT:mat_peptide FJ560988_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J-27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ560989_SHBs_P-C Product feature CHAIN FJ560989_SHBs_P-C of FT:mat_peptide FJ560989_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J28). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ560990_SHBs_P-C Product feature CHAIN FJ560990_SHBs_P-C of FT:mat_peptide FJ560990_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J50). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ560991_SHBs_P-C Product feature CHAIN FJ560991_SHBs_P-C of FT:mat_peptide FJ560991_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPMLVLQAGFFLLTXILTIPXSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ560993_SHBs_P-C Product feature CHAIN FJ560993_SHBs_P-C of FT:mat_peptide FJ560993_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ560994_SHBs_P-C Product feature CHAIN FJ560994_SHBs_P-C of FT:mat_peptide FJ560994_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate H24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ560997_SHBs_P-C Product feature CHAIN FJ560997_SHBs_P-C of FT:mat_peptide FJ560997_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J1-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FJ560998_SHBs_P-C Product feature CHAIN FJ560998_SHBs_P-C of FT:mat_peptide FJ560998_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ560999_SHBs_P-C Product feature CHAIN FJ560999_SHBs_P-C of FT:mat_peptide FJ560999_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate J4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLXFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561000_SHBs_P-C Product feature CHAIN FJ561000_SHBs_P-C of FT:mat_peptide FJ561000_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q25). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561003_SHBs_P-C Product feature CHAIN FJ561003_SHBs_P-C of FT:mat_peptide FJ561003_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561005_SHBs_P-C Product feature CHAIN FJ561005_SHBs_P-C of FT:mat_peptide FJ561005_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS18). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLRPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWIYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561006_SHBs_P-C Product feature CHAIN FJ561006_SHBs_P-C of FT:mat_peptide FJ561006_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS208). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561008_SHBs_P-C Product feature CHAIN FJ561008_SHBs_P-C of FT:mat_peptide FJ561008_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS267). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561010_SHBs_P-C Product feature CHAIN FJ561010_SHBs_P-C of FT:mat_peptide FJ561010_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS99). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRVLTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561011_SHBs_P-C Product feature CHAIN FJ561011_SHBs_P-C of FT:mat_peptide FJ561011_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGQSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561012_SHBs_P-C Product feature CHAIN FJ561012_SHBs_P-C of FT:mat_peptide FJ561012_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S114). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFFPLLPIFFCLWVYI
>gnl|hbvpro|FJ561014_SHBs_P-C Product feature CHAIN FJ561014_SHBs_P-C of FT:mat_peptide FJ561014_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S120). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTNPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561016_SHBs_P-C Product feature CHAIN FJ561016_SHBs_P-C of FT:mat_peptide FJ561016_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561017_SHBs_P-C Product feature CHAIN FJ561017_SHBs_P-C of FT:mat_peptide FJ561017_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S130). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561020_SHBs_P-C Product feature CHAIN FJ561020_SHBs_P-C of FT:mat_peptide FJ561020_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561022_SHBs_P-C Product feature CHAIN FJ561022_SHBs_P-C of FT:mat_peptide FJ561022_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S42). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MDNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561025_SHBs_P-C Product feature CHAIN FJ561025_SHBs_P-C of FT:mat_peptide FJ561025_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S51). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561026_SHBs_P-C Product feature CHAIN FJ561026_SHBs_P-C of FT:mat_peptide FJ561026_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S53). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561028_SHBs_P-C Product feature CHAIN FJ561028_SHBs_P-C of FT:mat_peptide FJ561028_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S62). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCLGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561029_SHBs_P-C Product feature CHAIN FJ561029_SHBs_P-C of FT:mat_peptide FJ561029_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S67). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561030_SHBs_P-C Product feature CHAIN FJ561030_SHBs_P-C of FT:mat_peptide FJ561030_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S69). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ561031_SHBs_P-C Product feature CHAIN FJ561031_SHBs_P-C of FT:mat_peptide FJ561031_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561032_SHBs_P-C Product feature CHAIN FJ561032_SHBs_P-C of FT:mat_peptide FJ561032_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S71). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MERTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561033_SHBs_P-C Product feature CHAIN FJ561033_SHBs_P-C of FT:mat_peptide FJ561033_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S75). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561035_SHBs_P-C Product feature CHAIN FJ561035_SHBs_P-C of FT:mat_peptide FJ561035_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S84). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561037_SHBs_P-C Product feature CHAIN FJ561037_SHBs_P-C of FT:mat_peptide FJ561037_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S90). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561039_SHBs_P-C Product feature CHAIN FJ561039_SHBs_P-C of FT:mat_peptide FJ561039_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S94). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561040_SHBs_P-C Product feature CHAIN FJ561040_SHBs_P-C of FT:mat_peptide FJ561040_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate Q19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFPGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561041_SHBs_P-C Product feature CHAIN FJ561041_SHBs_P-C of FT:mat_peptide FJ561041_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS136). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ561042_SHBs_P-C Product feature CHAIN FJ561042_SHBs_P-C of FT:mat_peptide FJ561042_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS156). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561043_SHBs_P-C Product feature CHAIN FJ561043_SHBs_P-C of FT:mat_peptide FJ561043_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS195). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCXIPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561045_SHBs_P-C Product feature CHAIN FJ561045_SHBs_P-C of FT:mat_peptide FJ561045_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS227). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLWVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561046_SHBs_P-C Product feature CHAIN FJ561046_SHBs_P-C of FT:mat_peptide FJ561046_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS249). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561047_SHBs_P-C Product feature CHAIN FJ561047_SHBs_P-C of FT:mat_peptide FJ561047_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS242). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFPGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561048_SHBs_P-C Product feature CHAIN FJ561048_SHBs_P-C of FT:mat_peptide FJ561048_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS202). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPMLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ561049_SHBs_P-C Product feature CHAIN FJ561049_SHBs_P-C of FT:mat_peptide FJ561049_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate QS133). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTQPAQGNSTIPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562218_SHBs_P-C Product feature CHAIN FJ562218_SHBs_P-C of FT:mat_peptide FJ562218_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562220_SHBs_P-C Product feature CHAIN FJ562220_SHBs_P-C of FT:mat_peptide FJ562220_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I12). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562221_SHBs_P-C Product feature CHAIN FJ562221_SHBs_P-C of FT:mat_peptide FJ562221_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562225_SHBs_P-C Product feature CHAIN FJ562225_SHBs_P-C of FT:mat_peptide FJ562225_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I19). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562228_SHBs_P-C Product feature CHAIN FJ562228_SHBs_P-C of FT:mat_peptide FJ562228_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I33). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLSNILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|FJ562230_SHBs_P-C Product feature CHAIN FJ562230_SHBs_P-C of FT:mat_peptide FJ562230_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I38). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562232_SHBs_P-C Product feature CHAIN FJ562232_SHBs_P-C of FT:mat_peptide FJ562232_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I45). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562233_SHBs_P-C Product feature CHAIN FJ562233_SHBs_P-C of FT:mat_peptide FJ562233_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I48). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562235_SHBs_P-C Product feature CHAIN FJ562235_SHBs_P-C of FT:mat_peptide FJ562235_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I50). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562238_SHBs_P-C Product feature CHAIN FJ562238_SHBs_P-C of FT:mat_peptide FJ562238_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I62). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562239_SHBs_P-C Product feature CHAIN FJ562239_SHBs_P-C of FT:mat_peptide FJ562239_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I64). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYKGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562241_SHBs_P-C Product feature CHAIN FJ562241_SHBs_P-C of FT:mat_peptide FJ562241_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I67). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562242_SHBs_P-C Product feature CHAIN FJ562242_SHBs_P-C of FT:mat_peptide FJ562242_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I68). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562243_SHBs_P-C Product feature CHAIN FJ562243_SHBs_P-C of FT:mat_peptide FJ562243_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I71). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQGGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ562244_SHBs_P-C Product feature CHAIN FJ562244_SHBs_P-C of FT:mat_peptide FJ562244_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I72). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562248_SHBs_P-C Product feature CHAIN FJ562248_SHBs_P-C of FT:mat_peptide FJ562248_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I76). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562249_SHBs_P-C Product feature CHAIN FJ562249_SHBs_P-C of FT:mat_peptide FJ562249_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I79). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562250_SHBs_P-C Product feature CHAIN FJ562250_SHBs_P-C of FT:mat_peptide FJ562250_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I83). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLYNILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562251_SHBs_P-C Product feature CHAIN FJ562251_SHBs_P-C of FT:mat_peptide FJ562251_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I84). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562252_SHBs_P-C Product feature CHAIN FJ562252_SHBs_P-C of FT:mat_peptide FJ562252_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I85). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562255_SHBs_P-C Product feature CHAIN FJ562255_SHBs_P-C of FT:mat_peptide FJ562255_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I92). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|FJ562256_SHBs_P-C Product feature CHAIN FJ562256_SHBs_P-C of FT:mat_peptide FJ562256_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I95). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRSPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVSI
>gnl|hbvpro|FJ562258_SHBs_P-C Product feature CHAIN FJ562258_SHBs_P-C of FT:mat_peptide FJ562258_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I97). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562261_SHBs_P-C Product feature CHAIN FJ562261_SHBs_P-C of FT:mat_peptide FJ562261_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I109). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNDSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|FJ562264_SHBs_P-C Product feature CHAIN FJ562264_SHBs_P-C of FT:mat_peptide FJ562264_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I114). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562265_SHBs_P-C Product feature CHAIN FJ562265_SHBs_P-C of FT:mat_peptide FJ562265_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I116). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562266_SHBs_P-C Product feature CHAIN FJ562266_SHBs_P-C of FT:mat_peptide FJ562266_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I118). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562268_SHBs_P-C Product feature CHAIN FJ562268_SHBs_P-C of FT:mat_peptide FJ562268_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I121). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562269_SHBs_P-C Product feature CHAIN FJ562269_SHBs_P-C of FT:mat_peptide FJ562269_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I122). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCVRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562270_SHBs_P-C Product feature CHAIN FJ562270_SHBs_P-C of FT:mat_peptide FJ562270_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I123). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSMGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562272_SHBs_P-C Product feature CHAIN FJ562272_SHBs_P-C of FT:mat_peptide FJ562272_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I125). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562273_SHBs_P-C Product feature CHAIN FJ562273_SHBs_P-C of FT:mat_peptide FJ562273_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I127). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562274_SHBs_P-C Product feature CHAIN FJ562274_SHBs_P-C of FT:mat_peptide FJ562274_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I128). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562275_SHBs_P-C Product feature CHAIN FJ562275_SHBs_P-C of FT:mat_peptide FJ562275_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I129). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562276_SHBs_P-C Product feature CHAIN FJ562276_SHBs_P-C of FT:mat_peptide FJ562276_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I130). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWLVGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562279_SHBs_P-C Product feature CHAIN FJ562279_SHBs_P-C of FT:mat_peptide FJ562279_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I140). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562280_SHBs_P-C Product feature CHAIN FJ562280_SHBs_P-C of FT:mat_peptide FJ562280_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I141). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562281_SHBs_P-C Product feature CHAIN FJ562281_SHBs_P-C of FT:mat_peptide FJ562281_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I143). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562282_SHBs_P-C Product feature CHAIN FJ562282_SHBs_P-C of FT:mat_peptide FJ562282_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I144). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562283_SHBs_P-C Product feature CHAIN FJ562283_SHBs_P-C of FT:mat_peptide FJ562283_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I145). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562284_SHBs_P-C Product feature CHAIN FJ562284_SHBs_P-C of FT:mat_peptide FJ562284_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I146). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562285_SHBs_P-C Product feature CHAIN FJ562285_SHBs_P-C of FT:mat_peptide FJ562285_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I147). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562286_SHBs_P-C Product feature CHAIN FJ562286_SHBs_P-C of FT:mat_peptide FJ562286_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I149). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562288_SHBs_P-C Product feature CHAIN FJ562288_SHBs_P-C of FT:mat_peptide FJ562288_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I153). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562290_SHBs_P-C Product feature CHAIN FJ562290_SHBs_P-C of FT:mat_peptide FJ562290_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I162). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562291_SHBs_P-C Product feature CHAIN FJ562291_SHBs_P-C of FT:mat_peptide FJ562291_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I163). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562292_SHBs_P-C Product feature CHAIN FJ562292_SHBs_P-C of FT:mat_peptide FJ562292_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I164). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWIYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTTTGPCKTCTIPVQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562293_SHBs_P-C Product feature CHAIN FJ562293_SHBs_P-C of FT:mat_peptide FJ562293_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I167). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562295_SHBs_P-C Product feature CHAIN FJ562295_SHBs_P-C of FT:mat_peptide FJ562295_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I169). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562298_SHBs_P-C Product feature CHAIN FJ562298_SHBs_P-C of FT:mat_peptide FJ562298_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I174). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562299_SHBs_P-C Product feature CHAIN FJ562299_SHBs_P-C of FT:mat_peptide FJ562299_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I175). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562300_SHBs_P-C Product feature CHAIN FJ562300_SHBs_P-C of FT:mat_peptide FJ562300_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I182). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562301_SHBs_P-C Product feature CHAIN FJ562301_SHBs_P-C of FT:mat_peptide FJ562301_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I185). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562304_SHBs_P-C Product feature CHAIN FJ562304_SHBs_P-C of FT:mat_peptide FJ562304_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I190). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562306_SHBs_P-C Product feature CHAIN FJ562306_SHBs_P-C of FT:mat_peptide FJ562306_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I196). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562307_SHBs_P-C Product feature CHAIN FJ562307_SHBs_P-C of FT:mat_peptide FJ562307_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I197). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562308_SHBs_P-C Product feature CHAIN FJ562308_SHBs_P-C of FT:mat_peptide FJ562308_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I199). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562310_SHBs_P-C Product feature CHAIN FJ562310_SHBs_P-C of FT:mat_peptide FJ562310_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I201). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCSGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWGSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562313_SHBs_P-C Product feature CHAIN FJ562313_SHBs_P-C of FT:mat_peptide FJ562313_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I204). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILQLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562315_SHBs_P-C Product feature CHAIN FJ562315_SHBs_P-C of FT:mat_peptide FJ562315_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I207). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562318_SHBs_P-C Product feature CHAIN FJ562318_SHBs_P-C of FT:mat_peptide FJ562318_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I211). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562319_SHBs_P-C Product feature CHAIN FJ562319_SHBs_P-C of FT:mat_peptide FJ562319_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I212). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562320_SHBs_P-C Product feature CHAIN FJ562320_SHBs_P-C of FT:mat_peptide FJ562320_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I213). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPYVQWFVGLSPTVWLSVILMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562323_SHBs_P-C Product feature CHAIN FJ562323_SHBs_P-C of FT:mat_peptide FJ562323_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I217). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562324_SHBs_P-C Product feature CHAIN FJ562324_SHBs_P-C of FT:mat_peptide FJ562324_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I219). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562325_SHBs_P-C Product feature CHAIN FJ562325_SHBs_P-C of FT:mat_peptide FJ562325_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I223). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562326_SHBs_P-C Product feature CHAIN FJ562326_SHBs_P-C of FT:mat_peptide FJ562326_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I227). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562327_SHBs_P-C Product feature CHAIN FJ562327_SHBs_P-C of FT:mat_peptide FJ562327_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I228). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562329_SHBs_P-C Product feature CHAIN FJ562329_SHBs_P-C of FT:mat_peptide FJ562329_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I230). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562330_SHBs_P-C Product feature CHAIN FJ562330_SHBs_P-C of FT:mat_peptide FJ562330_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I231). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562331_SHBs_P-C Product feature CHAIN FJ562331_SHBs_P-C of FT:mat_peptide FJ562331_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I9). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562332_SHBs_P-C Product feature CHAIN FJ562332_SHBs_P-C of FT:mat_peptide FJ562332_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I42). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562333_SHBs_P-C Product feature CHAIN FJ562333_SHBs_P-C of FT:mat_peptide FJ562333_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I78). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562334_SHBs_P-C Product feature CHAIN FJ562334_SHBs_P-C of FT:mat_peptide FJ562334_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I82). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMSLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTNTAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562335_SHBs_P-C Product feature CHAIN FJ562335_SHBs_P-C of FT:mat_peptide FJ562335_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I108). Complete genome. [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQSSQSPTSKHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562337_SHBs_P-C Product feature CHAIN FJ562337_SHBs_P-C of FT:mat_peptide FJ562337_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I173). Complete genome. [Hepadnaviridae] (length=226 residues).
MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562339_SHBs_P-C Product feature CHAIN FJ562339_SHBs_P-C of FT:mat_peptide FJ562339_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I205). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FQWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ562340_SHBs_P-C Product feature CHAIN FJ562340_SHBs_P-C of FT:mat_peptide FJ562340_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate I220). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPGQNSQSPTSNRTPTSCPPICPGYRWMCLRRF
IIFLFILLLCLISLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQNTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ621589_SHBs_P-C Product feature CHAIN FJ621589_SHBs_P-C of FT:mat_peptide FJ621589_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4543). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621590_SHBs_P-C Product feature CHAIN FJ621590_SHBs_P-C of FT:mat_peptide FJ621590_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4294). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTITAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621591_SHBs_P-C Product feature CHAIN FJ621591_SHBs_P-C of FT:mat_peptide FJ621591_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4492). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPTFFCLWVYI
>gnl|hbvpro|FJ621593_SHBs_P-C Product feature CHAIN FJ621593_SHBs_P-C of FT:mat_peptide FJ621593_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3950). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSFLVPFVQWFVGLSPTVWFSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621594_SHBs_P-C Product feature CHAIN FJ621594_SHBs_P-C of FT:mat_peptide FJ621594_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2819). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNTLSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ621595_SHBs_P-C Product feature CHAIN FJ621595_SHBs_P-C of FT:mat_peptide FJ621595_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2032). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621596_SHBs_P-C Product feature CHAIN FJ621596_SHBs_P-C of FT:mat_peptide FJ621596_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2997). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621597_SHBs_P-C Product feature CHAIN FJ621597_SHBs_P-C of FT:mat_peptide FJ621597_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4135). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAXGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621598_SHBs_P-C Product feature CHAIN FJ621598_SHBs_P-C of FT:mat_peptide FJ621598_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4725). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSSHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621599_SHBs_P-C Product feature CHAIN FJ621599_SHBs_P-C of FT:mat_peptide FJ621599_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3983). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLALVDYQGMLPVCPLLPGSSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621600_SHBs_P-C Product feature CHAIN FJ621600_SHBs_P-C of FT:mat_peptide FJ621600_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2866). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621601_SHBs_P-C Product feature CHAIN FJ621601_SHBs_P-C of FT:mat_peptide FJ621601_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4072). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621609_SHBs_P-C Product feature CHAIN FJ621609_SHBs_P-C of FT:mat_peptide FJ621609_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3877). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621610_SHBs_P-C Product feature CHAIN FJ621610_SHBs_P-C of FT:mat_peptide FJ621610_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4474). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLFPIFFCLWVYI
>gnl|hbvpro|FJ621611_SHBs_P-C Product feature CHAIN FJ621611_SHBs_P-C of FT:mat_peptide FJ621611_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3955). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621798_SHBs_P-C Product feature CHAIN FJ621798_SHBs_P-C of FT:mat_peptide FJ621798_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1960). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621810_SHBs_P-C Product feature CHAIN FJ621810_SHBs_P-C of FT:mat_peptide FJ621810_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4409). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621811_SHBs_P-C Product feature CHAIN FJ621811_SHBs_P-C of FT:mat_peptide FJ621811_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1904). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|FJ621812_SHBs_P-C Product feature CHAIN FJ621812_SHBs_P-C of FT:mat_peptide FJ621812_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S1899). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGYLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHNILSPFLPLLPLFFCLWVYI
>gnl|hbvpro|FJ621813_SHBs_P-C Product feature CHAIN FJ621813_SHBs_P-C of FT:mat_peptide FJ621813_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3128). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPGQNSQSPTSNHSPTSCPXICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMILYWGPSLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621814_SHBs_P-C Product feature CHAIN FJ621814_SHBs_P-C of FT:mat_peptide FJ621814_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4519). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621815_SHBs_P-C Product feature CHAIN FJ621815_SHBs_P-C of FT:mat_peptide FJ621815_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3875). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGNSXFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621816_SHBs_P-C Product feature CHAIN FJ621816_SHBs_P-C of FT:mat_peptide FJ621816_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4635). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621817_SHBs_P-C Product feature CHAIN FJ621817_SHBs_P-C of FT:mat_peptide FJ621817_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4065). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHLPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621818_SHBs_P-C Product feature CHAIN FJ621818_SHBs_P-C of FT:mat_peptide FJ621818_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4067). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|FJ621819_SHBs_P-C Product feature CHAIN FJ621819_SHBs_P-C of FT:mat_peptide FJ621819_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2953). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621820_SHBs_P-C Product feature CHAIN FJ621820_SHBs_P-C of FT:mat_peptide FJ621820_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4346). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621821_SHBs_P-C Product feature CHAIN FJ621821_SHBs_P-C of FT:mat_peptide FJ621821_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4131). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621822_SHBs_P-C Product feature CHAIN FJ621822_SHBs_P-C of FT:mat_peptide FJ621822_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4132). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621823_SHBs_P-C Product feature CHAIN FJ621823_SHBs_P-C of FT:mat_peptide FJ621823_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4665). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSAFLGPLLVLLAGFSLLTRILTIPQSLDSWWTSLNFLGEVPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLPNILSPFLPLXVIXLXXWVYI
>gnl|hbvpro|FJ621824_SHBs_P-C Product feature CHAIN FJ621824_SHBs_P-C of FT:mat_peptide FJ621824_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2007). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGILGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621825_SHBs_P-C Product feature CHAIN FJ621825_SHBs_P-C of FT:mat_peptide FJ621825_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4479). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGSLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTSPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621826_SHBs_P-C Product feature CHAIN FJ621826_SHBs_P-C of FT:mat_peptide FJ621826_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4183). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFPGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621829_SHBs_P-C Product feature CHAIN FJ621829_SHBs_P-C of FT:mat_peptide FJ621829_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3029). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWELASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621830_SHBs_P-C Product feature CHAIN FJ621830_SHBs_P-C of FT:mat_peptide FJ621830_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2803). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVILMMWYWGPSLYNILSPFFPLLPIFFCLWVYI
>gnl|hbvpro|FJ621831_SHBs_P-C Product feature CHAIN FJ621831_SHBs_P-C of FT:mat_peptide FJ621831_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4216). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621832_SHBs_P-C Product feature CHAIN FJ621832_SHBs_P-C of FT:mat_peptide FJ621832_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4247). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621833_SHBs_P-C Product feature CHAIN FJ621833_SHBs_P-C of FT:mat_peptide FJ621833_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3002). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621834_SHBs_P-C Product feature CHAIN FJ621834_SHBs_P-C of FT:mat_peptide FJ621834_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3087). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPRLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621835_SHBs_P-C Product feature CHAIN FJ621835_SHBs_P-C of FT:mat_peptide FJ621835_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4215). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPRLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ621836_SHBs_P-C Product feature CHAIN FJ621836_SHBs_P-C of FT:mat_peptide FJ621836_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2815). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621837_SHBs_P-C Product feature CHAIN FJ621837_SHBs_P-C of FT:mat_peptide FJ621837_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2834). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621838_SHBs_P-C Product feature CHAIN FJ621838_SHBs_P-C of FT:mat_peptide FJ621838_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621839_SHBs_P-C Product feature CHAIN FJ621839_SHBs_P-C of FT:mat_peptide FJ621839_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4734). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621840_SHBs_P-C Product feature CHAIN FJ621840_SHBs_P-C of FT:mat_peptide FJ621840_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4735). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621841_SHBs_P-C Product feature CHAIN FJ621841_SHBs_P-C of FT:mat_peptide FJ621841_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3849). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLWVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPXFXCLWVYI
>gnl|hbvpro|FJ621842_SHBs_P-C Product feature CHAIN FJ621842_SHBs_P-C of FT:mat_peptide FJ621842_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4305). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621843_SHBs_P-C Product feature CHAIN FJ621843_SHBs_P-C of FT:mat_peptide FJ621843_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4263). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPISCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQRTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFAGLSPTVWLSVISMMWYWGPSLYNILSPFLPLLPIFFSLWVYI
>gnl|hbvpro|FJ621844_SHBs_P-C Product feature CHAIN FJ621844_SHBs_P-C of FT:mat_peptide FJ621844_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4711). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTFLNFLGGAHKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYRGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621845_SHBs_P-C Product feature CHAIN FJ621845_SHBs_P-C of FT:mat_peptide FJ621845_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4125). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621846_SHBs_P-C Product feature CHAIN FJ621846_SHBs_P-C of FT:mat_peptide FJ621846_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2887). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ621847_SHBs_P-C Product feature CHAIN FJ621847_SHBs_P-C of FT:mat_peptide FJ621847_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2938). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621848_SHBs_P-C Product feature CHAIN FJ621848_SHBs_P-C of FT:mat_peptide FJ621848_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4161). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXLXGTSTXSTGPCKXCTIXAQGTSMFPSCCCTKPSDANCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621849_SHBs_P-C Product feature CHAIN FJ621849_SHBs_P-C of FT:mat_peptide FJ621849_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3885). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=223 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICAGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGNSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLW
EWASVRFSWLSLLVPFVQCFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621850_SHBs_P-C Product feature CHAIN FJ621850_SHBs_P-C of FT:mat_peptide FJ621850_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4760). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFILLTRILTIPQSLDSWLTSLSSLGGAPKCPGQNSQSPTSNHSPTSCPPTCPGYRWXCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTXTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWXWASVRFSWLSLLVPFVQWFAGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ621851_SHBs_P-C Product feature CHAIN FJ621851_SHBs_P-C of FT:mat_peptide FJ621851_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4702). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFXCLWVYI
>gnl|hbvpro|FJ621852_SHBs_P-C Product feature CHAIN FJ621852_SHBs_P-C of FT:mat_peptide FJ621852_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3137). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLADYRGMLPVCPLLPGTSTTSTGPCKTCTSPAQGNSTFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIXMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621853_SHBs_P-C Product feature CHAIN FJ621853_SHBs_P-C of FT:mat_peptide FJ621853_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3829). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ621854_SHBs_P-C Product feature CHAIN FJ621854_SHBs_P-C of FT:mat_peptide FJ621854_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4326). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWLTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|FJ621855_SHBs_P-C Product feature CHAIN FJ621855_SHBs_P-C of FT:mat_peptide FJ621855_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3942). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621856_SHBs_P-C Product feature CHAIN FJ621856_SHBs_P-C of FT:mat_peptide FJ621856_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3138). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFPGGAPKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621857_SHBs_P-C Product feature CHAIN FJ621857_SHBs_P-C of FT:mat_peptide FJ621857_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4310). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFPGGAPKCPGQNSQSPTSNHSPTSCPPICPGYRLMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621858_SHBs_P-C Product feature CHAIN FJ621858_SHBs_P-C of FT:mat_peptide FJ621858_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2777). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621859_SHBs_P-C Product feature CHAIN FJ621859_SHBs_P-C of FT:mat_peptide FJ621859_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3090). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621860_SHBs_P-C Product feature CHAIN FJ621860_SHBs_P-C of FT:mat_peptide FJ621860_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3203). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621861_SHBs_P-C Product feature CHAIN FJ621861_SHBs_P-C of FT:mat_peptide FJ621861_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4244). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621862_SHBs_P-C Product feature CHAIN FJ621862_SHBs_P-C of FT:mat_peptide FJ621862_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2013). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFXLWVYI
>gnl|hbvpro|FJ621863_SHBs_P-C Product feature CHAIN FJ621863_SHBs_P-C of FT:mat_peptide FJ621863_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2092). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|FJ621864_SHBs_P-C Product feature CHAIN FJ621864_SHBs_P-C of FT:mat_peptide FJ621864_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2108). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621865_SHBs_P-C Product feature CHAIN FJ621865_SHBs_P-C of FT:mat_peptide FJ621865_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2829). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621866_SHBs_P-C Product feature CHAIN FJ621866_SHBs_P-C of FT:mat_peptide FJ621866_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2844). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621867_SHBs_P-C Product feature CHAIN FJ621867_SHBs_P-C of FT:mat_peptide FJ621867_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4041). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621868_SHBs_P-C Product feature CHAIN FJ621868_SHBs_P-C of FT:mat_peptide FJ621868_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3200). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWDWASVRFSWLSLLVPFVQWFAGLSPTVWLSVMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621869_SHBs_P-C Product feature CHAIN FJ621869_SHBs_P-C of FT:mat_peptide FJ621869_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3855). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTXPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFXLWXYI
>gnl|hbvpro|FJ621870_SHBs_P-C Product feature CHAIN FJ621870_SHBs_P-C of FT:mat_peptide FJ621870_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4042). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRLMCRRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPXLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621871_SHBs_P-C Product feature CHAIN FJ621871_SHBs_P-C of FT:mat_peptide FJ621871_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4520). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVXLSPTVWLSXMWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621872_SHBs_P-C Product feature CHAIN FJ621872_SHBs_P-C of FT:mat_peptide FJ621872_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4811). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGVPTCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWFSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFVPLLPIFFYLWVYI
>gnl|hbvpro|FJ621873_SHBs_P-C Product feature CHAIN FJ621873_SHBs_P-C of FT:mat_peptide FJ621873_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4499). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLSFLGGTPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLCNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ621876_SHBs_P-C Product feature CHAIN FJ621876_SHBs_P-C of FT:mat_peptide FJ621876_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4593). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLIRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTATTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621877_SHBs_P-C Product feature CHAIN FJ621877_SHBs_P-C of FT:mat_peptide FJ621877_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4637). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLIRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTATTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVXFSCLSLLXPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPXLPIFFCLWVYI
>gnl|hbvpro|FJ621878_SHBs_P-C Product feature CHAIN FJ621878_SHBs_P-C of FT:mat_peptide FJ621878_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4643). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFSLIRILTIPQSLDSWWTSLNFLGEAPACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTATTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSCLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621879_SHBs_P-C Product feature CHAIN FJ621879_SHBs_P-C of FT:mat_peptide FJ621879_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3997). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLNIILTIPHRLDSWWTSLNFLGGAPTCPGQNSKSPTSNHSXTSXPPICPXYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621880_SHBs_P-C Product feature CHAIN FJ621880_SHBs_P-C of FT:mat_peptide FJ621880_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4038). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKIHTIPQSLDSWWTSLNFLGGTPTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFVR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621881_SHBs_P-C Product feature CHAIN FJ621881_SHBs_P-C of FT:mat_peptide FJ621881_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3145). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLVDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621882_SHBs_P-C Product feature CHAIN FJ621882_SHBs_P-C of FT:mat_peptide FJ621882_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2808). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIXXWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621883_SHBs_P-C Product feature CHAIN FJ621883_SHBs_P-C of FT:mat_peptide FJ621883_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621884_SHBs_P-C Product feature CHAIN FJ621884_SHBs_P-C of FT:mat_peptide FJ621884_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3161). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621885_SHBs_P-C Product feature CHAIN FJ621885_SHBs_P-C of FT:mat_peptide FJ621885_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4488). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVELSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|FJ621886_SHBs_P-C Product feature CHAIN FJ621886_SHBs_P-C of FT:mat_peptide FJ621886_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4764). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTXPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621887_SHBs_P-C Product feature CHAIN FJ621887_SHBs_P-C of FT:mat_peptide FJ621887_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2912). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621888_SHBs_P-C Product feature CHAIN FJ621888_SHBs_P-C of FT:mat_peptide FJ621888_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2018). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGALTCPGRNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621889_SHBs_P-C Product feature CHAIN FJ621889_SHBs_P-C of FT:mat_peptide FJ621889_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S3181). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCPGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGXXMFPSCCCTKXXDGNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTAWLSVILMMWYWGPNLNNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ621890_SHBs_P-C Product feature CHAIN FJ621890_SHBs_P-C of FT:mat_peptide FJ621890_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S2012). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSXTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLXDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDXNCTCIPIPSSWAFAR
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ621891_SHBs_P-C Product feature CHAIN FJ621891_SHBs_P-C of FT:mat_peptide FJ621891_SHBs_P-C of [Viruses] Hepatitis B Virus genotype C (isolate S4027). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnavir