HBVdb

Dataset for protein HBSP of genotype D

[Download (right click)] [Alignment] [Repertoires]

1014 sequence(s)

>gnl|hbvpro|AB048701_HBSP_P-D Product feature CHAIN AB048701_HBSP_P-D of FT:mat_peptide AB048701_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AB078031_HBSP_P-D Product feature CHAIN AB078031_HBSP_P-D of FT:mat_peptide AB078031_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FH1-YS). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB078032_HBSP_P-D Product feature CHAIN AB078032_HBSP_P-D of FT:mat_peptide AB078032_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AH1-SY). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB078033_HBSP_P-D Product feature CHAIN AB078033_HBSP_P-D of FT:mat_peptide AB078033_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IS1-OY). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB090268_HBSP_P-D Product feature CHAIN AB090268_HBSP_P-D of FT:mat_peptide AB090268_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB090269_HBSP_P-D Product feature CHAIN AB090269_HBSP_P-D of FT:mat_peptide AB090269_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB090270_HBSP_P-D Product feature CHAIN AB090270_HBSP_P-D of FT:mat_peptide AB090270_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB104709_HBSP_P-D Product feature CHAIN AB104709_HBSP_P-D of FT:mat_peptide AB104709_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG64). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB104710_HBSP_P-D Product feature CHAIN AB104710_HBSP_P-D of FT:mat_peptide AB104710_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG105). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB104711_HBSP_P-D Product feature CHAIN AB104711_HBSP_P-D of FT:mat_peptide AB104711_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG104). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB104712_HBSP_P-D Product feature CHAIN AB104712_HBSP_P-D of FT:mat_peptide AB104712_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG75). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB109475_HBSP_P-D Product feature CHAIN AB109475_HBSP_P-D of FT:mat_peptide AB109475_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB109476_HBSP_P-D Product feature CHAIN AB109476_HBSP_P-D of FT:mat_peptide AB109476_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB109477_HBSP_P-D Product feature CHAIN AB109477_HBSP_P-D of FT:mat_peptide AB109477_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB109478_HBSP_P-D Product feature CHAIN AB109478_HBSP_P-D of FT:mat_peptide AB109478_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB109479_HBSP_P-D Product feature CHAIN AB109479_HBSP_P-D of FT:mat_peptide AB109479_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDLPPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB110075_HBSP_P-D Product feature CHAIN AB110075_HBSP_P-D of FT:mat_peptide AB110075_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB116266_HBSP_P-D Product feature CHAIN AB116266_HBSP_P-D of FT:mat_peptide AB116266_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB119251_HBSP_P-D Product feature CHAIN AB119251_HBSP_P-D of FT:mat_peptide AB119251_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB119252_HBSP_P-D Product feature CHAIN AB119252_HBSP_P-D of FT:mat_peptide AB119252_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB119253_HBSP_P-D Product feature CHAIN AB119253_HBSP_P-D of FT:mat_peptide AB119253_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB119254_HBSP_P-D Product feature CHAIN AB119254_HBSP_P-D of FT:mat_peptide AB119254_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AB119255_HBSP_P-D Product feature CHAIN AB119255_HBSP_P-D of FT:mat_peptide AB119255_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB119256_HBSP_P-D Product feature CHAIN AB119256_HBSP_P-D of FT:mat_peptide AB119256_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB120308_HBSP_P-D Product feature CHAIN AB120308_HBSP_P-D of FT:mat_peptide AB120308_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQPPAWDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB126581_HBSP_P-D Product feature CHAIN AB126581_HBSP_P-D of FT:mat_peptide AB126581_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU301). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPGRLLVKEPLCIPPGAGPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB188241_HBSP_P-D Product feature CHAIN AB188241_HBSP_P-D of FT:mat_peptide AB188241_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB188242_HBSP_P-D Product feature CHAIN AB188242_HBSP_P-D of FT:mat_peptide AB188242_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLRPPAWDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB188244_HBSP_P-D Product feature CHAIN AB188244_HBSP_P-D of FT:mat_peptide AB188244_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZ24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCGPHVAVPNLRT
EIAPVFPSHRPGLSQNTYGSGPQPVSXGSVY
>gnl|hbvpro|AB205126_HBSP_P-D Product feature CHAIN AB205126_HBSP_P-D of FT:mat_peptide AB205126_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-IF714-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB205127_HBSP_P-D Product feature CHAIN AB205127_HBSP_P-D of FT:mat_peptide AB205127_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU313-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB205128_HBSP_P-D Product feature CHAIN AB205128_HBSP_P-D of FT:mat_peptide AB205128_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU316-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB210820_HBSP_P-D Product feature CHAIN AB210820_HBSP_P-D of FT:mat_peptide AB210820_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDESGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLHKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB210821_HBSP_P-D Product feature CHAIN AB210821_HBSP_P-D of FT:mat_peptide AB210821_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB210822_HBSP_P-D Product feature CHAIN AB210822_HBSP_P-D of FT:mat_peptide AB210822_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB222709_HBSP_P-D Product feature CHAIN AB222709_HBSP_P-D of FT:mat_peptide AB222709_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB222710_HBSP_P-D Product feature CHAIN AB222710_HBSP_P-D of FT:mat_peptide AB222710_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6M). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSAGSVY
>gnl|hbvpro|AB222711_HBSP_P-D Product feature CHAIN AB222711_HBSP_P-D of FT:mat_peptide AB222711_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNV24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB222712_HBSP_P-D Product feature CHAIN AB222712_HBSP_P-D of FT:mat_peptide AB222712_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV61). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB222713_HBSP_P-D Product feature CHAIN AB222713_HBSP_P-D of FT:mat_peptide AB222713_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB246347_HBSP_P-D Product feature CHAIN AB246347_HBSP_P-D of FT:mat_peptide AB246347_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLEEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB246348_HBSP_P-D Product feature CHAIN AB246348_HBSP_P-D of FT:mat_peptide AB246348_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLYIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB267090_HBSP_P-D Product feature CHAIN AB267090_HBSP_P-D of FT:mat_peptide AB267090_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ehime 22-HS). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270537_HBSP_P-D Product feature CHAIN AB270537_HBSP_P-D of FT:mat_peptide AB270537_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL22F). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270539_HBSP_P-D Product feature CHAIN AB270539_HBSP_P-D of FT:mat_peptide AB270539_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL200F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVSNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270540_HBSP_P-D Product feature CHAIN AB270540_HBSP_P-D of FT:mat_peptide AB270540_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL241F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270541_HBSP_P-D Product feature CHAIN AB270541_HBSP_P-D of FT:mat_peptide AB270541_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL47F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270542_HBSP_P-D Product feature CHAIN AB270542_HBSP_P-D of FT:mat_peptide AB270542_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL12F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270543_HBSP_P-D Product feature CHAIN AB270543_HBSP_P-D of FT:mat_peptide AB270543_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL209F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270547_HBSP_P-D Product feature CHAIN AB270547_HBSP_P-D of FT:mat_peptide AB270547_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL295F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREHAEPARPLLAEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270548_HBSP_P-D Product feature CHAIN AB270548_HBSP_P-D of FT:mat_peptide AB270548_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL207F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270549_HBSP_P-D Product feature CHAIN AB270549_HBSP_P-D of FT:mat_peptide AB270549_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL79F). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLYIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB270550_HBSP_P-D Product feature CHAIN AB270550_HBSP_P-D of FT:mat_peptide AB270550_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL247F). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTDLQPPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB330367_HBSP_P-D Product feature CHAIN AB330367_HBSP_P-D of FT:mat_peptide AB330367_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ14HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AB330369_HBSP_P-D Product feature CHAIN AB330369_HBSP_P-D of FT:mat_peptide AB330369_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ5HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB330370_HBSP_P-D Product feature CHAIN AB330370_HBSP_P-D of FT:mat_peptide AB330370_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ6HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB471856_HBSP_P-D Product feature CHAIN AB471856_HBSP_P-D of FT:mat_peptide AB471856_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB471857_HBSP_P-D Product feature CHAIN AB471857_HBSP_P-D of FT:mat_peptide AB471857_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB493846_HBSP_P-D Product feature CHAIN AB493846_HBSP_P-D of FT:mat_peptide AB493846_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17UC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB555496_HBSP_P-D Product feature CHAIN AB555496_HBSP_P-D of FT:mat_peptide AB555496_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA31). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFWRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLYDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB555497_HBSP_P-D Product feature CHAIN AB555497_HBSP_P-D of FT:mat_peptide AB555497_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFWRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB555500_HBSP_P-D Product feature CHAIN AB555500_HBSP_P-D of FT:mat_peptide AB555500_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA64). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDXEAGPLEEELPRLADEDLNRRVAEDLNLGTPNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB555501_HBSP_P-D Product feature CHAIN AB555501_HBSP_P-D of FT:mat_peptide AB555501_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQQPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB583680_HBSP_P-D Product feature CHAIN AB583680_HBSP_P-D of FT:mat_peptide AB583680_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pkst7912). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674403_HBSP_P-D Product feature CHAIN AB674403_HBSP_P-D of FT:mat_peptide AB674403_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD87). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674404_HBSP_P-D Product feature CHAIN AB674404_HBSP_P-D of FT:mat_peptide AB674404_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE39). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARXHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674405_HBSP_P-D Product feature CHAIN AB674405_HBSP_P-D of FT:mat_peptide AB674405_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraHCCA12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAKPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674406_HBSP_P-D Product feature CHAIN AB674406_HBSP_P-D of FT:mat_peptide AB674406_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHARPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHXPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674407_HBSP_P-D Product feature CHAIN AB674407_HBSP_P-D of FT:mat_peptide AB674407_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674408_HBSP_P-D Product feature CHAIN AB674408_HBSP_P-D of FT:mat_peptide AB674408_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD83). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674409_HBSP_P-D Product feature CHAIN AB674409_HBSP_P-D of FT:mat_peptide AB674409_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD40). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674411_HBSP_P-D Product feature CHAIN AB674411_HBSP_P-D of FT:mat_peptide AB674411_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD84). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQRPVRDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|AB674413_HBSP_P-D Product feature CHAIN AB674413_HBSP_P-D of FT:mat_peptide AB674413_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB27). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674415_HBSP_P-D Product feature CHAIN AB674415_HBSP_P-D of FT:mat_peptide AB674415_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC24). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHXGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674416_HBSP_P-D Product feature CHAIN AB674416_HBSP_P-D of FT:mat_peptide AB674416_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE19). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRVLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674417_HBSP_P-D Product feature CHAIN AB674417_HBSP_P-D of FT:mat_peptide AB674417_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraLCE1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVADDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|AB674418_HBSP_P-D Product feature CHAIN AB674418_HBSP_P-D of FT:mat_peptide AB674418_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC7). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVADDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|AB674419_HBSP_P-D Product feature CHAIN AB674419_HBSP_P-D of FT:mat_peptide AB674419_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQPPARDPAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|AB674420_HBSP_P-D Product feature CHAIN AB674420_HBSP_P-D of FT:mat_peptide AB674420_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunLCD2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPVRDHAKPARLLLKAPLCFPHVAVQNLRM
EIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB674422_HBSP_P-D Product feature CHAIN AB674422_HBSP_P-D of FT:mat_peptide AB674422_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGXNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674423_HBSP_P-D Product feature CHAIN AB674423_HBSP_P-D of FT:mat_peptide AB674423_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSVLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674424_HBSP_P-D Product feature CHAIN AB674424_HBSP_P-D of FT:mat_peptide AB674424_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQLFRRLLLLDPEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQRPARDHAEPARVLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSIY
>gnl|hbvpro|AB674425_HBSP_P-D Product feature CHAIN AB674425_HBSP_P-D of FT:mat_peptide AB674425_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGXNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674426_HBSP_P-D Product feature CHAIN AB674426_HBSP_P-D of FT:mat_peptide AB674426_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD50). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674427_HBSP_P-D Product feature CHAIN AB674427_HBSP_P-D of FT:mat_peptide AB674427_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674428_HBSP_P-D Product feature CHAIN AB674428_HBSP_P-D of FT:mat_peptide AB674428_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPDDLQRPARDHAEPARVLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674431_HBSP_P-D Product feature CHAIN AB674431_HBSP_P-D of FT:mat_peptide AB674431_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYHHFRRLVLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AB674435_HBSP_P-D Product feature CHAIN AB674435_HBSP_P-D of FT:mat_peptide AB674435_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB24). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAESARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGPVY
>gnl|hbvpro|AF043593_HBSP_P-D Product feature CHAIN AF043593_HBSP_P-D of FT:mat_peptide AF043593_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6/89). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARPLFKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AF043594_HBSP_P-D Product feature CHAIN AF043594_HBSP_P-D of FT:mat_peptide AF043594_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1/91). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AF121239_HBSP_P-D Product feature CHAIN AF121239_HBSP_P-D of FT:mat_peptide AF121239_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1303). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AF121240_HBSP_C-D Product feature CHAIN AF121240_HBSP_C-D of FT:mat_peptide AF121240_HBSP_C-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/11066). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AF121241_HBSP_P-D Product feature CHAIN AF121241_HBSP_P-D of FT:mat_peptide AF121241_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1758). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AF121242_HBSP_P-D Product feature CHAIN AF121242_HBSP_P-D of FT:mat_peptide AF121242_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1218). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AF151735_HBSP_P-D Product feature CHAIN AF151735_HBSP_P-D of FT:mat_peptide AF151735_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRK
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AF280817_HBSP_P-D Product feature CHAIN AF280817_HBSP_P-D of FT:mat_peptide AF280817_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-D1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AJ344116_HBSP_P-D Product feature CHAIN AJ344116_HBSP_P-D of FT:mat_peptide AJ344116_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBsAg negative patient GX27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AJ627215_HBSP_P-D Product feature CHAIN AJ627215_HBSP_P-D of FT:mat_peptide AJ627215_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 06115). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AJ627216_HBSP_P-D Product feature CHAIN AJ627216_HBSP_P-D of FT:mat_peptide AJ627216_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17707). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AJ627218_HBSP_P-D Product feature CHAIN AJ627218_HBSP_P-D of FT:mat_peptide AJ627218_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 21116). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AJ627219_HBSP_P-D Product feature CHAIN AJ627219_HBSP_P-D of FT:mat_peptide AJ627219_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 24039). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHRPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AJ627220_HBSP_P-D Product feature CHAIN AJ627220_HBSP_P-D of FT:mat_peptide AJ627220_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 29234). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKETLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AJ627222_HBSP_P-D Product feature CHAIN AJ627222_HBSP_P-D of FT:mat_peptide AJ627222_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 31228). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADXDLNHRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AJ627223_HBSP_P-D Product feature CHAIN AJ627223_HBSP_P-D of FT:mat_peptide AJ627223_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33720). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AJ627224_HBSP_P-D Product feature CHAIN AJ627224_HBSP_P-D of FT:mat_peptide AJ627224_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33852). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY090452_HBSP_P-D Product feature CHAIN AY090452_HBSP_P-D of FT:mat_peptide AY090452_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSVLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDPQPPARDHAKPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY090453_HBSP_P-D Product feature CHAIN AY090453_HBSP_P-D of FT:mat_peptide AY090453_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHARPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSSGSIY
>gnl|hbvpro|AY161150_HBSP_P-D Product feature CHAIN AY161150_HBSP_P-D of FT:mat_peptide AY161150_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKETLFIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161151_HBSP_P-D Product feature CHAIN AY161151_HBSP_P-D of FT:mat_peptide AY161151_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKETLFIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161152_HBSP_P-D Product feature CHAIN AY161152_HBSP_P-D of FT:mat_peptide AY161152_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKETLFIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161153_HBSP_P-D Product feature CHAIN AY161153_HBSP_P-D of FT:mat_peptide AY161153_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKETLFIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161154_HBSP_P-D Product feature CHAIN AY161154_HBSP_P-D of FT:mat_peptide AY161154_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKETLFIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161155_HBSP_P-D Product feature CHAIN AY161155_HBSP_P-D of FT:mat_peptide AY161155_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKETLFIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161156_HBSP_P-D Product feature CHAIN AY161156_HBSP_P-D of FT:mat_peptide AY161156_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKETLFIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161157_HBSP_P-D Product feature CHAIN AY161157_HBSP_P-D of FT:mat_peptide AY161157_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRPLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161158_HBSP_P-D Product feature CHAIN AY161158_HBSP_P-D of FT:mat_peptide AY161158_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161159_HBSP_P-D Product feature CHAIN AY161159_HBSP_P-D of FT:mat_peptide AY161159_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY161160_HBSP_P-D Product feature CHAIN AY161160_HBSP_P-D of FT:mat_peptide AY161160_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY233291_HBSP_P-D Product feature CHAIN AY233291_HBSP_P-D of FT:mat_peptide AY233291_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 179). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY233292_HBSP_P-D Product feature CHAIN AY233292_HBSP_P-D of FT:mat_peptide AY233292_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 184). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY233294_HBSP_P-D Product feature CHAIN AY233294_HBSP_P-D of FT:mat_peptide AY233294_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 305). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY233296_HBSP_P-D Product feature CHAIN AY233296_HBSP_P-D of FT:mat_peptide AY233296_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 185). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY236160_HBSP_P-D Product feature CHAIN AY236160_HBSP_P-D of FT:mat_peptide AY236160_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1A). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVPPGSVY
>gnl|hbvpro|AY236164_HBSP_P-D Product feature CHAIN AY236164_HBSP_P-D of FT:mat_peptide AY236164_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 30). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGNLNDPQPPARDHAESARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|AY373431_HBSP_P-D Product feature CHAIN AY373431_HBSP_P-D of FT:mat_peptide AY373431_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY661792_HBSP_P-D Product feature CHAIN AY661792_HBSP_P-D of FT:mat_peptide AY661792_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ayw). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY661793_HBSP_P-D Product feature CHAIN AY661793_HBSP_P-D of FT:mat_peptide AY661793_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY721605_HBSP_P-D Product feature CHAIN AY721605_HBSP_P-D of FT:mat_peptide AY721605_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AK1.1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY721606_HBSP_P-D Product feature CHAIN AY721606_HBSP_P-D of FT:mat_peptide AY721606_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AT1.2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPVRDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY721607_HBSP_P-D Product feature CHAIN AY721607_HBSP_P-D of FT:mat_peptide AY721607_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HIY1.3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPAQLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY721608_HBSP_P-D Product feature CHAIN AY721608_HBSP_P-D of FT:mat_peptide AY721608_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IB1.4). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEHARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY721609_HBSP_P-D Product feature CHAIN AY721609_HBSP_P-D of FT:mat_peptide AY721609_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AA1.5). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY721610_HBSP_P-D Product feature CHAIN AY721610_HBSP_P-D of FT:mat_peptide AY721610_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FK1.6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY721611_HBSP_P-D Product feature CHAIN AY721611_HBSP_P-D of FT:mat_peptide AY721611_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SK1.7). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVSNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY721612_HBSP_P-D Product feature CHAIN AY721612_HBSP_P-D of FT:mat_peptide AY721612_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BL1.8). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY741794_HBSP_P-D Product feature CHAIN AY741794_HBSP_P-D of FT:mat_peptide AY741794_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-50). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY741795_HBSP_P-D Product feature CHAIN AY741795_HBSP_P-D of FT:mat_peptide AY741795_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-Hi). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQNLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY741796_HBSP_P-D Product feature CHAIN AY741796_HBSP_P-D of FT:mat_peptide AY741796_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQNLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY741797_HBSP_P-D Product feature CHAIN AY741797_HBSP_P-D of FT:mat_peptide AY741797_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|AY741798_HBSP_P-D Product feature CHAIN AY741798_HBSP_P-D of FT:mat_peptide AY741798_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAENLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY796030_HBSP_P-D Product feature CHAIN AY796030_HBSP_P-D of FT:mat_peptide AY796030_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FC1.9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY796031_HBSP_P-D Product feature CHAIN AY796031_HBSP_P-D of FT:mat_peptide AY796031_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RA1.10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKGPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY796032_HBSP_P-D Product feature CHAIN AY796032_HBSP_P-D of FT:mat_peptide AY796032_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NA1.11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|AY945307_HBSP_P-D Product feature CHAIN AY945307_HBSP_P-D of FT:mat_peptide AY945307_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLWENSYGSGPQPVSPGSVY
>gnl|hbvpro|DQ111986_HBSP_P-D Product feature CHAIN DQ111986_HBSP_P-D of FT:mat_peptide DQ111986_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MBT181). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDXDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|DQ315778_HBSP_P-D Product feature CHAIN DQ315778_HBSP_P-D of FT:mat_peptide DQ315778_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI0388). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|DQ336674_HBSP_P-D Product feature CHAIN DQ336674_HBSP_P-D of FT:mat_peptide DQ336674_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336675_HBSP_P-D Product feature CHAIN DQ336675_HBSP_P-D of FT:mat_peptide DQ336675_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336676_HBSP_P-D Product feature CHAIN DQ336676_HBSP_P-D of FT:mat_peptide DQ336676_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336677_HBSP_P-D Product feature CHAIN DQ336677_HBSP_P-D of FT:mat_peptide DQ336677_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336678_HBSP_P-D Product feature CHAIN DQ336678_HBSP_P-D of FT:mat_peptide DQ336678_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336679_HBSP_P-D Product feature CHAIN DQ336679_HBSP_P-D of FT:mat_peptide DQ336679_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336680_HBSP_P-D Product feature CHAIN DQ336680_HBSP_P-D of FT:mat_peptide DQ336680_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDLQPPARDHAEPARLLLKESLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ336681_HBSP_P-D Product feature CHAIN DQ336681_HBSP_P-D of FT:mat_peptide DQ336681_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDLQPPARDHAEPARLLLKESLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ336682_HBSP_P-D Product feature CHAIN DQ336682_HBSP_P-D of FT:mat_peptide DQ336682_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDLQPPARDHAEPARLLLKESLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|DQ336683_HBSP_P-D Product feature CHAIN DQ336683_HBSP_P-D of FT:mat_peptide DQ336683_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKESLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ336684_HBSP_P-D Product feature CHAIN DQ336684_HBSP_P-D of FT:mat_peptide DQ336684_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDLQPPARDHAEPARLLLKESLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|DQ336685_HBSP_P-D Product feature CHAIN DQ336685_HBSP_P-D of FT:mat_peptide DQ336685_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLLDPRPPARVLAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336686_HBSP_P-D Product feature CHAIN DQ336686_HBSP_P-D of FT:mat_peptide DQ336686_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPRPPARDHAGPARLLLKEPLCILPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336687_HBSP_P-D Product feature CHAIN DQ336687_HBSP_P-D of FT:mat_peptide DQ336687_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPRPPARDHAGPARLLLKEPLCILPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336688_HBSP_P-D Product feature CHAIN DQ336688_HBSP_P-D of FT:mat_peptide DQ336688_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPRPPARDHAGPARLLLKEPLCILPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336689_HBSP_P-D Product feature CHAIN DQ336689_HBSP_P-D of FT:mat_peptide DQ336689_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGNLNDPRQPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336690_HBSP_P-D Product feature CHAIN DQ336690_HBSP_P-D of FT:mat_peptide DQ336690_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ336692_HBSP_P-D Product feature CHAIN DQ336692_HBSP_P-D of FT:mat_peptide DQ336692_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPRPPARDHAGPARLLLKEPLCILPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ464172_HBSP_P-D Product feature CHAIN DQ464172_HBSP_P-D of FT:mat_peptide DQ464172_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLQEELPHLADEGLNRRVAEDLNLRNLTDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ464173_HBSP_P-D Product feature CHAIN DQ464173_HBSP_P-D of FT:mat_peptide DQ464173_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ464174_HBSP_P-D Product feature CHAIN DQ464174_HBSP_P-D of FT:mat_peptide DQ464174_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARVHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ464175_HBSP_P-D Product feature CHAIN DQ464175_HBSP_P-D of FT:mat_peptide DQ464175_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ464176_HBSP_P-D Product feature CHAIN DQ464176_HBSP_P-D of FT:mat_peptide DQ464176_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ464177_HBSP_P-D Product feature CHAIN DQ464177_HBSP_P-D of FT:mat_peptide DQ464177_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ464178_HBSP_P-D Product feature CHAIN DQ464178_HBSP_P-D of FT:mat_peptide DQ464178_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ464181_HBSP_P-D Product feature CHAIN DQ464181_HBSP_P-D of FT:mat_peptide DQ464181_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S3). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAHVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|DQ486021_HBSP_P-D Product feature CHAIN DQ486021_HBSP_P-D of FT:mat_peptide DQ486021_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ486022_HBSP_P-D Product feature CHAIN DQ486022_HBSP_P-D of FT:mat_peptide DQ486022_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT11). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGNLNDPQPPARDHAESARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGRGPQPVSPGSVY
>gnl|hbvpro|DQ486023_HBSP_P-D Product feature CHAIN DQ486023_HBSP_P-D of FT:mat_peptide DQ486023_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLEDEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPGAVPKLWT
EIAPVFPSHHLGLSENSYGSGPQPVPSGSVY
>gnl|hbvpro|DQ486025_HBSP_P-D Product feature CHAIN DQ486025_HBSP_P-D of FT:mat_peptide DQ486025_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLRM
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EF103275_HBSP_P-D Product feature CHAIN EF103275_HBSP_P-D of FT:mat_peptide EF103275_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EF103276_HBSP_P-D Product feature CHAIN EF103276_HBSP_P-D of FT:mat_peptide EF103276_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EF103277_HBSP_P-D Product feature CHAIN EF103277_HBSP_P-D of FT:mat_peptide EF103277_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran33). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EF103279_HBSP_P-D Product feature CHAIN EF103279_HBSP_P-D of FT:mat_peptide EF103279_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran99). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EF103280_HBSP_P-D Product feature CHAIN EF103280_HBSP_P-D of FT:mat_peptide EF103280_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran100). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EF103281_HBSP_P-D Product feature CHAIN EF103281_HBSP_P-D of FT:mat_peptide EF103281_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU414135_HBSP_P-D Product feature CHAIN EU414135_HBSP_P-D of FT:mat_peptide EU414135_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU414136_HBSP_P-D Product feature CHAIN EU414136_HBSP_P-D of FT:mat_peptide EU414136_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
QIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU414138_HBSP_P-D Product feature CHAIN EU414138_HBSP_P-D of FT:mat_peptide EU414138_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU414139_HBSP_P-D Product feature CHAIN EU414139_HBSP_P-D of FT:mat_peptide EU414139_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEEXPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU414141_HBSP_P-D Product feature CHAIN EU414141_HBSP_P-D of FT:mat_peptide EU414141_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU414142_HBSP_P-D Product feature CHAIN EU414142_HBSP_P-D of FT:mat_peptide EU414142_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU414143_HBSP_P-D Product feature CHAIN EU414143_HBSP_P-D of FT:mat_peptide EU414143_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRXAEDLNLGNLNDPQPPARDHAAPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594382_HBSP_P-D Product feature CHAIN EU594382_HBSP_P-D of FT:mat_peptide EU594382_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594396_HBSP_P-D Product feature CHAIN EU594396_HBSP_P-D of FT:mat_peptide EU594396_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594397_HBSP_P-D Product feature CHAIN EU594397_HBSP_P-D of FT:mat_peptide EU594397_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594398_HBSP_P-D Product feature CHAIN EU594398_HBSP_P-D of FT:mat_peptide EU594398_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594399_HBSP_P-D Product feature CHAIN EU594399_HBSP_P-D of FT:mat_peptide EU594399_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594400_HBSP_P-D Product feature CHAIN EU594400_HBSP_P-D of FT:mat_peptide EU594400_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594401_HBSP_P-D Product feature CHAIN EU594401_HBSP_P-D of FT:mat_peptide EU594401_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594402_HBSP_P-D Product feature CHAIN EU594402_HBSP_P-D of FT:mat_peptide EU594402_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594403_HBSP_P-D Product feature CHAIN EU594403_HBSP_P-D of FT:mat_peptide EU594403_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594404_HBSP_P-D Product feature CHAIN EU594404_HBSP_P-D of FT:mat_peptide EU594404_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594405_HBSP_P-D Product feature CHAIN EU594405_HBSP_P-D of FT:mat_peptide EU594405_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594407_HBSP_P-D Product feature CHAIN EU594407_HBSP_P-D of FT:mat_peptide EU594407_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594408_HBSP_P-D Product feature CHAIN EU594408_HBSP_P-D of FT:mat_peptide EU594408_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594409_HBSP_P-D Product feature CHAIN EU594409_HBSP_P-D of FT:mat_peptide EU594409_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594410_HBSP_P-D Product feature CHAIN EU594410_HBSP_P-D of FT:mat_peptide EU594410_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594411_HBSP_P-D Product feature CHAIN EU594411_HBSP_P-D of FT:mat_peptide EU594411_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594412_HBSP_P-D Product feature CHAIN EU594412_HBSP_P-D of FT:mat_peptide EU594412_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594413_HBSP_P-D Product feature CHAIN EU594413_HBSP_P-D of FT:mat_peptide EU594413_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594414_HBSP_P-D Product feature CHAIN EU594414_HBSP_P-D of FT:mat_peptide EU594414_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594415_HBSP_P-D Product feature CHAIN EU594415_HBSP_P-D of FT:mat_peptide EU594415_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594416_HBSP_P-D Product feature CHAIN EU594416_HBSP_P-D of FT:mat_peptide EU594416_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLRPPAWDHAEPARLLFKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594417_HBSP_P-D Product feature CHAIN EU594417_HBSP_P-D of FT:mat_peptide EU594417_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594418_HBSP_P-D Product feature CHAIN EU594418_HBSP_P-D of FT:mat_peptide EU594418_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594419_HBSP_P-D Product feature CHAIN EU594419_HBSP_P-D of FT:mat_peptide EU594419_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAGPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594420_HBSP_P-D Product feature CHAIN EU594420_HBSP_P-D of FT:mat_peptide EU594420_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAGPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594421_HBSP_P-D Product feature CHAIN EU594421_HBSP_P-D of FT:mat_peptide EU594421_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594422_HBSP_P-D Product feature CHAIN EU594422_HBSP_P-D of FT:mat_peptide EU594422_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAGPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594423_HBSP_P-D Product feature CHAIN EU594423_HBSP_P-D of FT:mat_peptide EU594423_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAGPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594424_HBSP_P-D Product feature CHAIN EU594424_HBSP_P-D of FT:mat_peptide EU594424_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594425_HBSP_P-D Product feature CHAIN EU594425_HBSP_P-D of FT:mat_peptide EU594425_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594426_HBSP_P-D Product feature CHAIN EU594426_HBSP_P-D of FT:mat_peptide EU594426_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594427_HBSP_P-D Product feature CHAIN EU594427_HBSP_P-D of FT:mat_peptide EU594427_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594428_HBSP_P-D Product feature CHAIN EU594428_HBSP_P-D of FT:mat_peptide EU594428_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAGPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594429_HBSP_P-D Product feature CHAIN EU594429_HBSP_P-D of FT:mat_peptide EU594429_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594430_HBSP_P-D Product feature CHAIN EU594430_HBSP_P-D of FT:mat_peptide EU594430_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594431_HBSP_P-D Product feature CHAIN EU594431_HBSP_P-D of FT:mat_peptide EU594431_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594432_HBSP_P-D Product feature CHAIN EU594432_HBSP_P-D of FT:mat_peptide EU594432_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594433_HBSP_P-D Product feature CHAIN EU594433_HBSP_P-D of FT:mat_peptide EU594433_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAREHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU594434_HBSP_P-D Product feature CHAIN EU594434_HBSP_P-D of FT:mat_peptide EU594434_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKDPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU787436_HBSP_P-D Product feature CHAIN EU787436_HBSP_P-D of FT:mat_peptide EU787436_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 165). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU787437_HBSP_P-D Product feature CHAIN EU787437_HBSP_P-D of FT:mat_peptide EU787437_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|EU787438_HBSP_P-D Product feature CHAIN EU787438_HBSP_P-D of FT:mat_peptide EU787438_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU787439_HBSP_P-D Product feature CHAIN EU787439_HBSP_P-D of FT:mat_peptide EU787439_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 89). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEDLPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPLVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU787440_HBSP_P-D Product feature CHAIN EU787440_HBSP_P-D of FT:mat_peptide EU787440_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU787441_HBSP_P-D Product feature CHAIN EU787441_HBSP_P-D of FT:mat_peptide EU787441_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSIY
>gnl|hbvpro|EU787442_HBSP_P-D Product feature CHAIN EU787442_HBSP_P-D of FT:mat_peptide EU787442_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU787443_HBSP_P-D Product feature CHAIN EU787443_HBSP_P-D of FT:mat_peptide EU787443_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate w40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU787445_HBSP_P-D Product feature CHAIN EU787445_HBSP_P-D of FT:mat_peptide EU787445_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W51). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEHARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU787446_HBSP_P-D Product feature CHAIN EU787446_HBSP_P-D of FT:mat_peptide EU787446_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W75). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU787447_HBSP_P-D Product feature CHAIN EU787447_HBSP_P-D of FT:mat_peptide EU787447_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W46). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPLVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU919197_HBSP_P-D Product feature CHAIN EU919197_HBSP_P-D of FT:mat_peptide EU919197_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJU). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPTVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU921418_HBSP_P-D Product feature CHAIN EU921418_HBSP_P-D of FT:mat_peptide EU921418_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.165.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|EU921419_HBSP_P-D Product feature CHAIN EU921419_HBSP_P-D of FT:mat_peptide EU921419_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.252.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNPNDPQPPARDHVEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|EU939680_HBSP_P-D Product feature CHAIN EU939680_HBSP_P-D of FT:mat_peptide EU939680_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C186). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGTLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARFLLKEPLCIPLVAVPKLRT
EIAPVFPSHHPGLSENSYGSGPQPISPCSVY
>gnl|hbvpro|EU939681_HBSP_P-D Product feature CHAIN EU939681_HBSP_P-D of FT:mat_peptide EU939681_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDPAEPARLLLKEPLCIPLVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349205_HBSP_P-D Product feature CHAIN FJ349205_HBSP_P-D of FT:mat_peptide FJ349205_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349206_HBSP_P-D Product feature CHAIN FJ349206_HBSP_P-D of FT:mat_peptide FJ349206_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLHLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349208_HBSP_P-D Product feature CHAIN FJ349208_HBSP_P-D of FT:mat_peptide FJ349208_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349213_HBSP_P-D Product feature CHAIN FJ349213_HBSP_P-D of FT:mat_peptide FJ349213_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H59). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDNDTGPLEEELPRLADEGLNRRVAEDLNLGNLNDRRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349215_HBSP_P-D Product feature CHAIN FJ349215_HBSP_P-D of FT:mat_peptide FJ349215_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H82). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349216_HBSP_P-D Product feature CHAIN FJ349216_HBSP_P-D of FT:mat_peptide FJ349216_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H113). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349217_HBSP_P-D Product feature CHAIN FJ349217_HBSP_P-D of FT:mat_peptide FJ349217_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H129). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349218_HBSP_P-D Product feature CHAIN FJ349218_HBSP_P-D of FT:mat_peptide FJ349218_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H135). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGIGPQPVSHGSVY
>gnl|hbvpro|FJ349219_HBSP_P-D Product feature CHAIN FJ349219_HBSP_P-D of FT:mat_peptide FJ349219_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H138). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLTEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349220_HBSP_P-D Product feature CHAIN FJ349220_HBSP_P-D of FT:mat_peptide FJ349220_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H144). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349228_HBSP_P-D Product feature CHAIN FJ349228_HBSP_P-D of FT:mat_peptide FJ349228_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349229_HBSP_P-D Product feature CHAIN FJ349229_HBSP_P-D of FT:mat_peptide FJ349229_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349230_HBSP_P-D Product feature CHAIN FJ349230_HBSP_P-D of FT:mat_peptide FJ349230_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349231_HBSP_P-D Product feature CHAIN FJ349231_HBSP_P-D of FT:mat_peptide FJ349231_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349232_HBSP_P-D Product feature CHAIN FJ349232_HBSP_P-D of FT:mat_peptide FJ349232_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349233_HBSP_P-D Product feature CHAIN FJ349233_HBSP_P-D of FT:mat_peptide FJ349233_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|FJ349234_HBSP_P-D Product feature CHAIN FJ349234_HBSP_P-D of FT:mat_peptide FJ349234_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C82). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ349235_HBSP_P-D Product feature CHAIN FJ349235_HBSP_P-D of FT:mat_peptide FJ349235_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C90). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQLPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ386590_HBSP_P-D Product feature CHAIN FJ386590_HBSP_P-D of FT:mat_peptide FJ386590_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1841). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ562309_HBSP_P-D Product feature CHAIN FJ562309_HBSP_P-D of FT:mat_peptide FJ562309_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I200). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ562338_HBSP_P-D Product feature CHAIN FJ562338_HBSP_P-D of FT:mat_peptide FJ562338_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I192). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ692506_HBSP_P-D Product feature CHAIN FJ692506_HBSP_P-D of FT:mat_peptide FJ692506_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50157). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ692507_HBSP_P-D Product feature CHAIN FJ692507_HBSP_P-D of FT:mat_peptide FJ692507_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50158). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ692532_HBSP_P-D Product feature CHAIN FJ692532_HBSP_P-D of FT:mat_peptide FJ692532_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50053). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPXLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCFPPVAVQNLRM
ETAPVFPSHRPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|FJ692533_HBSP_P-D Product feature CHAIN FJ692533_HBSP_P-D of FT:mat_peptide FJ692533_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50064). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETALVFPSHRPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|FJ899792_HBSP_P-D Product feature CHAIN FJ899792_HBSP_P-D of FT:mat_peptide FJ899792_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDPAEPARLLLKEPLCIPLVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904395_HBSP_P-D Product feature CHAIN FJ904395_HBSP_P-D of FT:mat_peptide FJ904395_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A10a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904399_HBSP_P-D Product feature CHAIN FJ904399_HBSP_P-D of FT:mat_peptide FJ904399_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLAXEGXNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904402_HBSP_P-D Product feature CHAIN FJ904402_HBSP_P-D of FT:mat_peptide FJ904402_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGVNRRVAEDLNLGNXNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904410_HBSP_P-D Product feature CHAIN FJ904410_HBSP_P-D of FT:mat_peptide FJ904410_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A54b). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904412_HBSP_P-D Product feature CHAIN FJ904412_HBSP_P-D of FT:mat_peptide FJ904412_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A56). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904415_HBSP_P-D Product feature CHAIN FJ904415_HBSP_P-D of FT:mat_peptide FJ904415_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A63). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSILLLDDEAGPLEEELPRVAVEGVNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904418_HBSP_P-D Product feature CHAIN FJ904418_HBSP_P-D of FT:mat_peptide FJ904418_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A69a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904419_HBSP_P-D Product feature CHAIN FJ904419_HBSP_P-D of FT:mat_peptide FJ904419_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A70). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAELARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904420_HBSP_P-D Product feature CHAIN FJ904420_HBSP_P-D of FT:mat_peptide FJ904420_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904421_HBSP_P-D Product feature CHAIN FJ904421_HBSP_P-D of FT:mat_peptide FJ904421_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71b). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904422_HBSP_P-D Product feature CHAIN FJ904422_HBSP_P-D of FT:mat_peptide FJ904422_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A76). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDXAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904424_HBSP_P-D Product feature CHAIN FJ904424_HBSP_P-D of FT:mat_peptide FJ904424_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A79a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARHLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904426_HBSP_P-D Product feature CHAIN FJ904426_HBSP_P-D of FT:mat_peptide FJ904426_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904427_HBSP_P-D Product feature CHAIN FJ904427_HBSP_P-D of FT:mat_peptide FJ904427_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRK
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904429_HBSP_P-D Product feature CHAIN FJ904429_HBSP_P-D of FT:mat_peptide FJ904429_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904431_HBSP_P-D Product feature CHAIN FJ904431_HBSP_P-D of FT:mat_peptide FJ904431_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B12). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904432_HBSP_P-D Product feature CHAIN FJ904432_HBSP_P-D of FT:mat_peptide FJ904432_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904433_HBSP_C-D Product feature CHAIN FJ904433_HBSP_C-D of FT:mat_peptide FJ904433_HBSP_C-D of [Viruses] Hepatitis B Virus genotype D (isolate B15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNXNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904435_HBSP_P-D Product feature CHAIN FJ904435_HBSP_P-D of FT:mat_peptide FJ904435_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904438_HBSP_P-D Product feature CHAIN FJ904438_HBSP_P-D of FT:mat_peptide FJ904438_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904439_HBSP_P-D Product feature CHAIN FJ904439_HBSP_P-D of FT:mat_peptide FJ904439_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904443_HBSP_P-D Product feature CHAIN FJ904443_HBSP_P-D of FT:mat_peptide FJ904443_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B46). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904445_HBSP_P-D Product feature CHAIN FJ904445_HBSP_P-D of FT:mat_peptide FJ904445_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B62). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|FJ904446_HBSP_P-D Product feature CHAIN FJ904446_HBSP_P-D of FT:mat_peptide FJ904446_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B64a). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVH
>gnl|hbvpro|GQ167301_HBSP_P-D Product feature CHAIN GQ167301_HBSP_P-D of FT:mat_peptide GQ167301_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM452). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ167302_HBSP_P-D Product feature CHAIN GQ167302_HBSP_P-D of FT:mat_peptide GQ167302_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4521). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183448_HBSP_P-D Product feature CHAIN GQ183448_HBSP_P-D of FT:mat_peptide GQ183448_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4629). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGILNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183449_HBSP_P-D Product feature CHAIN GQ183449_HBSP_P-D of FT:mat_peptide GQ183449_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4591). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183450_HBSP_P-D Product feature CHAIN GQ183450_HBSP_P-D of FT:mat_peptide GQ183450_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4589). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183451_HBSP_P-D Product feature CHAIN GQ183451_HBSP_P-D of FT:mat_peptide GQ183451_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4588). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183452_HBSP_P-D Product feature CHAIN GQ183452_HBSP_P-D of FT:mat_peptide GQ183452_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4590). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183453_HBSP_P-D Product feature CHAIN GQ183453_HBSP_P-D of FT:mat_peptide GQ183453_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4574). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183454_HBSP_P-D Product feature CHAIN GQ183454_HBSP_P-D of FT:mat_peptide GQ183454_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4582). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183455_HBSP_P-D Product feature CHAIN GQ183455_HBSP_P-D of FT:mat_peptide GQ183455_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4573). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183456_HBSP_P-D Product feature CHAIN GQ183456_HBSP_P-D of FT:mat_peptide GQ183456_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4572). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183457_HBSP_P-D Product feature CHAIN GQ183457_HBSP_P-D of FT:mat_peptide GQ183457_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4583). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183458_HBSP_P-D Product feature CHAIN GQ183458_HBSP_P-D of FT:mat_peptide GQ183458_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4587). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183459_HBSP_P-D Product feature CHAIN GQ183459_HBSP_P-D of FT:mat_peptide GQ183459_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4585). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183460_HBSP_P-D Product feature CHAIN GQ183460_HBSP_P-D of FT:mat_peptide GQ183460_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4584). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183461_HBSP_P-D Product feature CHAIN GQ183461_HBSP_P-D of FT:mat_peptide GQ183461_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4586). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183462_HBSP_P-D Product feature CHAIN GQ183462_HBSP_P-D of FT:mat_peptide GQ183462_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4567). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183463_HBSP_P-D Product feature CHAIN GQ183463_HBSP_P-D of FT:mat_peptide GQ183463_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4613). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183464_HBSP_P-D Product feature CHAIN GQ183464_HBSP_P-D of FT:mat_peptide GQ183464_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4703). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183465_HBSP_P-D Product feature CHAIN GQ183465_HBSP_P-D of FT:mat_peptide GQ183465_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4614). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183466_HBSP_P-D Product feature CHAIN GQ183466_HBSP_P-D of FT:mat_peptide GQ183466_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4577). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183467_HBSP_P-D Product feature CHAIN GQ183467_HBSP_P-D of FT:mat_peptide GQ183467_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4705). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183468_HBSP_P-D Product feature CHAIN GQ183468_HBSP_P-D of FT:mat_peptide GQ183468_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4632). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183469_HBSP_P-D Product feature CHAIN GQ183469_HBSP_P-D of FT:mat_peptide GQ183469_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4602). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183470_HBSP_P-D Product feature CHAIN GQ183470_HBSP_P-D of FT:mat_peptide GQ183470_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4639). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183471_HBSP_P-D Product feature CHAIN GQ183471_HBSP_P-D of FT:mat_peptide GQ183471_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4610). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183472_HBSP_P-D Product feature CHAIN GQ183472_HBSP_P-D of FT:mat_peptide GQ183472_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4691). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARQLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183473_HBSP_P-D Product feature CHAIN GQ183473_HBSP_P-D of FT:mat_peptide GQ183473_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4601). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183474_HBSP_P-D Product feature CHAIN GQ183474_HBSP_P-D of FT:mat_peptide GQ183474_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4594). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183475_HBSP_P-D Product feature CHAIN GQ183475_HBSP_P-D of FT:mat_peptide GQ183475_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4575). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEKLPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183476_HBSP_P-D Product feature CHAIN GQ183476_HBSP_P-D of FT:mat_peptide GQ183476_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4603). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183477_HBSP_P-D Product feature CHAIN GQ183477_HBSP_P-D of FT:mat_peptide GQ183477_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4604). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARQLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183478_HBSP_P-D Product feature CHAIN GQ183478_HBSP_P-D of FT:mat_peptide GQ183478_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4605). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183479_HBSP_P-D Product feature CHAIN GQ183479_HBSP_P-D of FT:mat_peptide GQ183479_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4607). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183480_HBSP_P-D Product feature CHAIN GQ183480_HBSP_P-D of FT:mat_peptide GQ183480_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4609). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKDPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183481_HBSP_P-D Product feature CHAIN GQ183481_HBSP_P-D of FT:mat_peptide GQ183481_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4569). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLFKEPLCIPLVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183482_HBSP_P-D Product feature CHAIN GQ183482_HBSP_P-D of FT:mat_peptide GQ183482_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4570). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183483_HBSP_P-D Product feature CHAIN GQ183483_HBSP_P-D of FT:mat_peptide GQ183483_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4566). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183484_HBSP_P-D Product feature CHAIN GQ183484_HBSP_P-D of FT:mat_peptide GQ183484_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4598). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ183485_HBSP_P-D Product feature CHAIN GQ183485_HBSP_P-D of FT:mat_peptide GQ183485_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4599). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ184322_HBSP_P-D Product feature CHAIN GQ184322_HBSP_P-D of FT:mat_peptide GQ184322_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4522). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLDRRVAEDLNLGTLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ205380_HBSP_P-D Product feature CHAIN GQ205380_HBSP_P-D of FT:mat_peptide GQ205380_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1245). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQPPARDHAEPARLLLTEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|GQ377589_HBSP_P-D Product feature CHAIN GQ377589_HBSP_P-D of FT:mat_peptide GQ377589_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate J145). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ477452_HBSP_P-D Product feature CHAIN GQ477452_HBSP_P-D of FT:mat_peptide GQ477452_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ477453_HBSP_P-D Product feature CHAIN GQ477453_HBSP_P-D of FT:mat_peptide GQ477453_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P39). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLGTPNDLPPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHRPGLSENSYGNGPQPVSPGSVY
>gnl|hbvpro|GQ477454_HBSP_P-D Product feature CHAIN GQ477454_HBSP_P-D of FT:mat_peptide GQ477454_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P68). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=112 residues).
MPLSYQHFRNVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPAREHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPFSVHY
>gnl|hbvpro|GQ477455_HBSP_P-D Product feature CHAIN GQ477455_HBSP_P-D of FT:mat_peptide GQ477455_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P73). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ477456_HBSP_P-D Product feature CHAIN GQ477456_HBSP_P-D of FT:mat_peptide GQ477456_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P84). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADQDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ477457_HBSP_P-D Product feature CHAIN GQ477457_HBSP_P-D of FT:mat_peptide GQ477457_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P118). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ477458_HBSP_P-D Product feature CHAIN GQ477458_HBSP_P-D of FT:mat_peptide GQ477458_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P126). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVSNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ477459_HBSP_P-D Product feature CHAIN GQ477459_HBSP_P-D of FT:mat_peptide GQ477459_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P127). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ922000_HBSP_P-D Product feature CHAIN GQ922000_HBSP_P-D of FT:mat_peptide GQ922000_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3552). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNPNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ922001_HBSP_P-D Product feature CHAIN GQ922001_HBSP_P-D of FT:mat_peptide GQ922001_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3654). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ922002_HBSP_P-D Product feature CHAIN GQ922002_HBSP_P-D of FT:mat_peptide GQ922002_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3624). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GQ922003_HBSP_P-D Product feature CHAIN GQ922003_HBSP_P-D of FT:mat_peptide GQ922003_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3225). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|GQ922004_HBSP_P-D Product feature CHAIN GQ922004_HBSP_P-D of FT:mat_peptide GQ922004_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3284). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|GQ922005_HBSP_P-D Product feature CHAIN GQ922005_HBSP_P-D of FT:mat_peptide GQ922005_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B2894). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLNDHRPPARDPAEPARLLLKEPLCIPLVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|GQ924652_HBSP_P-D Product feature CHAIN GQ924652_HBSP_P-D of FT:mat_peptide GQ924652_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M89). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU357846_HBSP_P-D Product feature CHAIN GU357846_HBSP_P-D of FT:mat_peptide GU357846_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456635_HBSP_P-D Product feature CHAIN GU456635_HBSP_P-D of FT:mat_peptide GU456635_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456636_HBSP_P-D Product feature CHAIN GU456636_HBSP_P-D of FT:mat_peptide GU456636_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456637_HBSP_P-D Product feature CHAIN GU456637_HBSP_P-D of FT:mat_peptide GU456637_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T49). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSCQHFRRLVLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHRPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456638_HBSP_P-D Product feature CHAIN GU456638_HBSP_P-D of FT:mat_peptide GU456638_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGNGPQPVSLGSVY
>gnl|hbvpro|GU456639_HBSP_P-D Product feature CHAIN GU456639_HBSP_P-D of FT:mat_peptide GU456639_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T129). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPIEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456640_HBSP_P-D Product feature CHAIN GU456640_HBSP_P-D of FT:mat_peptide GU456640_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456641_HBSP_P-D Product feature CHAIN GU456641_HBSP_P-D of FT:mat_peptide GU456641_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQLPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456642_HBSP_P-D Product feature CHAIN GU456642_HBSP_P-D of FT:mat_peptide GU456642_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T70). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456643_HBSP_P-D Product feature CHAIN GU456643_HBSP_P-D of FT:mat_peptide GU456643_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T52). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSIY
>gnl|hbvpro|GU456644_HBSP_P-D Product feature CHAIN GU456644_HBSP_P-D of FT:mat_peptide GU456644_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T58). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456645_HBSP_P-D Product feature CHAIN GU456645_HBSP_P-D of FT:mat_peptide GU456645_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T80). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQRPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456646_HBSP_P-D Product feature CHAIN GU456646_HBSP_P-D of FT:mat_peptide GU456646_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T77). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456647_HBSP_P-D Product feature CHAIN GU456647_HBSP_P-D of FT:mat_peptide GU456647_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T130). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDVNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456648_HBSP_P-D Product feature CHAIN GU456648_HBSP_P-D of FT:mat_peptide GU456648_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T85). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456649_HBSP_P-D Product feature CHAIN GU456649_HBSP_P-D of FT:mat_peptide GU456649_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T57). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456650_HBSP_P-D Product feature CHAIN GU456650_HBSP_P-D of FT:mat_peptide GU456650_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T62). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456651_HBSP_P-D Product feature CHAIN GU456651_HBSP_P-D of FT:mat_peptide GU456651_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDLQLPARDHAELARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456652_HBSP_P-D Product feature CHAIN GU456652_HBSP_P-D of FT:mat_peptide GU456652_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456653_HBSP_P-D Product feature CHAIN GU456653_HBSP_P-D of FT:mat_peptide GU456653_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T59). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456654_HBSP_P-D Product feature CHAIN GU456654_HBSP_P-D of FT:mat_peptide GU456654_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T39). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTPNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456655_HBSP_P-D Product feature CHAIN GU456655_HBSP_P-D of FT:mat_peptide GU456655_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T95). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456656_HBSP_P-D Product feature CHAIN GU456656_HBSP_P-D of FT:mat_peptide GU456656_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDESGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456657_HBSP_P-D Product feature CHAIN GU456657_HBSP_P-D of FT:mat_peptide GU456657_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T83). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQPPARDHAKPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456658_HBSP_P-D Product feature CHAIN GU456658_HBSP_P-D of FT:mat_peptide GU456658_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T114). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456659_HBSP_P-D Product feature CHAIN GU456659_HBSP_P-D of FT:mat_peptide GU456659_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456660_HBSP_P-D Product feature CHAIN GU456660_HBSP_P-D of FT:mat_peptide GU456660_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T64). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456661_HBSP_P-D Product feature CHAIN GU456661_HBSP_P-D of FT:mat_peptide GU456661_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T99). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456662_HBSP_P-D Product feature CHAIN GU456662_HBSP_P-D of FT:mat_peptide GU456662_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T23). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456663_HBSP_P-D Product feature CHAIN GU456663_HBSP_P-D of FT:mat_peptide GU456663_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T86). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456664_HBSP_P-D Product feature CHAIN GU456664_HBSP_P-D of FT:mat_peptide GU456664_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456665_HBSP_P-D Product feature CHAIN GU456665_HBSP_P-D of FT:mat_peptide GU456665_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T76). Complete genome. [Hepadnaviridae] (length=112 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAELARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVYW
>gnl|hbvpro|GU456666_HBSP_P-D Product feature CHAIN GU456666_HBSP_P-D of FT:mat_peptide GU456666_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAELARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456667_HBSP_P-D Product feature CHAIN GU456667_HBSP_P-D of FT:mat_peptide GU456667_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T120). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456668_HBSP_P-D Product feature CHAIN GU456668_HBSP_P-D of FT:mat_peptide GU456668_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYRHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456669_HBSP_P-D Product feature CHAIN GU456669_HBSP_P-D of FT:mat_peptide GU456669_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T94). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDPDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456670_HBSP_P-D Product feature CHAIN GU456670_HBSP_P-D of FT:mat_peptide GU456670_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456671_HBSP_P-D Product feature CHAIN GU456671_HBSP_P-D of FT:mat_peptide GU456671_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T56). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456672_HBSP_P-D Product feature CHAIN GU456672_HBSP_P-D of FT:mat_peptide GU456672_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T73). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGVSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456673_HBSP_P-D Product feature CHAIN GU456673_HBSP_P-D of FT:mat_peptide GU456673_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T75). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456674_HBSP_P-D Product feature CHAIN GU456674_HBSP_P-D of FT:mat_peptide GU456674_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEDELPRLADEDLNRRIAEDLNLGDLNDLQQPARDHAEPARLLLKEPLCIPHVAVQNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456675_HBSP_P-D Product feature CHAIN GU456675_HBSP_P-D of FT:mat_peptide GU456675_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|GU456676_HBSP_P-D Product feature CHAIN GU456676_HBSP_P-D of FT:mat_peptide GU456676_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T98). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456677_HBSP_P-D Product feature CHAIN GU456677_HBSP_P-D of FT:mat_peptide GU456677_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T46). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456678_HBSP_P-D Product feature CHAIN GU456678_HBSP_P-D of FT:mat_peptide GU456678_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T97). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNGLRPPARNSAEPARLLLKEPLCISPVAVQNLRE
EIAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456679_HBSP_P-D Product feature CHAIN GU456679_HBSP_P-D of FT:mat_peptide GU456679_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T63). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456680_HBSP_P-D Product feature CHAIN GU456680_HBSP_P-D of FT:mat_peptide GU456680_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T88). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456681_HBSP_P-D Product feature CHAIN GU456681_HBSP_P-D of FT:mat_peptide GU456681_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T79). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456683_HBSP_P-D Product feature CHAIN GU456683_HBSP_P-D of FT:mat_peptide GU456683_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T101). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|GU456684_HBSP_P-D Product feature CHAIN GU456684_HBSP_P-D of FT:mat_peptide GU456684_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T60). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPQARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HM750151_HBSP_P-D Product feature CHAIN HM750151_HBSP_P-D of FT:mat_peptide HM750151_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSD-8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HM750152_HBSP_P-D Product feature CHAIN HM750152_HBSP_P-D of FT:mat_peptide HM750152_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate QHN-99). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEKELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HM750153_HBSP_P-D Product feature CHAIN HM750153_HBSP_P-D of FT:mat_peptide HM750153_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJW-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HM750154_HBSP_P-D Product feature CHAIN HM750154_HBSP_P-D of FT:mat_peptide HM750154_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XGW-23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPLVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HM750155_HBSP_P-D Product feature CHAIN HM750155_HBSP_P-D of FT:mat_peptide HM750155_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARVPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HM750156_HBSP_P-D Product feature CHAIN HM750156_HBSP_P-D of FT:mat_peptide HM750156_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARVPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ236014_HBSP_P-D Product feature CHAIN HQ236014_HBSP_P-D of FT:mat_peptide HQ236014_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ236015_HBSP_P-D Product feature CHAIN HQ236015_HBSP_P-D of FT:mat_peptide HQ236015_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ236016_HBSP_P-D Product feature CHAIN HQ236016_HBSP_P-D of FT:mat_peptide HQ236016_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700439_HBSP_P-D Product feature CHAIN HQ700439_HBSP_P-D of FT:mat_peptide HQ700439_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AD03_1999). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700440_HBSP_P-D Product feature CHAIN HQ700440_HBSP_P-D of FT:mat_peptide HQ700440_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AD05_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700441_HBSP_P-D Product feature CHAIN HQ700441_HBSP_P-D of FT:mat_peptide HQ700441_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN10_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700442_HBSP_P-D Product feature CHAIN HQ700442_HBSP_P-D of FT:mat_peptide HQ700442_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700443_HBSP_P-D Product feature CHAIN HQ700443_HBSP_P-D of FT:mat_peptide HQ700443_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1999). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700444_HBSP_P-D Product feature CHAIN HQ700444_HBSP_P-D of FT:mat_peptide HQ700444_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN19_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700445_HBSP_P-D Product feature CHAIN HQ700445_HBSP_P-D of FT:mat_peptide HQ700445_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700446_HBSP_P-D Product feature CHAIN HQ700446_HBSP_P-D of FT:mat_peptide HQ700446_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1999). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700447_HBSP_P-D Product feature CHAIN HQ700447_HBSP_P-D of FT:mat_peptide HQ700447_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700448_HBSP_P-D Product feature CHAIN HQ700448_HBSP_P-D of FT:mat_peptide HQ700448_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1999). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700449_HBSP_P-D Product feature CHAIN HQ700449_HBSP_P-D of FT:mat_peptide HQ700449_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE06_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700450_HBSP_P-D Product feature CHAIN HQ700450_HBSP_P-D of FT:mat_peptide HQ700450_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE09_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700451_HBSP_P-D Product feature CHAIN HQ700451_HBSP_P-D of FT:mat_peptide HQ700451_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GI11_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700454_HBSP_P-D Product feature CHAIN HQ700454_HBSP_P-D of FT:mat_peptide HQ700454_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700455_HBSP_P-D Product feature CHAIN HQ700455_HBSP_P-D of FT:mat_peptide HQ700455_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1999). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLAXEGXNXRVAKDXNXGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700458_HBSP_P-D Product feature CHAIN HQ700458_HBSP_P-D of FT:mat_peptide HQ700458_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE35_1997). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHRPQARDPAEPARLLLKEPLCIPPVVVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|HQ700459_HBSP_P-D Product feature CHAIN HQ700459_HBSP_P-D of FT:mat_peptide HQ700459_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE55_1993). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700463_HBSP_P-D Product feature CHAIN HQ700463_HBSP_P-D of FT:mat_peptide HQ700463_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HI43_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700464_HBSP_P-D Product feature CHAIN HQ700464_HBSP_P-D of FT:mat_peptide HQ700464_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_KA40_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700466_HBSP_P-D Product feature CHAIN HQ700466_HBSP_P-D of FT:mat_peptide HQ700466_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700467_HBSP_P-D Product feature CHAIN HQ700467_HBSP_P-D of FT:mat_peptide HQ700467_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1999). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700468_HBSP_P-D Product feature CHAIN HQ700468_HBSP_P-D of FT:mat_peptide HQ700468_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI27_1984). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700469_HBSP_P-D Product feature CHAIN HQ700469_HBSP_P-D of FT:mat_peptide HQ700469_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700470_HBSP_P-D Product feature CHAIN HQ700470_HBSP_P-D of FT:mat_peptide HQ700470_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1999). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700471_HBSP_P-D Product feature CHAIN HQ700471_HBSP_P-D of FT:mat_peptide HQ700471_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO70_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700472_HBSP_P-D Product feature CHAIN HQ700472_HBSP_P-D of FT:mat_peptide HQ700472_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO77_1997). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700473_HBSP_P-D Product feature CHAIN HQ700473_HBSP_P-D of FT:mat_peptide HQ700473_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700474_HBSP_P-D Product feature CHAIN HQ700474_HBSP_P-D of FT:mat_peptide HQ700474_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1999). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYHHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700477_HBSP_P-D Product feature CHAIN HQ700477_HBSP_P-D of FT:mat_peptide HQ700477_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1984). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700478_HBSP_P-D Product feature CHAIN HQ700478_HBSP_P-D of FT:mat_peptide HQ700478_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1994). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKTTLCIPHVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700479_HBSP_P-D Product feature CHAIN HQ700479_HBSP_P-D of FT:mat_peptide HQ700479_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA11_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700480_HBSP_P-D Product feature CHAIN HQ700480_HBSP_P-D of FT:mat_peptide HQ700480_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700481_HBSP_P-D Product feature CHAIN HQ700481_HBSP_P-D of FT:mat_peptide HQ700481_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1999). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVSNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700482_HBSP_P-D Product feature CHAIN HQ700482_HBSP_P-D of FT:mat_peptide HQ700482_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA40_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700483_HBSP_P-D Product feature CHAIN HQ700483_HBSP_P-D of FT:mat_peptide HQ700483_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA120_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700484_HBSP_P-D Product feature CHAIN HQ700484_HBSP_P-D of FT:mat_peptide HQ700484_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA229_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700487_HBSP_P-D Product feature CHAIN HQ700487_HBSP_P-D of FT:mat_peptide HQ700487_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TU25_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700488_HBSP_P-D Product feature CHAIN HQ700488_HBSP_P-D of FT:mat_peptide HQ700488_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1984). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700489_HBSP_P-D Product feature CHAIN HQ700489_HBSP_P-D of FT:mat_peptide HQ700489_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1999). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700510_HBSP_P-D Product feature CHAIN HQ700510_HBSP_P-D of FT:mat_peptide HQ700510_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_128225_2003). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700511_HBSP_P-D Product feature CHAIN HQ700511_HBSP_P-D of FT:mat_peptide HQ700511_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_164317_2001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700512_HBSP_P-D Product feature CHAIN HQ700512_HBSP_P-D of FT:mat_peptide HQ700512_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_182089_2001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700513_HBSP_P-D Product feature CHAIN HQ700513_HBSP_P-D of FT:mat_peptide HQ700513_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_16600_2001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700514_HBSP_P-D Product feature CHAIN HQ700514_HBSP_P-D of FT:mat_peptide HQ700514_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_1664337_2001). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ700553_HBSP_P-D Product feature CHAIN HQ700553_HBSP_P-D of FT:mat_peptide HQ700553_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1999). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKTTLCIPHVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ833465_HBSP_P-D Product feature CHAIN HQ833465_HBSP_P-D of FT:mat_peptide HQ833465_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQSVSPGSVY
>gnl|hbvpro|HQ833466_HBSP_P-D Product feature CHAIN HQ833466_HBSP_P-D of FT:mat_peptide HQ833466_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB26). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVXNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ833467_HBSP_P-D Product feature CHAIN HQ833467_HBSP_P-D of FT:mat_peptide HQ833467_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVXNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ833468_HBSP_P-D Product feature CHAIN HQ833468_HBSP_P-D of FT:mat_peptide HQ833468_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB52). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQPPARDPAEPARLLLKEPLCIPPVAVQNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ833469_HBSP_P-D Product feature CHAIN HQ833469_HBSP_P-D of FT:mat_peptide HQ833469_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB79). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ833470_HBSP_P-D Product feature CHAIN HQ833470_HBSP_P-D of FT:mat_peptide HQ833470_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB80). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|HQ833471_HBSP_P-D Product feature CHAIN HQ833471_HBSP_P-D of FT:mat_peptide HQ833471_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB97). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754588_HBSP_P-D Product feature CHAIN JF754588_HBSP_P-D of FT:mat_peptide JF754588_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK61). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARPLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754590_HBSP_P-D Product feature CHAIN JF754590_HBSP_P-D of FT:mat_peptide JF754590_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK41). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754591_HBSP_P-D Product feature CHAIN JF754591_HBSP_P-D of FT:mat_peptide JF754591_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQLPARDHAEPARLLHKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754592_HBSP_P-D Product feature CHAIN JF754592_HBSP_P-D of FT:mat_peptide JF754592_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK64). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754593_HBSP_P-D Product feature CHAIN JF754593_HBSP_P-D of FT:mat_peptide JF754593_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK170). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSAY
>gnl|hbvpro|JF754594_HBSP_P-D Product feature CHAIN JF754594_HBSP_P-D of FT:mat_peptide JF754594_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK165). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754595_HBSP_P-D Product feature CHAIN JF754595_HBSP_P-D of FT:mat_peptide JF754595_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK164). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754596_HBSP_P-D Product feature CHAIN JF754596_HBSP_P-D of FT:mat_peptide JF754596_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK106). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754597_HBSP_P-D Product feature CHAIN JF754597_HBSP_P-D of FT:mat_peptide JF754597_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK105). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754598_HBSP_P-D Product feature CHAIN JF754598_HBSP_P-D of FT:mat_peptide JF754598_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK104). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754599_HBSP_P-D Product feature CHAIN JF754599_HBSP_P-D of FT:mat_peptide JF754599_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK173). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIHPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754600_HBSP_P-D Product feature CHAIN JF754600_HBSP_P-D of FT:mat_peptide JF754600_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK91). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754601_HBSP_P-D Product feature CHAIN JF754601_HBSP_P-D of FT:mat_peptide JF754601_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK88). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754602_HBSP_P-D Product feature CHAIN JF754602_HBSP_P-D of FT:mat_peptide JF754602_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK83). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDHEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQLPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754603_HBSP_P-D Product feature CHAIN JF754603_HBSP_P-D of FT:mat_peptide JF754603_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK8). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754604_HBSP_P-D Product feature CHAIN JF754604_HBSP_P-D of FT:mat_peptide JF754604_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK79). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754605_HBSP_P-D Product feature CHAIN JF754605_HBSP_P-D of FT:mat_peptide JF754605_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK77). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754606_HBSP_P-D Product feature CHAIN JF754606_HBSP_P-D of FT:mat_peptide JF754606_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK73). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754607_HBSP_P-D Product feature CHAIN JF754607_HBSP_P-D of FT:mat_peptide JF754607_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK67). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQLPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754608_HBSP_P-D Product feature CHAIN JF754608_HBSP_P-D of FT:mat_peptide JF754608_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK63). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754609_HBSP_P-D Product feature CHAIN JF754609_HBSP_P-D of FT:mat_peptide JF754609_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK45). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754610_HBSP_P-D Product feature CHAIN JF754610_HBSP_P-D of FT:mat_peptide JF754610_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK157). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754611_HBSP_P-D Product feature CHAIN JF754611_HBSP_P-D of FT:mat_peptide JF754611_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK152). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRLPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JF754612_HBSP_P-D Product feature CHAIN JF754612_HBSP_P-D of FT:mat_peptide JF754612_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK148). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNRRVADDLNLGTLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754615_HBSP_P-D Product feature CHAIN JF754615_HBSP_P-D of FT:mat_peptide JF754615_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK141). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754617_HBSP_P-D Product feature CHAIN JF754617_HBSP_P-D of FT:mat_peptide JF754617_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK131). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754619_HBSP_P-D Product feature CHAIN JF754619_HBSP_P-D of FT:mat_peptide JF754619_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK62). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQPPARDHAEHARLLLKEPLCIPPVAVQNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754621_HBSP_P-D Product feature CHAIN JF754621_HBSP_P-D of FT:mat_peptide JF754621_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK161). Non-functional genomic sequence. [Hepadnaviridae] (length=112 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVYX
>gnl|hbvpro|JF754622_HBSP_P-D Product feature CHAIN JF754622_HBSP_P-D of FT:mat_peptide JF754622_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK16). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754623_HBSP_P-D Product feature CHAIN JF754623_HBSP_P-D of FT:mat_peptide JF754623_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK171). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIHPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754624_HBSP_P-D Product feature CHAIN JF754624_HBSP_P-D of FT:mat_peptide JF754624_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JF754626_HBSP_P-D Product feature CHAIN JF754626_HBSP_P-D of FT:mat_peptide JF754626_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754627_HBSP_P-D Product feature CHAIN JF754627_HBSP_P-D of FT:mat_peptide JF754627_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754628_HBSP_P-D Product feature CHAIN JF754628_HBSP_P-D of FT:mat_peptide JF754628_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754629_HBSP_P-D Product feature CHAIN JF754629_HBSP_P-D of FT:mat_peptide JF754629_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK176). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVVVSNLRT
EIAPVFPSHHPGLSQNSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754630_HBSP_P-D Product feature CHAIN JF754630_HBSP_P-D of FT:mat_peptide JF754630_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK175). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSCQHFRRLLLLDNESGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIALVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754631_HBSP_P-D Product feature CHAIN JF754631_HBSP_P-D of FT:mat_peptide JF754631_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK193). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQPPARDHAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754632_HBSP_P-D Product feature CHAIN JF754632_HBSP_P-D of FT:mat_peptide JF754632_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK186). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQLPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754633_HBSP_P-D Product feature CHAIN JF754633_HBSP_P-D of FT:mat_peptide JF754633_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK128). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754634_HBSP_P-D Product feature CHAIN JF754634_HBSP_P-D of FT:mat_peptide JF754634_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JF754635_HBSP_P-D Product feature CHAIN JF754635_HBSP_P-D of FT:mat_peptide JF754635_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK113). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040750_HBSP_P-D Product feature CHAIN JN040750_HBSP_P-D of FT:mat_peptide JN040750_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919078). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPAWDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040751_HBSP_P-D Product feature CHAIN JN040751_HBSP_P-D of FT:mat_peptide JN040751_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919047). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040752_HBSP_P-D Product feature CHAIN JN040752_HBSP_P-D of FT:mat_peptide JN040752_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919033). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQSFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040754_HBSP_P-D Product feature CHAIN JN040754_HBSP_P-D of FT:mat_peptide JN040754_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919045). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040755_HBSP_P-D Product feature CHAIN JN040755_HBSP_P-D of FT:mat_peptide JN040755_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919086). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDPQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040756_HBSP_P-D Product feature CHAIN JN040756_HBSP_P-D of FT:mat_peptide JN040756_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919039). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHRPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040757_HBSP_P-D Product feature CHAIN JN040757_HBSP_P-D of FT:mat_peptide JN040757_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919056). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARPLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040758_HBSP_P-D Product feature CHAIN JN040758_HBSP_P-D of FT:mat_peptide JN040758_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919037). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040759_HBSP_P-D Product feature CHAIN JN040759_HBSP_P-D of FT:mat_peptide JN040759_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919063). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040760_HBSP_P-D Product feature CHAIN JN040760_HBSP_P-D of FT:mat_peptide JN040760_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919059). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040761_HBSP_P-D Product feature CHAIN JN040761_HBSP_P-D of FT:mat_peptide JN040761_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919002). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040762_HBSP_P-D Product feature CHAIN JN040762_HBSP_P-D of FT:mat_peptide JN040762_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919007). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040765_HBSP_P-D Product feature CHAIN JN040765_HBSP_P-D of FT:mat_peptide JN040765_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919006). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQYFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040766_HBSP_P-D Product feature CHAIN JN040766_HBSP_P-D of FT:mat_peptide JN040766_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919046). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRLVAEDLNLGKLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVPPGSVY
>gnl|hbvpro|JN040767_HBSP_P-D Product feature CHAIN JN040767_HBSP_P-D of FT:mat_peptide JN040767_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919019). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGHLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JN040768_HBSP_P-D Product feature CHAIN JN040768_HBSP_P-D of FT:mat_peptide JN040768_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919051). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JN040769_HBSP_P-D Product feature CHAIN JN040769_HBSP_P-D of FT:mat_peptide JN040769_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919015). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040770_HBSP_P-D Product feature CHAIN JN040770_HBSP_P-D of FT:mat_peptide JN040770_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919087). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040771_HBSP_P-D Product feature CHAIN JN040771_HBSP_P-D of FT:mat_peptide JN040771_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919013). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040772_HBSP_P-D Product feature CHAIN JN040772_HBSP_P-D of FT:mat_peptide JN040772_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919065). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGNLNDHQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040773_HBSP_P-D Product feature CHAIN JN040773_HBSP_P-D of FT:mat_peptide JN040773_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919084). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JN040774_HBSP_P-D Product feature CHAIN JN040774_HBSP_P-D of FT:mat_peptide JN040774_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919088). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040775_HBSP_P-D Product feature CHAIN JN040775_HBSP_P-D of FT:mat_peptide JN040775_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919049). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGIGPQPVSHGSVY
>gnl|hbvpro|JN040776_HBSP_P-D Product feature CHAIN JN040776_HBSP_P-D of FT:mat_peptide JN040776_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919043). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040777_HBSP_P-D Product feature CHAIN JN040777_HBSP_P-D of FT:mat_peptide JN040777_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919017). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKTPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040778_HBSP_P-D Product feature CHAIN JN040778_HBSP_P-D of FT:mat_peptide JN040778_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919038). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADAGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040779_HBSP_P-D Product feature CHAIN JN040779_HBSP_P-D of FT:mat_peptide JN040779_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919070). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040780_HBSP_P-D Product feature CHAIN JN040780_HBSP_P-D of FT:mat_peptide JN040780_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919072). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040781_HBSP_P-D Product feature CHAIN JN040781_HBSP_P-D of FT:mat_peptide JN040781_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919029). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040782_HBSP_P-D Product feature CHAIN JN040782_HBSP_P-D of FT:mat_peptide JN040782_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919041). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPDDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040783_HBSP_P-D Product feature CHAIN JN040783_HBSP_P-D of FT:mat_peptide JN040783_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919090). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040784_HBSP_P-D Product feature CHAIN JN040784_HBSP_P-D of FT:mat_peptide JN040784_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919030). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGIGPQPVSHGSVY
>gnl|hbvpro|JN040785_HBSP_P-D Product feature CHAIN JN040785_HBSP_P-D of FT:mat_peptide JN040785_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919022). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040786_HBSP_P-D Product feature CHAIN JN040786_HBSP_P-D of FT:mat_peptide JN040786_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919035). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040788_HBSP_P-D Product feature CHAIN JN040788_HBSP_P-D of FT:mat_peptide JN040788_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919024). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLEEPLCLPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040790_HBSP_P-D Product feature CHAIN JN040790_HBSP_P-D of FT:mat_peptide JN040790_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919054). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSIY
>gnl|hbvpro|JN040791_HBSP_P-D Product feature CHAIN JN040791_HBSP_P-D of FT:mat_peptide JN040791_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919082). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040792_HBSP_P-D Product feature CHAIN JN040792_HBSP_P-D of FT:mat_peptide JN040792_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919079). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040793_HBSP_P-D Product feature CHAIN JN040793_HBSP_P-D of FT:mat_peptide JN040793_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919083). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040794_HBSP_P-D Product feature CHAIN JN040794_HBSP_P-D of FT:mat_peptide JN040794_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919075). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040795_HBSP_P-D Product feature CHAIN JN040795_HBSP_P-D of FT:mat_peptide JN040795_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919003). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040796_HBSP_P-D Product feature CHAIN JN040796_HBSP_P-D of FT:mat_peptide JN040796_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919018). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRSVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040797_HBSP_P-D Product feature CHAIN JN040797_HBSP_P-D of FT:mat_peptide JN040797_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919021). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040799_HBSP_P-D Product feature CHAIN JN040799_HBSP_P-D of FT:mat_peptide JN040799_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919080). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040800_HBSP_P-D Product feature CHAIN JN040800_HBSP_P-D of FT:mat_peptide JN040800_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919012). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040801_HBSP_P-D Product feature CHAIN JN040801_HBSP_P-D of FT:mat_peptide JN040801_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919042). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040802_HBSP_P-D Product feature CHAIN JN040802_HBSP_P-D of FT:mat_peptide JN040802_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919074). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQLPVRDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040804_HBSP_P-D Product feature CHAIN JN040804_HBSP_P-D of FT:mat_peptide JN040804_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919028). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=110 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNLQIPARDHAEPARLLLKEPLRIPPVAVPNLRTE
IAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JN040805_HBSP_P-D Product feature CHAIN JN040805_HBSP_P-D of FT:mat_peptide JN040805_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919058). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040806_HBSP_P-D Product feature CHAIN JN040806_HBSP_P-D of FT:mat_peptide JN040806_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919066). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDETGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040807_HBSP_P-D Product feature CHAIN JN040807_HBSP_P-D of FT:mat_peptide JN040807_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919034). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGVSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040808_HBSP_P-D Product feature CHAIN JN040808_HBSP_P-D of FT:mat_peptide JN040808_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919011). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRIAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040809_HBSP_P-D Product feature CHAIN JN040809_HBSP_P-D of FT:mat_peptide JN040809_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919014). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040810_HBSP_P-D Product feature CHAIN JN040810_HBSP_P-D of FT:mat_peptide JN040810_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919060). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPAAVQNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040811_HBSP_P-D Product feature CHAIN JN040811_HBSP_P-D of FT:mat_peptide JN040811_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919048). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040812_HBSP_P-D Product feature CHAIN JN040812_HBSP_P-D of FT:mat_peptide JN040812_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919027). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQQPARDHAELARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040813_HBSP_P-D Product feature CHAIN JN040813_HBSP_P-D of FT:mat_peptide JN040813_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919025). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040814_HBSP_P-D Product feature CHAIN JN040814_HBSP_P-D of FT:mat_peptide JN040814_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919032). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGGGPQPVSHGSVY
>gnl|hbvpro|JN040815_HBSP_P-D Product feature CHAIN JN040815_HBSP_P-D of FT:mat_peptide JN040815_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919073). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVSNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040816_HBSP_P-D Product feature CHAIN JN040816_HBSP_P-D of FT:mat_peptide JN040816_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919016). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVSNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040817_HBSP_P-D Product feature CHAIN JN040817_HBSP_P-D of FT:mat_peptide JN040817_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919020). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVSNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040818_HBSP_P-D Product feature CHAIN JN040818_HBSP_P-D of FT:mat_peptide JN040818_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919081). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQQPARDHAGPAPLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040819_HBSP_P-D Product feature CHAIN JN040819_HBSP_P-D of FT:mat_peptide JN040819_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919067). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040820_HBSP_P-D Product feature CHAIN JN040820_HBSP_P-D of FT:mat_peptide JN040820_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919010). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQLPARDHAEPARLLLKEPLCIPPVAVSNLRT
EIAPVFPSHHPGLSENSYGTGPQPVSHGSVY
>gnl|hbvpro|JN040821_HBSP_P-D Product feature CHAIN JN040821_HBSP_P-D of FT:mat_peptide JN040821_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919085). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040822_HBSP_P-D Product feature CHAIN JN040822_HBSP_P-D of FT:mat_peptide JN040822_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919044). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVF
>gnl|hbvpro|JN040823_HBSP_P-D Product feature CHAIN JN040823_HBSP_P-D of FT:mat_peptide JN040823_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919005). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040824_HBSP_P-D Product feature CHAIN JN040824_HBSP_P-D of FT:mat_peptide JN040824_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919071). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040826_HBSP_P-D Product feature CHAIN JN040826_HBSP_P-D of FT:mat_peptide JN040826_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919055). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JN040827_HBSP_P-D Product feature CHAIN JN040827_HBSP_P-D of FT:mat_peptide JN040827_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919008). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARRLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040828_HBSP_P-D Product feature CHAIN JN040828_HBSP_P-D of FT:mat_peptide JN040828_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919069). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040829_HBSP_P-D Product feature CHAIN JN040829_HBSP_P-D of FT:mat_peptide JN040829_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919089). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN040830_HBSP_P-D Product feature CHAIN JN040830_HBSP_P-D of FT:mat_peptide JN040830_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919052). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257148_HBSP_P-D Product feature CHAIN JN257148_HBSP_P-D of FT:mat_peptide JN257148_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMF). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JN257149_HBSP_P-D Product feature CHAIN JN257149_HBSP_P-D of FT:mat_peptide JN257149_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSFN). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAXPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257150_HBSP_P-D Product feature CHAIN JN257150_HBSP_P-D of FT:mat_peptide JN257150_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABS). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257151_HBSP_P-D Product feature CHAIN JN257151_HBSP_P-D of FT:mat_peptide JN257151_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHHR). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257152_HBSP_P-D Product feature CHAIN JN257152_HBSP_P-D of FT:mat_peptide JN257152_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRJB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257153_HBSP_P-D Product feature CHAIN JN257153_HBSP_P-D of FT:mat_peptide JN257153_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARRLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257155_HBSP_P-D Product feature CHAIN JN257155_HBSP_P-D of FT:mat_peptide JN257155_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJHM1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257159_HBSP_P-D Product feature CHAIN JN257159_HBSP_P-D of FT:mat_peptide JN257159_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMRW). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVXPGSVY
>gnl|hbvpro|JN257160_HBSP_P-D Product feature CHAIN JN257160_HBSP_P-D of FT:mat_peptide JN257160_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHATR1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRXVAXDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257161_HBSP_P-D Product feature CHAIN JN257161_HBSP_P-D of FT:mat_peptide JN257161_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHATR2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRXVAXDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257162_HBSP_P-D Product feature CHAIN JN257162_HBSP_P-D of FT:mat_peptide JN257162_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSDQ). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDXQXPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257163_HBSP_P-D Product feature CHAIN JN257163_HBSP_P-D of FT:mat_peptide JN257163_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAZI). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAKPARLLLKEPLCIPPAAVPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257165_HBSP_P-D Product feature CHAIN JN257165_HBSP_P-D of FT:mat_peptide JN257165_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257166_HBSP_P-D Product feature CHAIN JN257166_HBSP_P-D of FT:mat_peptide JN257166_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL2). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257167_HBSP_P-D Product feature CHAIN JN257167_HBSP_P-D of FT:mat_peptide JN257167_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHMM1). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLXIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257169_HBSP_P-D Product feature CHAIN JN257169_HBSP_P-D of FT:mat_peptide JN257169_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAFF). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257170_HBSP_P-D Product feature CHAIN JN257170_HBSP_P-D of FT:mat_peptide JN257170_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJWB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257171_HBSP_P-D Product feature CHAIN JN257171_HBSP_P-D of FT:mat_peptide JN257171_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKML). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257172_HBSP_P-D Product feature CHAIN JN257172_HBSP_P-D of FT:mat_peptide JN257172_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMYD1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVVVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257173_HBSP_P-D Product feature CHAIN JN257173_HBSP_P-D of FT:mat_peptide JN257173_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMYD2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVVVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257176_HBSP_P-D Product feature CHAIN JN257176_HBSP_P-D of FT:mat_peptide JN257176_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNVNXLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257177_HBSP_P-D Product feature CHAIN JN257177_HBSP_P-D of FT:mat_peptide JN257177_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ2). Complete genome. [Hepadnaviridae] (length=112 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNNINXLQPPARDHAEPARLLLKEPLCIPPVAVPNLR
TEIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257178_HBSP_P-D Product feature CHAIN JN257178_HBSP_P-D of FT:mat_peptide JN257178_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHTRK). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAXDHAEPARLLLKEPLCIPPVAVPNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257179_HBSP_P-D Product feature CHAIN JN257179_HBSP_P-D of FT:mat_peptide JN257179_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMJD1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257182_HBSP_P-D Product feature CHAIN JN257182_HBSP_P-D of FT:mat_peptide JN257182_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMSL). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JN257183_HBSP_P-D Product feature CHAIN JN257183_HBSP_P-D of FT:mat_peptide JN257183_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKSH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257185_HBSP_P-D Product feature CHAIN JN257185_HBSP_P-D of FT:mat_peptide JN257185_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHZYD). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257186_HBSP_P-D Product feature CHAIN JN257186_HBSP_P-D of FT:mat_peptide JN257186_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHDHM). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQRPARXHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JN257187_HBSP_P-D Product feature CHAIN JN257187_HBSP_P-D of FT:mat_peptide JN257187_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL1). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCXPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257188_HBSP_P-D Product feature CHAIN JN257188_HBSP_P-D of FT:mat_peptide JN257188_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCXPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257190_HBSP_P-D Product feature CHAIN JN257190_HBSP_P-D of FT:mat_peptide JN257190_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHYHY). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNLRVAEDLNLGNLNDLQPPAWDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGXGPQPVSPGSVY
>gnl|hbvpro|JN257193_HBSP_P-D Product feature CHAIN JN257193_HBSP_P-D of FT:mat_peptide JN257193_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257194_HBSP_P-D Product feature CHAIN JN257194_HBSP_P-D of FT:mat_peptide JN257194_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257195_HBSP_P-D Product feature CHAIN JN257195_HBSP_P-D of FT:mat_peptide JN257195_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARRLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257196_HBSP_P-D Product feature CHAIN JN257196_HBSP_P-D of FT:mat_peptide JN257196_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABR1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257199_HBSP_P-D Product feature CHAIN JN257199_HBSP_P-D of FT:mat_peptide JN257199_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSOD2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257200_HBSP_P-D Product feature CHAIN JN257200_HBSP_P-D of FT:mat_peptide JN257200_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMNM). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKESLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVH
>gnl|hbvpro|JN257201_HBSP_P-D Product feature CHAIN JN257201_HBSP_P-D of FT:mat_peptide JN257201_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFAD). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257202_HBSP_P-D Product feature CHAIN JN257202_HBSP_P-D of FT:mat_peptide JN257202_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSLI). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQRPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257203_HBSP_P-D Product feature CHAIN JN257203_HBSP_P-D of FT:mat_peptide JN257203_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJKF). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLEEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVH
>gnl|hbvpro|JN257205_HBSP_P-D Product feature CHAIN JN257205_HBSP_P-D of FT:mat_peptide JN257205_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRYD). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257209_HBSP_P-D Product feature CHAIN JN257209_HBSP_P-D of FT:mat_peptide JN257209_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMR2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257211_HBSP_P-D Product feature CHAIN JN257211_HBSP_P-D of FT:mat_peptide JN257211_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHBRH1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVXNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN257214_HBSP_P-D Product feature CHAIN JN257214_HBSP_P-D of FT:mat_peptide JN257214_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJDR1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLXFPPVAVPNLRT
XIAPVFPSHHPGLSENSYGSGPQPVSXGSVY
>gnl|hbvpro|JN257215_HBSP_P-D Product feature CHAIN JN257215_HBSP_P-D of FT:mat_peptide JN257215_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJDR2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLXFPPVAVPNLRT
XIAPVFPSHHPGLSENSYGSGPQPVSXGSVY
>gnl|hbvpro|JN642126_HBSP_P-D Product feature CHAIN JN642126_HBSP_P-D of FT:mat_peptide JN642126_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642128_HBSP_P-D Product feature CHAIN JN642128_HBSP_P-D of FT:mat_peptide JN642128_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb11). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFPRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAKPARLLHKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGGGSQPVSPGSIY
>gnl|hbvpro|JN642129_HBSP_P-D Product feature CHAIN JN642129_HBSP_P-D of FT:mat_peptide JN642129_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQQPARDHAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642130_HBSP_P-D Product feature CHAIN JN642130_HBSP_P-D of FT:mat_peptide JN642130_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642131_HBSP_P-D Product feature CHAIN JN642131_HBSP_P-D of FT:mat_peptide JN642131_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642132_HBSP_P-D Product feature CHAIN JN642132_HBSP_P-D of FT:mat_peptide JN642132_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642133_HBSP_P-D Product feature CHAIN JN642133_HBSP_P-D of FT:mat_peptide JN642133_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQPPARDHAEPARLLLKETLRIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642134_HBSP_P-D Product feature CHAIN JN642134_HBSP_P-D of FT:mat_peptide JN642134_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDAESGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPAREHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSRHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642135_HBSP_P-D Product feature CHAIN JN642135_HBSP_P-D of FT:mat_peptide JN642135_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNNAGPLEEELPRLADEGLNRRVAEDLSLGNLNDLQPPARDHAGPARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642136_HBSP_P-D Product feature CHAIN JN642136_HBSP_P-D of FT:mat_peptide JN642136_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEHARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642138_HBSP_P-D Product feature CHAIN JN642138_HBSP_P-D of FT:mat_peptide JN642138_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRRPPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSLY
>gnl|hbvpro|JN642140_HBSP_P-D Product feature CHAIN JN642140_HBSP_P-D of FT:mat_peptide JN642140_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642142_HBSP_P-D Product feature CHAIN JN642142_HBSP_P-D of FT:mat_peptide JN642142_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JN642143_HBSP_P-D Product feature CHAIN JN642143_HBSP_P-D of FT:mat_peptide JN642143_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb33). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642144_HBSP_P-D Product feature CHAIN JN642144_HBSP_P-D of FT:mat_peptide JN642144_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642145_HBSP_P-D Product feature CHAIN JN642145_HBSP_P-D of FT:mat_peptide JN642145_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGRHRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642146_HBSP_P-D Product feature CHAIN JN642146_HBSP_P-D of FT:mat_peptide JN642146_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642147_HBSP_P-D Product feature CHAIN JN642147_HBSP_P-D of FT:mat_peptide JN642147_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb39). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFPRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEPARLLLKEPLCIPPAVVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642148_HBSP_P-D Product feature CHAIN JN642148_HBSP_P-D of FT:mat_peptide JN642148_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642149_HBSP_P-D Product feature CHAIN JN642149_HBSP_P-D of FT:mat_peptide JN642149_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb41). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642150_HBSP_P-D Product feature CHAIN JN642150_HBSP_P-D of FT:mat_peptide JN642150_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642151_HBSP_P-D Product feature CHAIN JN642151_HBSP_P-D of FT:mat_peptide JN642151_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642153_HBSP_P-D Product feature CHAIN JN642153_HBSP_P-D of FT:mat_peptide JN642153_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb47). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAKPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642154_HBSP_P-D Product feature CHAIN JN642154_HBSP_P-D of FT:mat_peptide JN642154_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQLPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642155_HBSP_P-D Product feature CHAIN JN642155_HBSP_P-D of FT:mat_peptide JN642155_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb49). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642156_HBSP_P-D Product feature CHAIN JN642156_HBSP_P-D of FT:mat_peptide JN642156_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb50). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642157_HBSP_P-D Product feature CHAIN JN642157_HBSP_P-D of FT:mat_peptide JN642157_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642158_HBSP_P-D Product feature CHAIN JN642158_HBSP_P-D of FT:mat_peptide JN642158_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb57). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPICIPHVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642159_HBSP_P-D Product feature CHAIN JN642159_HBSP_P-D of FT:mat_peptide JN642159_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb52). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642161_HBSP_P-D Product feature CHAIN JN642161_HBSP_P-D of FT:mat_peptide JN642161_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAELARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642162_HBSP_P-D Product feature CHAIN JN642162_HBSP_P-D of FT:mat_peptide JN642162_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb58). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642163_HBSP_P-D Product feature CHAIN JN642163_HBSP_P-D of FT:mat_peptide JN642163_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb59). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642164_HBSP_P-D Product feature CHAIN JN642164_HBSP_P-D of FT:mat_peptide JN642164_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb60). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642165_HBSP_P-D Product feature CHAIN JN642165_HBSP_P-D of FT:mat_peptide JN642165_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPAAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642166_HBSP_P-D Product feature CHAIN JN642166_HBSP_P-D of FT:mat_peptide JN642166_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN642167_HBSP_P-D Product feature CHAIN JN642167_HBSP_P-D of FT:mat_peptide JN642167_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRHVAEELNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664918_HBSP_P-D Product feature CHAIN JN664918_HBSP_P-D of FT:mat_peptide JN664918_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2198_IC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664919_HBSP_P-D Product feature CHAIN JN664919_HBSP_P-D of FT:mat_peptide JN664919_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2320_IC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAKPARLLLTEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664920_HBSP_P-D Product feature CHAIN JN664920_HBSP_P-D of FT:mat_peptide JN664920_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1903_IC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664927_HBSP_P-D Product feature CHAIN JN664927_HBSP_P-D of FT:mat_peptide JN664927_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE20_CHB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JN664928_HBSP_P-D Product feature CHAIN JN664928_HBSP_P-D of FT:mat_peptide JN664928_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE27_CHB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664930_HBSP_P-D Product feature CHAIN JN664930_HBSP_P-D of FT:mat_peptide JN664930_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEN9_CHB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664931_HBSP_P-D Product feature CHAIN JN664931_HBSP_P-D of FT:mat_peptide JN664931_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB6_CHB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664939_HBSP_P-D Product feature CHAIN JN664939_HBSP_P-D of FT:mat_peptide JN664939_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN71_LC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN664941_HBSP_P-D Product feature CHAIN JN664941_HBSP_P-D of FT:mat_peptide JN664941_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB21_LC). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARRLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|JN664948_HBSP_P-D Product feature CHAIN JN664948_HBSP_P-D of FT:mat_peptide JN664948_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN64_LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688678_HBSP_P-D Product feature CHAIN JN688678_HBSP_P-D of FT:mat_peptide JN688678_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV007). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688679_HBSP_P-D Product feature CHAIN JN688679_HBSP_P-D of FT:mat_peptide JN688679_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV010). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688683_HBSP_P-D Product feature CHAIN JN688683_HBSP_P-D of FT:mat_peptide JN688683_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV087). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLNNKAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688685_HBSP_P-D Product feature CHAIN JN688685_HBSP_P-D of FT:mat_peptide JN688685_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV097). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688695_HBSP_P-D Product feature CHAIN JN688695_HBSP_P-D of FT:mat_peptide JN688695_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV128). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPIEEELPRLADEGLNRRVAEDLNLGNLNDPRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688708_HBSP_P-D Product feature CHAIN JN688708_HBSP_P-D of FT:mat_peptide JN688708_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV142). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688710_HBSP_P-D Product feature CHAIN JN688710_HBSP_P-D of FT:mat_peptide JN688710_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV144). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNHRVAEDLNLGDLNDHQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688711_HBSP_P-D Product feature CHAIN JN688711_HBSP_P-D of FT:mat_peptide JN688711_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV161). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPVEEELPRLADEGLNRRVAEELNLGNLNDPQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688712_HBSP_P-D Product feature CHAIN JN688712_HBSP_P-D of FT:mat_peptide JN688712_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV163). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLTLGTLNDPQPPARDHAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHPGLSENSYGGGPQPVSPGSVY
>gnl|hbvpro|JN688713_HBSP_P-D Product feature CHAIN JN688713_HBSP_P-D of FT:mat_peptide JN688713_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV173). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEKAGPLEEELPRLADEGLNRRVAEDLNLGDLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN688722_HBSP_P-D Product feature CHAIN JN688722_HBSP_P-D of FT:mat_peptide JN688722_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV228). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN792903_HBSP_P-D Product feature CHAIN JN792903_HBSP_P-D of FT:mat_peptide JN792903_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 310000127). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN792904_HBSP_P-D Product feature CHAIN JN792904_HBSP_P-D of FT:mat_peptide JN792904_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002943). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAELARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN792906_HBSP_P-D Product feature CHAIN JN792906_HBSP_P-D of FT:mat_peptide JN792906_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002958). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAELARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN792907_HBSP_P-D Product feature CHAIN JN792907_HBSP_P-D of FT:mat_peptide JN792907_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000473). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGNLNDLQPPARDHAGLARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN792908_HBSP_P-D Product feature CHAIN JN792908_HBSP_P-D of FT:mat_peptide JN792908_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002951). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGNLNDLQPPARDHAGLARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN792909_HBSP_P-D Product feature CHAIN JN792909_HBSP_P-D of FT:mat_peptide JN792909_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000479). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN792910_HBSP_P-D Product feature CHAIN JN792910_HBSP_P-D of FT:mat_peptide JN792910_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 109001205). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN792911_HBSP_P-D Product feature CHAIN JN792911_HBSP_P-D of FT:mat_peptide JN792911_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002952). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEQELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JN792912_HBSP_P-D Product feature CHAIN JN792912_HBSP_P-D of FT:mat_peptide JN792912_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 307000449). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEQELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ687530_HBSP_P-D Product feature CHAIN JQ687530_HBSP_P-D of FT:mat_peptide JQ687530_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 200). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLKEELPRLANEDLNRRVAKDLNLGNLNDLQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ687531_HBSP_P-D Product feature CHAIN JQ687531_HBSP_P-D of FT:mat_peptide JQ687531_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 205). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707476_HBSP_P-D Product feature CHAIN JQ707476_HBSP_P-D of FT:mat_peptide JQ707476_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707477_HBSP_P-D Product feature CHAIN JQ707477_HBSP_P-D of FT:mat_peptide JQ707477_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707478_HBSP_P-D Product feature CHAIN JQ707478_HBSP_P-D of FT:mat_peptide JQ707478_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707479_HBSP_P-D Product feature CHAIN JQ707479_HBSP_P-D of FT:mat_peptide JQ707479_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARPLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707480_HBSP_P-D Product feature CHAIN JQ707480_HBSP_P-D of FT:mat_peptide JQ707480_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707481_HBSP_P-D Product feature CHAIN JQ707481_HBSP_P-D of FT:mat_peptide JQ707481_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707482_HBSP_P-D Product feature CHAIN JQ707482_HBSP_P-D of FT:mat_peptide JQ707482_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C17-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707483_HBSP_P-D Product feature CHAIN JQ707483_HBSP_P-D of FT:mat_peptide JQ707483_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707484_HBSP_P-D Product feature CHAIN JQ707484_HBSP_P-D of FT:mat_peptide JQ707484_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C19). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707485_HBSP_P-D Product feature CHAIN JQ707485_HBSP_P-D of FT:mat_peptide JQ707485_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARPLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707486_HBSP_P-D Product feature CHAIN JQ707486_HBSP_P-D of FT:mat_peptide JQ707486_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707487_HBSP_P-D Product feature CHAIN JQ707487_HBSP_P-D of FT:mat_peptide JQ707487_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKELLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707488_HBSP_P-D Product feature CHAIN JQ707488_HBSP_P-D of FT:mat_peptide JQ707488_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707489_HBSP_P-D Product feature CHAIN JQ707489_HBSP_P-D of FT:mat_peptide JQ707489_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707490_HBSP_P-D Product feature CHAIN JQ707490_HBSP_P-D of FT:mat_peptide JQ707490_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAGPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707491_HBSP_P-D Product feature CHAIN JQ707491_HBSP_P-D of FT:mat_peptide JQ707491_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C3). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPVEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707492_HBSP_P-D Product feature CHAIN JQ707492_HBSP_P-D of FT:mat_peptide JQ707492_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C30). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707493_HBSP_P-D Product feature CHAIN JQ707493_HBSP_P-D of FT:mat_peptide JQ707493_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C31). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707494_HBSP_P-D Product feature CHAIN JQ707494_HBSP_P-D of FT:mat_peptide JQ707494_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707495_HBSP_P-D Product feature CHAIN JQ707495_HBSP_P-D of FT:mat_peptide JQ707495_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C33). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707496_HBSP_P-D Product feature CHAIN JQ707496_HBSP_P-D of FT:mat_peptide JQ707496_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C34-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707497_HBSP_P-D Product feature CHAIN JQ707497_HBSP_P-D of FT:mat_peptide JQ707497_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQQFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPFSPGSVY
>gnl|hbvpro|JQ707498_HBSP_P-D Product feature CHAIN JQ707498_HBSP_P-D of FT:mat_peptide JQ707498_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C37). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707499_HBSP_P-D Product feature CHAIN JQ707499_HBSP_P-D of FT:mat_peptide JQ707499_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARPLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707500_HBSP_P-D Product feature CHAIN JQ707500_HBSP_P-D of FT:mat_peptide JQ707500_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707501_HBSP_P-D Product feature CHAIN JQ707501_HBSP_P-D of FT:mat_peptide JQ707501_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C41). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707502_HBSP_P-D Product feature CHAIN JQ707502_HBSP_P-D of FT:mat_peptide JQ707502_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707503_HBSP_P-D Product feature CHAIN JQ707503_HBSP_P-D of FT:mat_peptide JQ707503_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707504_HBSP_P-D Product feature CHAIN JQ707504_HBSP_P-D of FT:mat_peptide JQ707504_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C44). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707505_HBSP_P-D Product feature CHAIN JQ707505_HBSP_P-D of FT:mat_peptide JQ707505_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707506_HBSP_P-D Product feature CHAIN JQ707506_HBSP_P-D of FT:mat_peptide JQ707506_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C46). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707507_HBSP_P-D Product feature CHAIN JQ707507_HBSP_P-D of FT:mat_peptide JQ707507_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707508_HBSP_P-D Product feature CHAIN JQ707508_HBSP_P-D of FT:mat_peptide JQ707508_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707509_HBSP_P-D Product feature CHAIN JQ707509_HBSP_P-D of FT:mat_peptide JQ707509_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707510_HBSP_P-D Product feature CHAIN JQ707510_HBSP_P-D of FT:mat_peptide JQ707510_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGPVY
>gnl|hbvpro|JQ707511_HBSP_P-D Product feature CHAIN JQ707511_HBSP_P-D of FT:mat_peptide JQ707511_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGSQPVSPGSVY
>gnl|hbvpro|JQ707512_HBSP_P-D Product feature CHAIN JQ707512_HBSP_P-D of FT:mat_peptide JQ707512_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C1-22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707513_HBSP_P-D Product feature CHAIN JQ707513_HBSP_P-D of FT:mat_peptide JQ707513_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGIGPQPVSHGSVY
>gnl|hbvpro|JQ707514_HBSP_P-D Product feature CHAIN JQ707514_HBSP_P-D of FT:mat_peptide JQ707514_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707515_HBSP_P-D Product feature CHAIN JQ707515_HBSP_P-D of FT:mat_peptide JQ707515_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707516_HBSP_P-D Product feature CHAIN JQ707516_HBSP_P-D of FT:mat_peptide JQ707516_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707517_HBSP_P-D Product feature CHAIN JQ707517_HBSP_P-D of FT:mat_peptide JQ707517_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGTGPQPVSHGSVY
>gnl|hbvpro|JQ707518_HBSP_P-D Product feature CHAIN JQ707518_HBSP_P-D of FT:mat_peptide JQ707518_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C17-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707519_HBSP_P-D Product feature CHAIN JQ707519_HBSP_P-D of FT:mat_peptide JQ707519_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707520_HBSP_P-D Product feature CHAIN JQ707520_HBSP_P-D of FT:mat_peptide JQ707520_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707521_HBSP_P-D Product feature CHAIN JQ707521_HBSP_P-D of FT:mat_peptide JQ707521_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707522_HBSP_P-D Product feature CHAIN JQ707522_HBSP_P-D of FT:mat_peptide JQ707522_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707523_HBSP_P-D Product feature CHAIN JQ707523_HBSP_P-D of FT:mat_peptide JQ707523_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707524_HBSP_P-D Product feature CHAIN JQ707524_HBSP_P-D of FT:mat_peptide JQ707524_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707525_HBSP_P-D Product feature CHAIN JQ707525_HBSP_P-D of FT:mat_peptide JQ707525_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707526_HBSP_P-D Product feature CHAIN JQ707526_HBSP_P-D of FT:mat_peptide JQ707526_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707527_HBSP_P-D Product feature CHAIN JQ707527_HBSP_P-D of FT:mat_peptide JQ707527_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C44). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JQ707528_HBSP_P-D Product feature CHAIN JQ707528_HBSP_P-D of FT:mat_peptide JQ707528_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707529_HBSP_P-D Product feature CHAIN JQ707529_HBSP_P-D of FT:mat_peptide JQ707529_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C46). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707530_HBSP_P-D Product feature CHAIN JQ707530_HBSP_P-D of FT:mat_peptide JQ707530_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707682_HBSP_P-D Product feature CHAIN JQ707682_HBSP_P-D of FT:mat_peptide JQ707682_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_1-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707683_HBSP_P-D Product feature CHAIN JQ707683_HBSP_P-D of FT:mat_peptide JQ707683_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707684_HBSP_P-D Product feature CHAIN JQ707684_HBSP_P-D of FT:mat_peptide JQ707684_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707685_HBSP_P-D Product feature CHAIN JQ707685_HBSP_P-D of FT:mat_peptide JQ707685_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707686_HBSP_P-D Product feature CHAIN JQ707686_HBSP_P-D of FT:mat_peptide JQ707686_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707687_HBSP_P-D Product feature CHAIN JQ707687_HBSP_P-D of FT:mat_peptide JQ707687_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707688_HBSP_P-D Product feature CHAIN JQ707688_HBSP_P-D of FT:mat_peptide JQ707688_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707689_HBSP_P-D Product feature CHAIN JQ707689_HBSP_P-D of FT:mat_peptide JQ707689_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPTRDHAEPARLLLKEPLCIPPVAVPNFRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707690_HBSP_P-D Product feature CHAIN JQ707690_HBSP_P-D of FT:mat_peptide JQ707690_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707691_HBSP_P-D Product feature CHAIN JQ707691_HBSP_P-D of FT:mat_peptide JQ707691_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707692_HBSP_P-D Product feature CHAIN JQ707692_HBSP_P-D of FT:mat_peptide JQ707692_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707693_HBSP_P-D Product feature CHAIN JQ707693_HBSP_P-D of FT:mat_peptide JQ707693_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707694_HBSP_P-D Product feature CHAIN JQ707694_HBSP_P-D of FT:mat_peptide JQ707694_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_28). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707695_HBSP_P-D Product feature CHAIN JQ707695_HBSP_P-D of FT:mat_peptide JQ707695_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_29). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707696_HBSP_P-D Product feature CHAIN JQ707696_HBSP_P-D of FT:mat_peptide JQ707696_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707697_HBSP_P-D Product feature CHAIN JQ707697_HBSP_P-D of FT:mat_peptide JQ707697_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_30). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707698_HBSP_P-D Product feature CHAIN JQ707698_HBSP_P-D of FT:mat_peptide JQ707698_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_32). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707699_HBSP_P-D Product feature CHAIN JQ707699_HBSP_P-D of FT:mat_peptide JQ707699_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707700_HBSP_P-D Product feature CHAIN JQ707700_HBSP_P-D of FT:mat_peptide JQ707700_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_36-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707701_HBSP_P-D Product feature CHAIN JQ707701_HBSP_P-D of FT:mat_peptide JQ707701_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707702_HBSP_P-D Product feature CHAIN JQ707702_HBSP_P-D of FT:mat_peptide JQ707702_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707703_HBSP_P-D Product feature CHAIN JQ707703_HBSP_P-D of FT:mat_peptide JQ707703_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707704_HBSP_P-D Product feature CHAIN JQ707704_HBSP_P-D of FT:mat_peptide JQ707704_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707705_HBSP_P-D Product feature CHAIN JQ707705_HBSP_P-D of FT:mat_peptide JQ707705_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ707706_HBSP_P-D Product feature CHAIN JQ707706_HBSP_P-D of FT:mat_peptide JQ707706_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_8-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|JQ927384_HBSP_P-D Product feature CHAIN JQ927384_HBSP_P-D of FT:mat_peptide JQ927384_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KM2109). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JX096954_HBSP_P-D Product feature CHAIN JX096954_HBSP_P-D of FT:mat_peptide JX096954_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1-3242). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JX096955_HBSP_P-D Product feature CHAIN JX096955_HBSP_P-D of FT:mat_peptide JX096955_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2-3051). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSIY
>gnl|hbvpro|JX096956_HBSP_P-D Product feature CHAIN JX096956_HBSP_P-D of FT:mat_peptide JX096956_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5-6154). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JX096957_HBSP_P-D Product feature CHAIN JX096957_HBSP_P-D of FT:mat_peptide JX096957_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6-2646). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JX096958_HBSP_P-D Product feature CHAIN JX096958_HBSP_P-D of FT:mat_peptide JX096958_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7-1276). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|JX310733_HBSP_P-D Product feature CHAIN JX310733_HBSP_P-D of FT:mat_peptide JX310733_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D23_1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPAWEHAEAARLLLQEPLCIPPVAVPNLRX
EIAPVFPSHHHGLSEDSYGXGPQPVSPGSVY
>gnl|hbvpro|JX898694_HBSP_P-D Product feature CHAIN JX898694_HBSP_P-D of FT:mat_peptide JX898694_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPTVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC774436_HBSP_P-D Product feature CHAIN KC774436_HBSP_P-D of FT:mat_peptide KC774436_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1008). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC774437_HBSP_P-D Product feature CHAIN KC774437_HBSP_P-D of FT:mat_peptide KC774437_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1009). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC774440_HBSP_P-D Product feature CHAIN KC774440_HBSP_P-D of FT:mat_peptide KC774440_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1028). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC774444_HBSP_P-D Product feature CHAIN KC774444_HBSP_P-D of FT:mat_peptide KC774444_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1038). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KC774445_HBSP_P-D Product feature CHAIN KC774445_HBSP_P-D of FT:mat_peptide KC774445_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1040). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAKDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC774459_HBSP_P-D Product feature CHAIN KC774459_HBSP_P-D of FT:mat_peptide KC774459_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1111). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRM
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC774460_HBSP_P-D Product feature CHAIN KC774460_HBSP_P-D of FT:mat_peptide KC774460_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1112). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC774462_HBSP_P-D Product feature CHAIN KC774462_HBSP_P-D of FT:mat_peptide KC774462_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dxa2047). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC774477_HBSP_P-D Product feature CHAIN KC774477_HBSP_P-D of FT:mat_peptide KC774477_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dxn1031). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875277_HBSP_P-D Product feature CHAIN KC875277_HBSP_P-D of FT:mat_peptide KC875277_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875279_HBSP_P-D Product feature CHAIN KC875279_HBSP_P-D of FT:mat_peptide KC875279_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHSEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875283_HBSP_P-D Product feature CHAIN KC875283_HBSP_P-D of FT:mat_peptide KC875283_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875286_HBSP_P-D Product feature CHAIN KC875286_HBSP_P-D of FT:mat_peptide KC875286_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875287_HBSP_P-D Product feature CHAIN KC875287_HBSP_P-D of FT:mat_peptide KC875287_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875288_HBSP_P-D Product feature CHAIN KC875288_HBSP_P-D of FT:mat_peptide KC875288_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV56). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875289_HBSP_P-D Product feature CHAIN KC875289_HBSP_P-D of FT:mat_peptide KC875289_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV55). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875290_HBSP_P-D Product feature CHAIN KC875290_HBSP_P-D of FT:mat_peptide KC875290_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV57). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875292_HBSP_P-D Product feature CHAIN KC875292_HBSP_P-D of FT:mat_peptide KC875292_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875293_HBSP_P-D Product feature CHAIN KC875293_HBSP_P-D of FT:mat_peptide KC875293_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV69). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875294_HBSP_P-D Product feature CHAIN KC875294_HBSP_P-D of FT:mat_peptide KC875294_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV70). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875295_HBSP_P-D Product feature CHAIN KC875295_HBSP_P-D of FT:mat_peptide KC875295_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV81). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875296_HBSP_P-D Product feature CHAIN KC875296_HBSP_P-D of FT:mat_peptide KC875296_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV82). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875297_HBSP_P-D Product feature CHAIN KC875297_HBSP_P-D of FT:mat_peptide KC875297_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV84). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875299_HBSP_P-D Product feature CHAIN KC875299_HBSP_P-D of FT:mat_peptide KC875299_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV85). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875301_HBSP_P-D Product feature CHAIN KC875301_HBSP_P-D of FT:mat_peptide KC875301_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV89). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875306_HBSP_P-D Product feature CHAIN KC875306_HBSP_P-D of FT:mat_peptide KC875306_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV71). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875307_HBSP_P-D Product feature CHAIN KC875307_HBSP_P-D of FT:mat_peptide KC875307_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV74). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875308_HBSP_P-D Product feature CHAIN KC875308_HBSP_P-D of FT:mat_peptide KC875308_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV72). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875309_HBSP_P-D Product feature CHAIN KC875309_HBSP_P-D of FT:mat_peptide KC875309_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV43). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875312_HBSP_P-D Product feature CHAIN KC875312_HBSP_P-D of FT:mat_peptide KC875312_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV22). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875322_HBSP_P-D Product feature CHAIN KC875322_HBSP_P-D of FT:mat_peptide KC875322_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV54). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875323_HBSP_P-D Product feature CHAIN KC875323_HBSP_P-D of FT:mat_peptide KC875323_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV53). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875324_HBSP_P-D Product feature CHAIN KC875324_HBSP_P-D of FT:mat_peptide KC875324_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV59). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPPEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875325_HBSP_P-D Product feature CHAIN KC875325_HBSP_P-D of FT:mat_peptide KC875325_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV60). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAAPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875326_HBSP_P-D Product feature CHAIN KC875326_HBSP_P-D of FT:mat_peptide KC875326_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV37). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAAPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875328_HBSP_P-D Product feature CHAIN KC875328_HBSP_P-D of FT:mat_peptide KC875328_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV83). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875329_HBSP_P-D Product feature CHAIN KC875329_HBSP_P-D of FT:mat_peptide KC875329_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV90). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875330_HBSP_P-D Product feature CHAIN KC875330_HBSP_P-D of FT:mat_peptide KC875330_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV87). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875331_HBSP_P-D Product feature CHAIN KC875331_HBSP_P-D of FT:mat_peptide KC875331_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV88). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875340_HBSP_P-D Product feature CHAIN KC875340_HBSP_P-D of FT:mat_peptide KC875340_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV34). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KC875341_HBSP_P-D Product feature CHAIN KC875341_HBSP_P-D of FT:mat_peptide KC875341_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV67). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF053178_HBSP_P-D Product feature CHAIN KF053178_HBSP_P-D of FT:mat_peptide KF053178_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MY62981). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEHARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF061167_HBSP_P-D Product feature CHAIN KF061167_HBSP_P-D of FT:mat_peptide KF061167_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_1a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYXHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF061168_HBSP_P-D Product feature CHAIN KF061168_HBSP_P-D of FT:mat_peptide KF061168_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_3a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF061169_HBSP_P-D Product feature CHAIN KF061169_HBSP_P-D of FT:mat_peptide KF061169_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_7a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF170739_HBSP_P-D Product feature CHAIN KF170739_HBSP_P-D of FT:mat_peptide KF170739_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_024). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKETLCIPPVAVPNLRT
EIAPVFPSHHPGPSGNSYGSGPQPVSPGSVY
>gnl|hbvpro|KF192830_HBSP_P-D Product feature CHAIN KF192830_HBSP_P-D of FT:mat_peptide KF192830_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP71). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREHAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF192831_HBSP_P-D Product feature CHAIN KF192831_HBSP_P-D of FT:mat_peptide KF192831_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP59). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF192832_HBSP_P-D Product feature CHAIN KF192832_HBSP_P-D of FT:mat_peptide KF192832_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP67). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF192834_HBSP_P-D Product feature CHAIN KF192834_HBSP_P-D of FT:mat_peptide KF192834_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP63). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAKPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KF471640_HBSP_P-D Product feature CHAIN KF471640_HBSP_P-D of FT:mat_peptide KF471640_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-86). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471641_HBSP_P-D Product feature CHAIN KF471641_HBSP_P-D of FT:mat_peptide KF471641_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-66). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLCLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471642_HBSP_P-D Product feature CHAIN KF471642_HBSP_P-D of FT:mat_peptide KF471642_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-65). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471644_HBSP_P-D Product feature CHAIN KF471644_HBSP_P-D of FT:mat_peptide KF471644_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-52). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471645_HBSP_P-D Product feature CHAIN KF471645_HBSP_P-D of FT:mat_peptide KF471645_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-50). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLDSDY
>gnl|hbvpro|KF471646_HBSP_P-D Product feature CHAIN KF471646_HBSP_P-D of FT:mat_peptide KF471646_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471647_HBSP_P-D Product feature CHAIN KF471647_HBSP_P-D of FT:mat_peptide KF471647_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVH
>gnl|hbvpro|KF471649_HBSP_P-D Product feature CHAIN KF471649_HBSP_P-D of FT:mat_peptide KF471649_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-31). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471650_HBSP_P-D Product feature CHAIN KF471650_HBSP_P-D of FT:mat_peptide KF471650_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDHAEPARLLLKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471651_HBSP_P-D Product feature CHAIN KF471651_HBSP_P-D of FT:mat_peptide KF471651_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471652_HBSP_P-D Product feature CHAIN KF471652_HBSP_P-D of FT:mat_peptide KF471652_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-20). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471653_HBSP_P-D Product feature CHAIN KF471653_HBSP_P-D of FT:mat_peptide KF471653_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-18). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471654_HBSP_P-D Product feature CHAIN KF471654_HBSP_P-D of FT:mat_peptide KF471654_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471655_HBSP_P-D Product feature CHAIN KF471655_HBSP_P-D of FT:mat_peptide KF471655_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471657_HBSP_P-D Product feature CHAIN KF471657_HBSP_P-D of FT:mat_peptide KF471657_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPTVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471658_HBSP_P-D Product feature CHAIN KF471658_HBSP_P-D of FT:mat_peptide KF471658_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG_4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471659_HBSP_P-D Product feature CHAIN KF471659_HBSP_P-D of FT:mat_peptide KF471659_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF471660_HBSP_P-D Product feature CHAIN KF471660_HBSP_P-D of FT:mat_peptide KF471660_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF584160_HBSP_P-D Product feature CHAIN KF584160_HBSP_P-D of FT:mat_peptide KF584160_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYXRFRXLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF584161_HBSP_P-D Product feature CHAIN KF584161_HBSP_P-D of FT:mat_peptide KF584161_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF584162_HBSP_P-D Product feature CHAIN KF584162_HBSP_P-D of FT:mat_peptide KF584162_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1b). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF584163_HBSP_P-D Product feature CHAIN KF584163_HBSP_P-D of FT:mat_peptide KF584163_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2a). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF584164_HBSP_P-D Product feature CHAIN KF584164_HBSP_P-D of FT:mat_peptide KF584164_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2b). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF584165_HBSP_P-D Product feature CHAIN KF584165_HBSP_P-D of FT:mat_peptide KF584165_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Da). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF584166_HBSP_P-D Product feature CHAIN KF584166_HBSP_P-D of FT:mat_peptide KF584166_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Db). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679989_HBSP_P-D Product feature CHAIN KF679989_HBSP_P-D of FT:mat_peptide KF679989_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-49). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679990_HBSP_P-D Product feature CHAIN KF679990_HBSP_P-D of FT:mat_peptide KF679990_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-57). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679992_HBSP_P-D Product feature CHAIN KF679992_HBSP_P-D of FT:mat_peptide KF679992_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-75). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679993_HBSP_P-D Product feature CHAIN KF679993_HBSP_P-D of FT:mat_peptide KF679993_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-76). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679994_HBSP_P-D Product feature CHAIN KF679994_HBSP_P-D of FT:mat_peptide KF679994_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-10). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679995_HBSP_P-D Product feature CHAIN KF679995_HBSP_P-D of FT:mat_peptide KF679995_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679996_HBSP_P-D Product feature CHAIN KF679996_HBSP_P-D of FT:mat_peptide KF679996_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-51). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679997_HBSP_P-D Product feature CHAIN KF679997_HBSP_P-D of FT:mat_peptide KF679997_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-56). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF679998_HBSP_P-D Product feature CHAIN KF679998_HBSP_P-D of FT:mat_peptide KF679998_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-63). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|KF779214_HBSP_P-D Product feature CHAIN KF779214_HBSP_P-D of FT:mat_peptide KF779214_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5754). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF779220_HBSP_P-D Product feature CHAIN KF779220_HBSP_P-D of FT:mat_peptide KF779220_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5910). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF779382_HBSP_P-D Product feature CHAIN KF779382_HBSP_P-D of FT:mat_peptide KF779382_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6295). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KF922432_HBSP_P-D Product feature CHAIN KF922432_HBSP_P-D of FT:mat_peptide KF922432_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate N011). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDPAEPARHLLKEPLCIPPVAVQNLRT
ETAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KJ470889_HBSP_P-D Product feature CHAIN KJ470889_HBSP_P-D of FT:mat_peptide KJ470889_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8034). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEXLXIPPVAVXNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470893_HBSP_P-D Product feature CHAIN KJ470893_HBSP_P-D of FT:mat_peptide KJ470893_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8118). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPHVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470894_HBSP_P-D Product feature CHAIN KJ470894_HBSP_P-D of FT:mat_peptide KJ470894_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8066). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCFPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470895_HBSP_P-D Product feature CHAIN KJ470895_HBSP_P-D of FT:mat_peptide KJ470895_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8120). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ470896_HBSP_P-D Product feature CHAIN KJ470896_HBSP_P-D of FT:mat_peptide KJ470896_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8122). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSZNSYGSGPQPVSLGSVY
>gnl|hbvpro|KJ647350_HBSP_P-D Product feature CHAIN KJ647350_HBSP_P-D of FT:mat_peptide KJ647350_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV197). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRLPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KJ647352_HBSP_P-D Product feature CHAIN KJ647352_HBSP_P-D of FT:mat_peptide KJ647352_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV219). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQXFRRLLLLDDESGPLEEELPRLADEDLNRRVADDLNLGNLSDLQPPAWDHAKPAQLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSKNSYGSGPQPVSPGSVY
>gnl|hbvpro|KJ647355_HBSP_P-D Product feature CHAIN KJ647355_HBSP_P-D of FT:mat_peptide KJ647355_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV247). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDPQPPARDLAKPAXLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSXNSYGSGPQPVSPGSVY
>gnl|hbvpro|KM519455_HBSP_P-D Product feature CHAIN KM519455_HBSP_P-D of FT:mat_peptide KM519455_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_WT_SA). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524338_HBSP_P-D Product feature CHAIN KM524338_HBSP_P-D of FT:mat_peptide KM524338_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV136_EP-CHB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524339_HBSP_P-D Product feature CHAIN KM524339_HBSP_P-D of FT:mat_peptide KM524339_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV064_EP-CHB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524341_HBSP_P-D Product feature CHAIN KM524341_HBSP_P-D of FT:mat_peptide KM524341_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV128_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524342_HBSP_P-D Product feature CHAIN KM524342_HBSP_P-D of FT:mat_peptide KM524342_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DR003_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLTEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KM524344_HBSP_P-D Product feature CHAIN KM524344_HBSP_P-D of FT:mat_peptide KM524344_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK070_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAKPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524346_HBSP_P-D Product feature CHAIN KM524346_HBSP_P-D of FT:mat_peptide KM524346_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK096_EP-CHB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAKPARLLFKEPLCIPTVAVPNLRT
EIAPVFPSHHPGLSENSYGCGPQPVSPGSVY
>gnl|hbvpro|KM524347_HBSP_P-D Product feature CHAIN KM524347_HBSP_P-D of FT:mat_peptide KM524347_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK102_EP-CHB). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524348_HBSP_P-D Product feature CHAIN KM524348_HBSP_P-D of FT:mat_peptide KM524348_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK129_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQLFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKDPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524351_HBSP_P-D Product feature CHAIN KM524351_HBSP_P-D of FT:mat_peptide KM524351_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-020_HIV-HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAKPARLLFKEPLCIPTVAVPNLRT
EIAPVFPSHHPGLSENSYGCGPQPVSPGSVY
>gnl|hbvpro|KM524352_HBSP_P-D Product feature CHAIN KM524352_HBSP_P-D of FT:mat_peptide KM524352_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-025_HIV-HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524353_HBSP_P-D Product feature CHAIN KM524353_HBSP_P-D of FT:mat_peptide KM524353_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-031_HIV-HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524354_HBSP_P-D Product feature CHAIN KM524354_HBSP_P-D of FT:mat_peptide KM524354_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-058_HIV-HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524355_HBSP_P-D Product feature CHAIN KM524355_HBSP_P-D of FT:mat_peptide KM524355_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-092_HIV-HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524356_HBSP_P-D Product feature CHAIN KM524356_HBSP_P-D of FT:mat_peptide KM524356_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-123_HIV-HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCFPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM524358_HBSP_P-D Product feature CHAIN KM524358_HBSP_P-D of FT:mat_peptide KM524358_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV.I-057_HIV-HBV). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KM577668_HBSP_P-D Product feature CHAIN KM577668_HBSP_P-D of FT:mat_peptide KM577668_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM577669_HBSP_P-D Product feature CHAIN KM577669_HBSP_P-D of FT:mat_peptide KM577669_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM577670_HBSP_P-D Product feature CHAIN KM577670_HBSP_P-D of FT:mat_peptide KM577670_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQYFRRLVLLDNDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM577671_HBSP_P-D Product feature CHAIN KM577671_HBSP_P-D of FT:mat_peptide KM577671_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-9). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPQSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM606744_HBSP_P-D Product feature CHAIN KM606744_HBSP_P-D of FT:mat_peptide KM606744_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba9). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDPAGPARLLLKEPLCIPPVAVQNLRT
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KM606752_HBSP_P-D Product feature CHAIN KM606752_HBSP_P-D of FT:mat_peptide KM606752_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba100). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAENLNLGNLNDHQPPARDPAGPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KM606753_HBSP_P-D Product feature CHAIN KM606753_HBSP_P-D of FT:mat_peptide KM606753_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba109). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEHARLLLKEPLCIPPAAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KM606754_HBSP_P-D Product feature CHAIN KM606754_HBSP_P-D of FT:mat_peptide KM606754_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba120). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSVLLLDDEAGPLQEELPRLADEDLNRRVAEYLNLGNHNDHRPPARDPAGPARLLLKEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KP090179_HBSP_P-D Product feature CHAIN KP090179_HBSP_P-D of FT:mat_peptide KP090179_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR6). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPQEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP090180_HBSP_P-D Product feature CHAIN KP090180_HBSP_P-D of FT:mat_peptide KP090180_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPAQLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP090181_HBSP_P-D Product feature CHAIN KP090181_HBSP_P-D of FT:mat_peptide KP090181_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR40). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLRNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP168419_HBSP_P-D Product feature CHAIN KP168419_HBSP_P-D of FT:mat_peptide KP168419_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KN109). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP322599_HBSP_P-D Product feature CHAIN KP322599_HBSP_P-D of FT:mat_peptide KP322599_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2811). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP322600_HBSP_P-D Product feature CHAIN KP322600_HBSP_P-D of FT:mat_peptide KP322600_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2812). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP322601_HBSP_P-D Product feature CHAIN KP322601_HBSP_P-D of FT:mat_peptide KP322601_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2813). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KP995100_HBSP_P-D Product feature CHAIN KP995100_HBSP_P-D of FT:mat_peptide KP995100_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 49-Cirrhosis). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPLVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KR905423_HBSP_P-D Product feature CHAIN KR905423_HBSP_P-D of FT:mat_peptide KR905423_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KR905424_HBSP_P-D Product feature CHAIN KR905424_HBSP_P-D of FT:mat_peptide KR905424_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT151620_HBSP_P-D Product feature CHAIN KT151620_HBSP_P-D of FT:mat_peptide KT151620_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAGPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT347090_HBSP_P-D Product feature CHAIN KT347090_HBSP_P-D of FT:mat_peptide KT347090_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGMTMG). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366491_HBSP_P-D Product feature CHAIN KT366491_HBSP_P-D of FT:mat_peptide KT366491_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366493_HBSP_P-D Product feature CHAIN KT366493_HBSP_P-D of FT:mat_peptide KT366493_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.41). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAKPARLLFKEPLYIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366494_HBSP_P-D Product feature CHAIN KT366494_HBSP_P-D of FT:mat_peptide KT366494_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.42). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARNHAEPARLLFKESLYSPPVAVPNVRK
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366495_HBSP_P-D Product feature CHAIN KT366495_HBSP_P-D of FT:mat_peptide KT366495_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.45). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366496_HBSP_P-D Product feature CHAIN KT366496_HBSP_P-D of FT:mat_peptide KT366496_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.46). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARQLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366497_HBSP_P-D Product feature CHAIN KT366497_HBSP_P-D of FT:mat_peptide KT366497_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.48). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366498_HBSP_P-D Product feature CHAIN KT366498_HBSP_P-D of FT:mat_peptide KT366498_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLEEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366499_HBSP_P-D Product feature CHAIN KT366499_HBSP_P-D of FT:mat_peptide KT366499_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.11). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAKPARLLLKEPLCIPPVAVPNLRT
QIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366500_HBSP_P-D Product feature CHAIN KT366500_HBSP_P-D of FT:mat_peptide KT366500_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLEEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366501_HBSP_P-D Product feature CHAIN KT366501_HBSP_P-D of FT:mat_peptide KT366501_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLEEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366502_HBSP_P-D Product feature CHAIN KT366502_HBSP_P-D of FT:mat_peptide KT366502_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLEEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366506_HBSP_P-D Product feature CHAIN KT366506_HBSP_P-D of FT:mat_peptide KT366506_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366507_HBSP_P-D Product feature CHAIN KT366507_HBSP_P-D of FT:mat_peptide KT366507_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.24). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366508_HBSP_P-D Product feature CHAIN KT366508_HBSP_P-D of FT:mat_peptide KT366508_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.25). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366509_HBSP_P-D Product feature CHAIN KT366509_HBSP_P-D of FT:mat_peptide KT366509_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.26). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366510_HBSP_P-D Product feature CHAIN KT366510_HBSP_P-D of FT:mat_peptide KT366510_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.36). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT366511_HBSP_P-D Product feature CHAIN KT366511_HBSP_P-D of FT:mat_peptide KT366511_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.37). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLYIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT749821_HBSP_P-D Product feature CHAIN KT749821_HBSP_P-D of FT:mat_peptide KT749821_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEELHLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT749823_HBSP_P-D Product feature CHAIN KT749823_HBSP_P-D of FT:mat_peptide KT749823_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL3). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLPLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHHGLSENSYGGGPQPVSPGSVY
>gnl|hbvpro|KT749827_HBSP_P-D Product feature CHAIN KT749827_HBSP_P-D of FT:mat_peptide KT749827_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KT749828_HBSP_P-D Product feature CHAIN KT749828_HBSP_P-D of FT:mat_peptide KT749828_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL13). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLANEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGAQPVSPGSVY
>gnl|hbvpro|KT963508_HBSP_P-D Product feature CHAIN KT963508_HBSP_P-D of FT:mat_peptide KT963508_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KU668449_HBSP_P-D Product feature CHAIN KU668449_HBSP_P-D of FT:mat_peptide KU668449_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV207). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSHGSVY
>gnl|hbvpro|KU736924_HBSP_P-D Product feature CHAIN KU736924_HBSP_P-D of FT:mat_peptide KU736924_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU736925_HBSP_P-D Product feature CHAIN KU736925_HBSP_P-D of FT:mat_peptide KU736925_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_15). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KU736926_HBSP_P-D Product feature CHAIN KU736926_HBSP_P-D of FT:mat_peptide KU736926_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_18). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFXSHHPGLSENSYGSGPQPVSLGSVH
>gnl|hbvpro|KU736927_HBSP_P-D Product feature CHAIN KU736927_HBSP_P-D of FT:mat_peptide KU736927_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_20). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSLGSVH
>gnl|hbvpro|KX196208_HBSP_P-D Product feature CHAIN KX196208_HBSP_P-D of FT:mat_peptide KX196208_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL093). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX196209_HBSP_P-D Product feature CHAIN KX196209_HBSP_P-D of FT:mat_peptide KX196209_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL094). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX196211_HBSP_P-D Product feature CHAIN KX196211_HBSP_P-D of FT:mat_peptide KX196211_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL096). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX196212_HBSP_P-D Product feature CHAIN KX196212_HBSP_P-D of FT:mat_peptide KX196212_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL097). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX196215_HBSP_P-D Product feature CHAIN KX196215_HBSP_P-D of FT:mat_peptide KX196215_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0100). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX196224_HBSP_P-D Product feature CHAIN KX196224_HBSP_P-D of FT:mat_peptide KX196224_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0109). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDYAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX196225_HBSP_P-D Product feature CHAIN KX196225_HBSP_P-D of FT:mat_peptide KX196225_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0110). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX196227_HBSP_P-D Product feature CHAIN KX196227_HBSP_P-D of FT:mat_peptide KX196227_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0112). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX196228_HBSP_P-D Product feature CHAIN KX196228_HBSP_P-D of FT:mat_peptide KX196228_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0113). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX196235_HBSP_P-D Product feature CHAIN KX196235_HBSP_P-D of FT:mat_peptide KX196235_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0120). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVD
>gnl|hbvpro|KX196236_HBSP_P-D Product feature CHAIN KX196236_HBSP_P-D of FT:mat_peptide KX196236_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0121). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX260231_HBSP_P-D Product feature CHAIN KX260231_HBSP_P-D of FT:mat_peptide KX260231_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR-32). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPAWDHAKPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSEDSYGSGPQPVSPGSVY
>gnl|hbvpro|KX276856_HBSP_P-D Product feature CHAIN KX276856_HBSP_P-D of FT:mat_peptide KX276856_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSVLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQPPAWDHAEPARLLFKEPLCIPPVVVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX276857_HBSP_P-D Product feature CHAIN KX276857_HBSP_P-D of FT:mat_peptide KX276857_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357622_HBSP_P-D Product feature CHAIN KX357622_HBSP_P-D of FT:mat_peptide KX357622_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GD104ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQLPARVHAEPARLLLKEPLCIPPVAVQNLRT
ETAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357637_HBSP_P-D Product feature CHAIN KX357637_HBSP_P-D of FT:mat_peptide KX357637_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK20ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDHAEPARPLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357638_HBSP_P-D Product feature CHAIN KX357638_HBSP_P-D of FT:mat_peptide KX357638_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AA95ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDHAEPARPLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX357639_HBSP_P-D Product feature CHAIN KX357639_HBSP_P-D of FT:mat_peptide KX357639_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GD82ETH). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX827290_HBSP_P-D Product feature CHAIN KX827290_HBSP_P-D of FT:mat_peptide KX827290_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno1.2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX827291_HBSP_P-D Product feature CHAIN KX827291_HBSP_P-D of FT:mat_peptide KX827291_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno2.2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX827300_HBSP_P-D Product feature CHAIN KX827300_HBSP_P-D of FT:mat_peptide KX827300_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno21.2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARHLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KX827301_HBSP_P-D Product feature CHAIN KX827301_HBSP_P-D of FT:mat_peptide KX827301_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno30.4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KY382412_HBSP_P-D Product feature CHAIN KY382412_HBSP_P-D of FT:mat_peptide KY382412_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1_1896). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KY382414_HBSP_P-D Product feature CHAIN KY382414_HBSP_P-D of FT:mat_peptide KY382414_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1_wt). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KY629630_HBSP_P-D Product feature CHAIN KY629630_HBSP_P-D of FT:mat_peptide KY629630_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TYM13097). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQPPARDPAEPARLLLKEPLCIPPVAVXNPRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|KY629633_HBSP_P-D Product feature CHAIN KY629633_HBSP_P-D of FT:mat_peptide KY629633_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KLMY14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDPAEPARLLLKEPLCIPLAAVXNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|KY629634_HBSP_P-D Product feature CHAIN KY629634_HBSP_P-D of FT:mat_peptide KY629634_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KLMY16). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVADELNLGNLNDLQPPARDPAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|LC365689_HBSP_P-D Product feature CHAIN LC365689_HBSP_P-D of FT:mat_peptide LC365689_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HB17-0791). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|LT992438_HBSP_P-D Product feature CHAIN LT992438_HBSP_P-D of FT:mat_peptide LT992438_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|LT992439_HBSP_P-D Product feature CHAIN LT992439_HBSP_P-D of FT:mat_peptide LT992439_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLRPPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|LT992444_HBSP_P-D Product feature CHAIN LT992444_HBSP_P-D of FT:mat_peptide LT992444_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRM
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|LT992454_HBSP_P-D Product feature CHAIN LT992454_HBSP_P-D of FT:mat_peptide LT992454_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA222). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|M32138_HBSP_P-D Product feature CHAIN M32138_HBSP_P-D of FT:mat_peptide M32138_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-21). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRHVAEELNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF618348_HBSP_P-D Product feature CHAIN MF618348_HBSP_P-D of FT:mat_peptide MF618348_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV137). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRM
ETAPVFPSHHPGLSENSYGSGPQPVSLGSVY
>gnl|hbvpro|MF618349_HBSP_P-D Product feature CHAIN MF618349_HBSP_P-D of FT:mat_peptide MF618349_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV165). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925358_HBSP_P-D Product feature CHAIN MF925358_HBSP_P-D of FT:mat_peptide MF925358_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV01). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925363_HBSP_P-D Product feature CHAIN MF925363_HBSP_P-D of FT:mat_peptide MF925363_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV07). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARILFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925364_HBSP_P-D Product feature CHAIN MF925364_HBSP_P-D of FT:mat_peptide MF925364_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV08). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925379_HBSP_P-D Product feature CHAIN MF925379_HBSP_P-D of FT:mat_peptide MF925379_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV23). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKAPLCIPHVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925383_HBSP_P-D Product feature CHAIN MF925383_HBSP_P-D of FT:mat_peptide MF925383_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV27). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925390_HBSP_P-D Product feature CHAIN MF925390_HBSP_P-D of FT:mat_peptide MF925390_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV34). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925391_HBSP_P-D Product feature CHAIN MF925391_HBSP_P-D of FT:mat_peptide MF925391_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV35). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRSVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPHVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MF925393_HBSP_P-D Product feature CHAIN MF925393_HBSP_P-D of FT:mat_peptide MF925393_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV38). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MH932714_HBSP_P-D Product feature CHAIN MH932714_HBSP_P-D of FT:mat_peptide MH932714_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Hiroshima GtD CL2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052947_HBSP_P-D Product feature CHAIN MK052947_HBSP_P-D of FT:mat_peptide MK052947_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-1). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDHNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSRRHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052948_HBSP_P-D Product feature CHAIN MK052948_HBSP_P-D of FT:mat_peptide MK052948_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLHKEPLCIPPVAVQNLRT
EIAPVFPSRRHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052949_HBSP_P-D Product feature CHAIN MK052949_HBSP_P-D of FT:mat_peptide MK052949_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDFNLGNLNDPQQPARDHAELARLLLKQPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052950_HBSP_P-D Product feature CHAIN MK052950_HBSP_P-D of FT:mat_peptide MK052950_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAELARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052951_HBSP_P-D Product feature CHAIN MK052951_HBSP_P-D of FT:mat_peptide MK052951_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLHKEPLCIPPVAVQNLRT
EIAPVFPSRHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052952_HBSP_P-D Product feature CHAIN MK052952_HBSP_P-D of FT:mat_peptide MK052952_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-6). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052953_HBSP_P-D Product feature CHAIN MK052953_HBSP_P-D of FT:mat_peptide MK052953_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052954_HBSP_P-D Product feature CHAIN MK052954_HBSP_P-D of FT:mat_peptide MK052954_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLHKEPLCIPPVAVQNLRT
EIAPVFPSRRHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052955_HBSP_P-D Product feature CHAIN MK052955_HBSP_P-D of FT:mat_peptide MK052955_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052956_HBSP_P-D Product feature CHAIN MK052956_HBSP_P-D of FT:mat_peptide MK052956_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052958_HBSP_P-D Product feature CHAIN MK052958_HBSP_P-D of FT:mat_peptide MK052958_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052959_HBSP_P-D Product feature CHAIN MK052959_HBSP_P-D of FT:mat_peptide MK052959_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAELARLLLKEPLCIPPVAVPNLRT
EIAHVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052960_HBSP_P-D Product feature CHAIN MK052960_HBSP_P-D of FT:mat_peptide MK052960_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-14). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052961_HBSP_P-D Product feature CHAIN MK052961_HBSP_P-D of FT:mat_peptide MK052961_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-15). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCTPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052963_HBSP_P-D Product feature CHAIN MK052963_HBSP_P-D of FT:mat_peptide MK052963_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052966_HBSP_P-D Product feature CHAIN MK052966_HBSP_P-D of FT:mat_peptide MK052966_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052971_HBSP_P-D Product feature CHAIN MK052971_HBSP_P-D of FT:mat_peptide MK052971_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRPADEGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHHGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052972_HBSP_P-D Product feature CHAIN MK052972_HBSP_P-D of FT:mat_peptide MK052972_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-12). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052973_HBSP_P-D Product feature CHAIN MK052973_HBSP_P-D of FT:mat_peptide MK052973_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-14). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052974_HBSP_P-D Product feature CHAIN MK052974_HBSP_P-D of FT:mat_peptide MK052974_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|MK052975_HBSP_P-D Product feature CHAIN MK052975_HBSP_P-D of FT:mat_peptide MK052975_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-17). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQQPARDHAEPARLLLKEPLCIPPVAVQNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X02496_HBSP_P-D Product feature CHAIN X02496_HBSP_P-D of FT:mat_peptide X02496_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X59795_HBSP_P-D Product feature CHAIN X59795_HBSP_P-D of FT:mat_peptide X59795_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Patient MG; HBV/S). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQPPARDHAGPARLLLKATLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X65257_HBSP_P-D Product feature CHAIN X65257_HBSP_P-D of FT:mat_peptide X65257_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient C; HBsAg positiv;HBV subtype ayw). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X65258_HBSP_P-D Product feature CHAIN X65258_HBSP_P-D of FT:mat_peptide X65258_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient CI; HBV subtype ayw). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEQQQPVRDHAKPARLLLKATLCFPHVAVPKLRM
EIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|X72702_HBSP_P-D Product feature CHAIN X72702_HBSP_P-D of FT:mat_peptide X72702_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient C1005). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X80924_HBSP_P-D Product feature CHAIN X80924_HBSP_P-D of FT:mat_peptide X80924_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 4). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X80926_HBSP_P-D Product feature CHAIN X80926_HBSP_P-D of FT:mat_peptide X80926_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 5). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDLQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X85254_HBSP_P-D Product feature CHAIN X85254_HBSP_P-D of FT:mat_peptide X85254_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQPPARDHAAPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHLGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X97848_HBSP_P-D Product feature CHAIN X97848_HBSP_P-D of FT:mat_peptide X97848_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 2). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLWNLNDHQPPARDHAGPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|X97849_HBSP_P-D Product feature CHAIN X97849_HBSP_P-D of FT:mat_peptide X97849_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 3). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|Y07587_HBSP_P-D Product feature CHAIN Y07587_HBSP_P-D of FT:mat_peptide Y07587_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
>gnl|hbvpro|Z35716_HBSP_P-D Product feature CHAIN Z35716_HBSP_P-D of FT:mat_peptide Z35716_HBSP_P-D of [Viruses] Hepatitis B Virus genotype D (isolate hb321). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPAWDHAEPARLLFKEPLCIPPVAVPNLRT
EIAPVFPSHHPGLSENSYGSGPQPVSPGSVY
© 1998-2019