HBVdb

Dataset for protein HBc of genotype D

[Download (right click)] [Alignment] [Repertoires]

1900 sequence(s)

>gnl|hbvpro|AB048701_HBc_P-D Product feature CHAIN AB048701_HBc_P-D of FT:mat_peptide AB048701_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRHVCLCWGDLMNLATWVGTNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDLVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRQRGRTIRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB078031_HBc_P-D Product feature CHAIN AB078031_HBc_P-D of FT:mat_peptide AB078031_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FH1-YS). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB078032_HBc_P-D Product feature CHAIN AB078032_HBc_P-D of FT:mat_peptide AB078032_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AH1-SY). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB078033_HBc_P-D Product feature CHAIN AB078033_HBc_P-D of FT:mat_peptide AB078033_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IS1-OY). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB090268_HBc_P-D Product feature CHAIN AB090268_HBc_P-D of FT:mat_peptide AB090268_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB090269_HBc_P-D Product feature CHAIN AB090269_HBc_P-D of FT:mat_peptide AB090269_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB090270_HBc_P-D Product feature CHAIN AB090270_HBc_P-D of FT:mat_peptide AB090270_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB104709_HBc_P-D Product feature CHAIN AB104709_HBc_P-D of FT:mat_peptide AB104709_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG64). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB104710_HBc_P-D Product feature CHAIN AB104710_HBc_P-D of FT:mat_peptide AB104710_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG105). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVTYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB104711_HBc_P-D Product feature CHAIN AB104711_HBc_P-D of FT:mat_peptide AB104711_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG104). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB104712_HBc_P-D Product feature CHAIN AB104712_HBc_P-D of FT:mat_peptide AB104712_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG75). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB109475_HBc_P-D Product feature CHAIN AB109475_HBc_P-D of FT:mat_peptide AB109475_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB109476_HBc_P-D Product feature CHAIN AB109476_HBc_P-D of FT:mat_peptide AB109476_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB109477_HBc_P-D Product feature CHAIN AB109477_HBc_P-D of FT:mat_peptide AB109477_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB109478_HBc_P-D Product feature CHAIN AB109478_HBc_P-D of FT:mat_peptide AB109478_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSAHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDQVVSYVNTNIALKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB109479_HBc_P-D Product feature CHAIN AB109479_HBc_P-D of FT:mat_peptide AB109479_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB110075_HBc_P-D Product feature CHAIN AB110075_HBc_P-D of FT:mat_peptide AB110075_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116266_HBc_P-D Product feature CHAIN AB116266_HBc_P-D of FT:mat_peptide AB116266_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB119251_HBc_P-D Product feature CHAIN AB119251_HBc_P-D of FT:mat_peptide AB119251_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPQDFFPSVRDLLDTASALYRQALESPEHCSAHHTALRQAILCWGELMTLATWVGTNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB119252_HBc_P-D Product feature CHAIN AB119252_HBc_P-D of FT:mat_peptide AB119252_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|AB119253_HBc_P-D Product feature CHAIN AB119253_HBc_P-D of FT:mat_peptide AB119253_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPQDFFPAVRDLLDTASALYREALESPEHCTYHHTALRQAILCWGELMSLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|AB119254_HBc_P-D Product feature CHAIN AB119254_HBc_P-D of FT:mat_peptide AB119254_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSYHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB119255_HBc_P-D Product feature CHAIN AB119255_HBc_P-D of FT:mat_peptide AB119255_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGDLMSLATWVGGNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRSTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB119256_HBc_P-D Product feature CHAIN AB119256_HBc_P-D of FT:mat_peptide AB119256_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWGGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSSLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB120308_HBc_P-D Product feature CHAIN AB120308_HBc_P-D of FT:mat_peptide AB120308_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|AB126581_HBc_P-D Product feature CHAIN AB126581_HBc_P-D of FT:mat_peptide AB126581_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU301). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB188241_HBc_P-D Product feature CHAIN AB188241_HBc_P-D of FT:mat_peptide AB188241_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSXHHTALRQAILCWGELMTLATWVGANLEDPT
SRDAVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB188242_HBc_P-D Product feature CHAIN AB188242_HBc_P-D of FT:mat_peptide AB188242_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDQP
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB188244_HBc_P-D Product feature CHAIN AB188244_HBc_P-D of FT:mat_peptide AB188244_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZ24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRXPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205126_HBc_P-D Product feature CHAIN AB205126_HBc_P-D of FT:mat_peptide AB205126_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-IF714-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205127_HBc_P-D Product feature CHAIN AB205127_HBc_P-D of FT:mat_peptide AB205127_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU313-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205128_HBc_P-D Product feature CHAIN AB205128_HBc_P-D of FT:mat_peptide AB205128_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU316-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRGLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB210820_HBc_P-D Product feature CHAIN AB210820_HBc_P-D of FT:mat_peptide AB210820_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGVNLEDQP
SRDLVVSYVNTNMGLKFRQLLWFHISCITFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB210821_HBc_P-D Product feature CHAIN AB210821_HBc_P-D of FT:mat_peptide AB210821_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|AB210822_HBc_P-D Product feature CHAIN AB210822_HBc_P-D of FT:mat_peptide AB210822_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|AB222709_HBc_P-D Product feature CHAIN AB222709_HBc_P-D of FT:mat_peptide AB222709_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB222710_HBc_P-D Product feature CHAIN AB222710_HBc_P-D of FT:mat_peptide AB222710_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6M). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRHTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB222711_HBc_P-D Product feature CHAIN AB222711_HBc_P-D of FT:mat_peptide AB222711_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNV24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB222712_HBc_P-D Product feature CHAIN AB222712_HBc_P-D of FT:mat_peptide AB222712_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV61). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB222713_HBc_P-D Product feature CHAIN AB222713_HBc_P-D of FT:mat_peptide AB222713_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246347_HBc_P-D Product feature CHAIN AB246347_HBc_P-D of FT:mat_peptide AB246347_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246348_HBc_P-D Product feature CHAIN AB246348_HBc_P-D of FT:mat_peptide AB246348_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB267090_HBc_P-D Product feature CHAIN AB267090_HBc_P-D of FT:mat_peptide AB267090_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ehime 22-HS). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRGRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB270537_HBc_P-D Product feature CHAIN AB270537_HBc_P-D of FT:mat_peptide AB270537_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL22F). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLQDPA
SRDQVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB270539_HBc_P-D Product feature CHAIN AB270539_HBc_P-D of FT:mat_peptide AB270539_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL200F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB270540_HBc_P-D Product feature CHAIN AB270540_HBc_P-D of FT:mat_peptide AB270540_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL241F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB270541_HBc_P-D Product feature CHAIN AB270541_HBc_P-D of FT:mat_peptide AB270541_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL47F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLEDQT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB270542_HBc_P-D Product feature CHAIN AB270542_HBc_P-D of FT:mat_peptide AB270542_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL12F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHGSAHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB270543_HBc_P-D Product feature CHAIN AB270543_HBc_P-D of FT:mat_peptide AB270543_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL209F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB270546_HBc_P-D Product feature CHAIN AB270546_HBc_P-D of FT:mat_peptide AB270546_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL88F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATICWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRATVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB270547_HBc_P-D Product feature CHAIN AB270547_HBc_P-D of FT:mat_peptide AB270547_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL295F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB270548_HBc_P-D Product feature CHAIN AB270548_HBc_P-D of FT:mat_peptide AB270548_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL207F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB270549_HBc_P-D Product feature CHAIN AB270549_HBc_P-D of FT:mat_peptide AB270549_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL79F). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB270550_HBc_P-D Product feature CHAIN AB270550_HBc_P-D of FT:mat_peptide AB270550_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL247F). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRSRTPRRRT
PSPRRRRSQSPRRRRSQSRESNC
>gnl|hbvpro|AB330367_HBc_P-D Product feature CHAIN AB330367_HBc_P-D of FT:mat_peptide AB330367_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ14HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESSEHCSPHHTALRQAILCWGDTLDLATWVGGNLEDQA
SRDLVVNYVNTKMGLKFRQLLWFHVSCLTFGRQIVVEYLVSFGVWIRTPPAYRPPNAPILSMLPETSVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB330369_HBc_P-D Product feature CHAIN AB330369_HBc_P-D of FT:mat_peptide AB330369_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ5HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB330370_HBc_P-D Product feature CHAIN AB330370_HBc_P-D of FT:mat_peptide AB330370_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ6HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB355452_HBc_P-D Product feature CHAIN AB355452_HBc_P-D of FT:mat_peptide AB355452_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQR
>gnl|hbvpro|AB355456_HBc_P-D Product feature CHAIN AB355456_HBc_P-D of FT:mat_peptide AB355456_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 07UC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQR
>gnl|hbvpro|AB471856_HBc_P-D Product feature CHAIN AB471856_HBc_P-D of FT:mat_peptide AB471856_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB471857_HBc_P-D Product feature CHAIN AB471857_HBc_P-D of FT:mat_peptide AB471857_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB493846_HBc_P-D Product feature CHAIN AB493846_HBc_P-D of FT:mat_peptide AB493846_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17UC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB555496_HBc_P-D Product feature CHAIN AB555496_HBc_P-D of FT:mat_peptide AB555496_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIENMVSFGVWIRSPPANRPPNAPILSTLLETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESVC
>gnl|hbvpro|AB555497_HBc_P-D Product feature CHAIN AB555497_HBc_P-D of FT:mat_peptide AB555497_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRSPQAYRPPNAPILSTLLETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB555500_HBc_P-D Product feature CHAIN AB555500_HBc_P-D of FT:mat_peptide AB555500_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA64). Complete genome. [Hepadnaviridae] (length=183 residues).
KDLDPYKEFGASVTLLSFLPAYFFPSVPDLLDTASALYREALESPEHVSAHHTALRQAILCWGDLMNLATWVGTNLDDPA
SRDLVVSYVNTNMGLKFRQLLWFHLSCLTFGRPTVMEFLVSFGVWIRTPPAYRPPNAPILSTLPETSVIRQXGRSPRRRT
PSPRRRRSKSPCRRRSQSRDAQC
>gnl|hbvpro|AB555501_HBc_P-D Product feature CHAIN AB555501_HBc_P-D of FT:mat_peptide AB555501_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYIRIGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPS
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYMVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|AB583680_HBc_P-D Product feature CHAIN AB583680_HBc_P-D of FT:mat_peptide AB583680_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pkst7912). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674403_HBc_P-D Product feature CHAIN AB674403_HBc_P-D of FT:mat_peptide AB674403_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD87). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLTTLATWVGGNLEDPT
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRCGTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674404_HBc_P-D Product feature CHAIN AB674404_HBc_P-D of FT:mat_peptide AB674404_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE39). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRXPGRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674405_HBc_P-D Product feature CHAIN AB674405_HBc_P-D of FT:mat_peptide AB674405_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraHCCA12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB674406_HBc_P-D Product feature CHAIN AB674406_HBc_P-D of FT:mat_peptide AB674406_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674407_HBc_P-D Product feature CHAIN AB674407_HBc_P-D of FT:mat_peptide AB674407_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674408_HBc_P-D Product feature CHAIN AB674408_HBc_P-D of FT:mat_peptide AB674408_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD83). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRQALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674410_HBc_P-D Product feature CHAIN AB674410_HBc_P-D of FT:mat_peptide AB674410_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD27). Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHVFLCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB674411_HBc_P-D Product feature CHAIN AB674411_HBc_P-D of FT:mat_peptide AB674411_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD84). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|AB674413_HBc_P-D Product feature CHAIN AB674413_HBc_P-D of FT:mat_peptide AB674413_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB27). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLQDPV
SRDQVVGYVNTTVGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674415_HBc_P-D Product feature CHAIN AB674415_HBc_P-D of FT:mat_peptide AB674415_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC24). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPENFYPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHXSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB674416_HBc_P-D Product feature CHAIN AB674416_HBc_P-D of FT:mat_peptide AB674416_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPDDFFPSARDLLDTATALYREALESQEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDQR
SRDLVVTYVNANMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPESTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674417_HBc_P-D Product feature CHAIN AB674417_HBc_P-D of FT:mat_peptide AB674417_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraLCE1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQACLCWGELMTLATWVGGNLEDPR
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRPRGRTPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB674418_HBc_P-D Product feature CHAIN AB674418_HBc_P-D of FT:mat_peptide AB674418_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC7). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPR
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRPRGRTPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AB674419_HBc_P-D Product feature CHAIN AB674419_HBc_P-D of FT:mat_peptide AB674419_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMSLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB674420_HBc_P-D Product feature CHAIN AB674420_HBc_P-D of FT:mat_peptide AB674420_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunLCD2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB674423_HBc_P-D Product feature CHAIN AB674423_HBc_P-D of FT:mat_peptide AB674423_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGKLMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRQTVIEYLVSFGVWIRTPPAYRPTNAPILSTLPECTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|AB674424_HBc_P-D Product feature CHAIN AB674424_HBc_P-D of FT:mat_peptide AB674424_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALDSPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPANAPILSTLPETSVIRSRSRAPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674425_HBc_P-D Product feature CHAIN AB674425_HBc_P-D of FT:mat_peptide AB674425_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674426_HBc_P-D Product feature CHAIN AB674426_HBc_P-D of FT:mat_peptide AB674426_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD50). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALQSPEHCSPHHTALRQAILCWGDLMXLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674427_HBc_P-D Product feature CHAIN AB674427_HBc_P-D of FT:mat_peptide AB674427_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD54). Complete genome. [Hepadnaviridae] (length=183 residues).
MDXDPYKEFGAXVELLSFLPLDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGSNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AB674428_HBc_P-D Product feature CHAIN AB674428_HBc_P-D of FT:mat_peptide AB674428_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPRC
>gnl|hbvpro|AB674429_HBc_P-D Product feature CHAIN AB674429_HBc_P-D of FT:mat_peptide AB674429_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD89). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLQDPV
SRDLVVRYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB674430_HBc_P-D Product feature CHAIN AB674430_HBc_P-D of FT:mat_peptide AB674430_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC2). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB674431_HBc_P-D Product feature CHAIN AB674431_HBc_P-D of FT:mat_peptide AB674431_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTHMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSSLPETCVVRRRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB716760_HBc_P-D Product feature CHAIN AB716760_HBc_P-D of FT:mat_peptide AB716760_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 11999_C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
LVMGHHKEFGATVELLSFLPSDFFPSVRXLLDTASAIYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTBMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF043593_HBc_P-D Product feature CHAIN AF043593_HBc_P-D of FT:mat_peptide AF043593_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6/89). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF043594_HBc_P-D Product feature CHAIN AF043594_HBc_P-D of FT:mat_peptide AF043594_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1/91). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPHDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLQDPA
SRELVVTYVNINMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF121239_HBc_P-D Product feature CHAIN AF121239_HBc_P-D of FT:mat_peptide AF121239_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1303). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AF121240_HBc_C-D Product feature CHAIN AF121240_HBc_C-D of FT:mat_peptide AF121240_HBc_C-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/11066). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AF121241_HBc_P-D Product feature CHAIN AF121241_HBc_P-D of FT:mat_peptide AF121241_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1758). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AF121242_HBc_P-D Product feature CHAIN AF121242_HBc_P-D of FT:mat_peptide AF121242_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1218). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AF151735_HBc_P-D Product feature CHAIN AF151735_HBc_P-D of FT:mat_peptide AF151735_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF280817_HBc_P-D Product feature CHAIN AF280817_HBc_P-D of FT:mat_peptide AF280817_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-D1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324108_HBc_P-D Product feature CHAIN AF324108_HBc_P-D of FT:mat_peptide AF324108_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0052). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324109_HBc_P-D Product feature CHAIN AF324109_HBc_P-D of FT:mat_peptide AF324109_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0062). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324110_HBc_P-D Product feature CHAIN AF324110_HBc_P-D of FT:mat_peptide AF324110_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0076). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILWWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPGRRRSQSRASQC
>gnl|hbvpro|AF324111_HBc_P-D Product feature CHAIN AF324111_HBc_P-D of FT:mat_peptide AF324111_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0081). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLATWVGANLEDQA
SRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETSVIRRRGRSSRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AF324113_HBc_P-D Product feature CHAIN AF324113_HBc_P-D of FT:mat_peptide AF324113_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0094). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRTLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324114_HBc_P-D Product feature CHAIN AF324114_HBc_P-D of FT:mat_peptide AF324114_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0018). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324115_HBc_P-D Product feature CHAIN AF324115_HBc_P-D of FT:mat_peptide AF324115_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0098). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324116_HBc_P-D Product feature CHAIN AF324116_HBc_P-D of FT:mat_peptide AF324116_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0123). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324132_HBc_P-D Product feature CHAIN AF324132_HBc_P-D of FT:mat_peptide AF324132_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8.25). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324138_HBc_P-D Product feature CHAIN AF324138_HBc_P-D of FT:mat_peptide AF324138_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I39). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324141_HBc_P-D Product feature CHAIN AF324141_HBc_P-D of FT:mat_peptide AF324141_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I55). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419512_HBc_P-D Product feature CHAIN AF419512_HBc_P-D of FT:mat_peptide AF419512_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I10-Fam C). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLATWVGANLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AF419516_HBc_P-D Product feature CHAIN AF419516_HBc_P-D of FT:mat_peptide AF419516_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I1-Fam A). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419521_HBc_P-D Product feature CHAIN AF419521_HBc_P-D of FT:mat_peptide AF419521_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I28-fam F). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIICWGELMTLATWVGANLEDPA
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNSPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419522_HBc_P-D Product feature CHAIN AF419522_HBc_P-D of FT:mat_peptide AF419522_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I2-Fam A). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHLSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSILPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419523_HBc_P-D Product feature CHAIN AF419523_HBc_P-D of FT:mat_peptide AF419523_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I31-Fam F). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALFLQALESPEHCSPHHTAIRQAVLCWGELMTLATWVGVNLEDPS
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNSPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419524_HBc_P-D Product feature CHAIN AF419524_HBc_P-D of FT:mat_peptide AF419524_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I3-Fam A). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419526_HBc_P-D Product feature CHAIN AF419526_HBc_P-D of FT:mat_peptide AF419526_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I44-Fam G). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTRLRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419527_HBc_P-D Product feature CHAIN AF419527_HBc_P-D of FT:mat_peptide AF419527_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I45-Fam G). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALEPPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVGSYVNTHMGLKFRQLLWFHISCLTFGRETVVQYLVSFGVWIRTPPAYRPPNAPILSMLPETCVVRRRGRSPGRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AF419528_HBc_P-D Product feature CHAIN AF419528_HBc_P-D of FT:mat_peptide AF419528_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I47-Fam G). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTAKALFREALESPEHCSPHHTAVRQAILCWGELMNLATWVGVNLEDQS
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AF419529_HBc_P-D Product feature CHAIN AF419529_HBc_P-D of FT:mat_peptide AF419529_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I49-Fam H). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGDLMTLATWVGANLEDPT
SRDLVVSYVNTTVGLKFRQLLWFHISCLTFGREAVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AF419530_HBc_P-D Product feature CHAIN AF419530_HBc_P-D of FT:mat_peptide AF419530_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I4-Fam A). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419532_HBc_P-D Product feature CHAIN AF419532_HBc_P-D of FT:mat_peptide AF419532_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I51-Fam H). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGANLDDPA
SRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419537_HBc_P-D Product feature CHAIN AF419537_HBc_P-D of FT:mat_peptide AF419537_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I8-Fam C). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGANLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSKSPRRRRSKSRESQC
>gnl|hbvpro|AF419538_HBc_P-D Product feature CHAIN AF419538_HBc_P-D of FT:mat_peptide AF419538_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I9-Fam C). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTHMGLKIRQLLWFHISCLTFGRQTVIEYFVSFGVWIRTPPAYRPPNAPILSTLPETTVIRCRGRSPRRRT
PSPRRRRSKSPRRRRSKSRESQC
>gnl|hbvpro|AF419539_HBc_P-D Product feature CHAIN AF419539_HBc_P-D of FT:mat_peptide AF419539_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I62-Fam I). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLQDQA
SRELVVNYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRGRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419540_HBc_P-D Product feature CHAIN AF419540_HBc_P-D of FT:mat_peptide AF419540_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I75-Fam M). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419542_HBc_P-D Product feature CHAIN AF419542_HBc_P-D of FT:mat_peptide AF419542_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I77-Fam I). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ131956_HBc_P-D Product feature CHAIN AJ131956_HBc_P-D of FT:mat_peptide AJ131956_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ344116_HBc_P-D Product feature CHAIN AJ344116_HBc_P-D of FT:mat_peptide AJ344116_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBsAg negative patient GX27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ627215_HBc_P-D Product feature CHAIN AJ627215_HBc_P-D of FT:mat_peptide AJ627215_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 06115). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESSEHCSPHHTALRQAILCWGDLMSLGTWVGGNLEDQA
SRDLVVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPSYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|AJ627216_HBc_P-D Product feature CHAIN AJ627216_HBc_P-D of FT:mat_peptide AJ627216_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17707). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESSEHCSPHHTALRQAILCWGDLMSLGTWVGGNLEDQA
SRDLVVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPSYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|AJ627218_HBc_P-D Product feature CHAIN AJ627218_HBc_P-D of FT:mat_peptide AJ627218_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 21116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESSEHCSPHHTALRQAILCWGDLMSLGTWVGGNLEDQA
SRDLVVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPSYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|AJ627219_HBc_P-D Product feature CHAIN AJ627219_HBc_P-D of FT:mat_peptide AJ627219_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 24039). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYRNALESPEHCSXHHTALRQAILCWGDLINLSTWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ627220_HBc_P-D Product feature CHAIN AJ627220_HBc_P-D of FT:mat_peptide AJ627220_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 29234). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ627222_HBc_P-D Product feature CHAIN AJ627222_HBc_P-D of FT:mat_peptide AJ627222_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 31228). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVQLLSFLPADFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ627223_HBc_P-D Product feature CHAIN AJ627223_HBc_P-D of FT:mat_peptide AJ627223_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33720). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ627224_HBc_P-D Product feature CHAIN AJ627224_HBc_P-D of FT:mat_peptide AJ627224_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33852). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM422939_HBc_P-D Product feature CHAIN AM422939_HBc_P-D of FT:mat_peptide AM422939_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate X28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY090452_HBc_P-D Product feature CHAIN AY090452_HBc_P-D of FT:mat_peptide AY090452_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQA
SRDLVVSYVNTNMGLKFRQMLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRETQC
>gnl|hbvpro|AY090453_HBc_P-D Product feature CHAIN AY090453_HBc_P-D of FT:mat_peptide AY090453_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161150_HBc_P-D Product feature CHAIN AY161150_HBc_P-D of FT:mat_peptide AY161150_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY161151_HBc_P-D Product feature CHAIN AY161151_HBc_P-D of FT:mat_peptide AY161151_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY161152_HBc_P-D Product feature CHAIN AY161152_HBc_P-D of FT:mat_peptide AY161152_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY161153_HBc_P-D Product feature CHAIN AY161153_HBc_P-D of FT:mat_peptide AY161153_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY161154_HBc_P-D Product feature CHAIN AY161154_HBc_P-D of FT:mat_peptide AY161154_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY161155_HBc_P-D Product feature CHAIN AY161155_HBc_P-D of FT:mat_peptide AY161155_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY161156_HBc_P-D Product feature CHAIN AY161156_HBc_P-D of FT:mat_peptide AY161156_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY161157_HBc_P-D Product feature CHAIN AY161157_HBc_P-D of FT:mat_peptide AY161157_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDTDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161158_HBc_P-D Product feature CHAIN AY161158_HBc_P-D of FT:mat_peptide AY161158_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRAKSRESQC
>gnl|hbvpro|AY161159_HBc_P-D Product feature CHAIN AY161159_HBc_P-D of FT:mat_peptide AY161159_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161160_HBc_P-D Product feature CHAIN AY161160_HBc_P-D of FT:mat_peptide AY161160_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY230112_HBc_P-D Product feature CHAIN AY230112_HBc_P-D of FT:mat_peptide AY230112_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY230114_HBc_P-D Product feature CHAIN AY230114_HBc_P-D of FT:mat_peptide AY230114_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY233291_HBc_P-D Product feature CHAIN AY233291_HBc_P-D of FT:mat_peptide AY233291_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 179). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233292_HBc_P-D Product feature CHAIN AY233292_HBc_P-D of FT:mat_peptide AY233292_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 184). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233294_HBc_P-D Product feature CHAIN AY233294_HBc_P-D of FT:mat_peptide AY233294_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 305). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233296_HBc_P-D Product feature CHAIN AY233296_HBc_P-D of FT:mat_peptide AY233296_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 185). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY236160_HBc_P-D Product feature CHAIN AY236160_HBc_P-D of FT:mat_peptide AY236160_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1A). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALECPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY236162_HBc_P-D Product feature CHAIN AY236162_HBc_P-D of FT:mat_peptide AY236162_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 23A). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALKQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY236164_HBc_P-D Product feature CHAIN AY236164_HBc_P-D of FT:mat_peptide AY236164_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 30). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSEFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
LSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY350614_HBc_P-D Product feature CHAIN AY350614_HBc_P-D of FT:mat_peptide AY350614_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371901_HBc_P-D Product feature CHAIN AY371901_HBc_P-D of FT:mat_peptide AY371901_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371902_HBc_P-D Product feature CHAIN AY371902_HBc_P-D of FT:mat_peptide AY371902_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371904_HBc_P-D Product feature CHAIN AY371904_HBc_P-D of FT:mat_peptide AY371904_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:14). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALTQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVLIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY371905_HBc_P-D Product feature CHAIN AY371905_HBc_P-D of FT:mat_peptide AY371905_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371906_HBc_P-D Product feature CHAIN AY371906_HBc_P-D of FT:mat_peptide AY371906_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:28). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELITLATWVGGNLEDPT
SRDLMVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371907_HBc_P-D Product feature CHAIN AY371907_HBc_P-D of FT:mat_peptide AY371907_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY371908_HBc_P-D Product feature CHAIN AY371908_HBc_P-D of FT:mat_peptide AY371908_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:18). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371909_HBc_P-D Product feature CHAIN AY371909_HBc_P-D of FT:mat_peptide AY371909_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:13). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTAVRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTHMGLKFRQILWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRPRSRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY371910_HBc_P-D Product feature CHAIN AY371910_HBc_P-D of FT:mat_peptide AY371910_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:59). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRQALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371911_HBc_P-D Product feature CHAIN AY371911_HBc_P-D of FT:mat_peptide AY371911_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:23). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371912_HBc_P-D Product feature CHAIN AY371912_HBc_P-D of FT:mat_peptide AY371912_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPKRKT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY371913_HBc_P-D Product feature CHAIN AY371913_HBc_P-D of FT:mat_peptide AY371913_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:8). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELVSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY371914_HBc_P-D Product feature CHAIN AY371914_HBc_P-D of FT:mat_peptide AY371914_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371915_HBc_P-D Product feature CHAIN AY371915_HBc_P-D of FT:mat_peptide AY371915_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:12). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY371916_HBc_P-D Product feature CHAIN AY371916_HBc_P-D of FT:mat_peptide AY371916_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:51). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY371917_HBc_P-D Product feature CHAIN AY371917_HBc_P-D of FT:mat_peptide AY371917_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:53). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371918_HBc_P-D Product feature CHAIN AY371918_HBc_P-D of FT:mat_peptide AY371918_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:42). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371919_HBc_P-D Product feature CHAIN AY371919_HBc_P-D of FT:mat_peptide AY371919_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:20). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRGSQC
>gnl|hbvpro|AY371920_HBc_P-D Product feature CHAIN AY371920_HBc_P-D of FT:mat_peptide AY371920_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371921_HBc_P-D Product feature CHAIN AY371921_HBc_P-D of FT:mat_peptide AY371921_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY371922_HBc_P-D Product feature CHAIN AY371922_HBc_P-D of FT:mat_peptide AY371922_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY373431_HBc_P-D Product feature CHAIN AY373431_HBc_P-D of FT:mat_peptide AY373431_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603427_HBc_P-D Product feature CHAIN AY603427_HBc_P-D of FT:mat_peptide AY603427_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 12T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603428_HBc_P-D Product feature CHAIN AY603428_HBc_P-D of FT:mat_peptide AY603428_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 13T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603433_HBc_P-D Product feature CHAIN AY603433_HBc_P-D of FT:mat_peptide AY603433_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 26T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHIALRQAILWWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRCPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603434_HBc_P-D Product feature CHAIN AY603434_HBc_P-D of FT:mat_peptide AY603434_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 30T). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603437_HBc_P-D Product feature CHAIN AY603437_HBc_P-D of FT:mat_peptide AY603437_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603439_HBc_P-D Product feature CHAIN AY603439_HBc_P-D of FT:mat_peptide AY603439_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 40T). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRT
PSNRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603440_HBc_P-D Product feature CHAIN AY603440_HBc_P-D of FT:mat_peptide AY603440_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 58T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603443_HBc_P-D Product feature CHAIN AY603443_HBc_P-D of FT:mat_peptide AY603443_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 02T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603445_HBc_P-D Product feature CHAIN AY603445_HBc_P-D of FT:mat_peptide AY603445_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFSPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY661792_HBc_P-D Product feature CHAIN AY661792_HBc_P-D of FT:mat_peptide AY661792_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ayw). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY661793_HBc_P-D Product feature CHAIN AY661793_HBc_P-D of FT:mat_peptide AY661793_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY721605_HBc_P-D Product feature CHAIN AY721605_HBc_P-D of FT:mat_peptide AY721605_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AK1.1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSHVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY721606_HBc_P-D Product feature CHAIN AY721606_HBc_P-D of FT:mat_peptide AY721606_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AT1.2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY721607_HBc_P-D Product feature CHAIN AY721607_HBc_P-D of FT:mat_peptide AY721607_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HIY1.3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY721608_HBc_P-D Product feature CHAIN AY721608_HBc_P-D of FT:mat_peptide AY721608_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IB1.4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY721609_HBc_P-D Product feature CHAIN AY721609_HBc_P-D of FT:mat_peptide AY721609_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AA1.5). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY721610_HBc_P-D Product feature CHAIN AY721610_HBc_P-D of FT:mat_peptide AY721610_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FK1.6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY721611_HBc_P-D Product feature CHAIN AY721611_HBc_P-D of FT:mat_peptide AY721611_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SK1.7). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY721612_HBc_P-D Product feature CHAIN AY721612_HBc_P-D of FT:mat_peptide AY721612_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BL1.8). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY741794_HBc_P-D Product feature CHAIN AY741794_HBc_P-D of FT:mat_peptide AY741794_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRTRSQSRGSQC
>gnl|hbvpro|AY741795_HBc_P-D Product feature CHAIN AY741795_HBc_P-D of FT:mat_peptide AY741795_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-Hi). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRTKSQSRGSQC
>gnl|hbvpro|AY741796_HBc_P-D Product feature CHAIN AY741796_HBc_P-D of FT:mat_peptide AY741796_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRTKSQSRGSQC
>gnl|hbvpro|AY741797_HBc_P-D Product feature CHAIN AY741797_HBc_P-D of FT:mat_peptide AY741797_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|AY741798_HBc_P-D Product feature CHAIN AY741798_HBc_P-D of FT:mat_peptide AY741798_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMSLATWVGGNLEDQQ
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|AY796030_HBc_P-D Product feature CHAIN AY796030_HBc_P-D of FT:mat_peptide AY796030_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FC1.9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY796031_HBc_P-D Product feature CHAIN AY796031_HBc_P-D of FT:mat_peptide AY796031_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RA1.10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDNASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AY796032_HBc_P-D Product feature CHAIN AY796032_HBc_P-D of FT:mat_peptide AY796032_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NA1.11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLDDPT
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY945307_HBc_P-D Product feature CHAIN AY945307_HBc_P-D of FT:mat_peptide AY945307_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ111986_HBc_P-D Product feature CHAIN DQ111986_HBc_P-D of FT:mat_peptide DQ111986_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MBT181). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPX
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPIAYRPPNAPILSTLPETCVVRXRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ178011_HBc_P-D Product feature CHAIN DQ178011_HBc_P-D of FT:mat_peptide DQ178011_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVFSYVNTNMGLKFRQLLWLHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPCRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ178012_HBc_P-D Product feature CHAIN DQ178012_HBc_P-D of FT:mat_peptide DQ178012_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVISYVNTNMGLKFRPLLWFHISCLNFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPCRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ178015_HBc_P-D Product feature CHAIN DQ178015_HBc_P-D of FT:mat_peptide DQ178015_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-7). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAFRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ178016_HBc_P-D Product feature CHAIN DQ178016_HBc_P-D of FT:mat_peptide DQ178016_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-8). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPCRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ178017_HBc_P-D Product feature CHAIN DQ178017_HBc_P-D of FT:mat_peptide DQ178017_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-9). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQILWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRKRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ178018_HBc_P-D Product feature CHAIN DQ178018_HBc_P-D of FT:mat_peptide DQ178018_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ178019_HBc_P-D Product feature CHAIN DQ178019_HBc_P-D of FT:mat_peptide DQ178019_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ178020_HBc_P-D Product feature CHAIN DQ178020_HBc_P-D of FT:mat_peptide DQ178020_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVTTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ304547_HBc_P-D Product feature CHAIN DQ304547_HBc_P-D of FT:mat_peptide DQ304547_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLAFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ304548_HBc_P-D Product feature CHAIN DQ304548_HBc_P-D of FT:mat_peptide DQ304548_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
LSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ304549_HBc_P-D Product feature CHAIN DQ304549_HBc_P-D of FT:mat_peptide DQ304549_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
LSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ304550_HBc_P-D Product feature CHAIN DQ304550_HBc_P-D of FT:mat_peptide DQ304550_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ304551_HBc_P-D Product feature CHAIN DQ304551_HBc_P-D of FT:mat_peptide DQ304551_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ315776_HBc_P-D Product feature CHAIN DQ315776_HBc_P-D of FT:mat_peptide DQ315776_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI00615). Complete genome. [Hepadnaviridae] (length=183 residues).
IDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315778_HBc_P-D Product feature CHAIN DQ315778_HBc_P-D of FT:mat_peptide DQ315778_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI0388). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSFRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLINLSTWVGSNLEDPA
SRDLVVSYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ329356_HBc_P-D Product feature CHAIN DQ329356_HBc_P-D of FT:mat_peptide DQ329356_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWRDLMTLATSVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVCLRTPPAYRPPNAPILSTLPETTVARRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ329357_HBc_P-D Product feature CHAIN DQ329357_HBc_P-D of FT:mat_peptide DQ329357_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRAQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336674_HBc_P-D Product feature CHAIN DQ336674_HBc_P-D of FT:mat_peptide DQ336674_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ336675_HBc_P-D Product feature CHAIN DQ336675_HBc_P-D of FT:mat_peptide DQ336675_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336676_HBc_P-D Product feature CHAIN DQ336676_HBc_P-D of FT:mat_peptide DQ336676_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336677_HBc_P-D Product feature CHAIN DQ336677_HBc_P-D of FT:mat_peptide DQ336677_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336678_HBc_P-D Product feature CHAIN DQ336678_HBc_P-D of FT:mat_peptide DQ336678_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336679_HBc_P-D Product feature CHAIN DQ336679_HBc_P-D of FT:mat_peptide DQ336679_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336680_HBc_P-D Product feature CHAIN DQ336680_HBc_P-D of FT:mat_peptide DQ336680_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVTEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREAQC
>gnl|hbvpro|DQ336681_HBc_P-D Product feature CHAIN DQ336681_HBc_P-D of FT:mat_peptide DQ336681_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREAQC
>gnl|hbvpro|DQ336682_HBc_P-D Product feature CHAIN DQ336682_HBc_P-D of FT:mat_peptide DQ336682_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVTEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREAQC
>gnl|hbvpro|DQ336683_HBc_P-D Product feature CHAIN DQ336683_HBc_P-D of FT:mat_peptide DQ336683_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCAPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRHLLWFHISCLTFGRDTVKEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ336684_HBc_P-D Product feature CHAIN DQ336684_HBc_P-D of FT:mat_peptide DQ336684_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVTEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREAQC
>gnl|hbvpro|DQ336685_HBc_P-D Product feature CHAIN DQ336685_HBc_P-D of FT:mat_peptide DQ336685_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESPC
>gnl|hbvpro|DQ336686_HBc_P-D Product feature CHAIN DQ336686_HBc_P-D of FT:mat_peptide DQ336686_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFRDALESSEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336687_HBc_P-D Product feature CHAIN DQ336687_HBc_P-D of FT:mat_peptide DQ336687_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336688_HBc_P-D Product feature CHAIN DQ336688_HBc_P-D of FT:mat_peptide DQ336688_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCPTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336689_HBc_P-D Product feature CHAIN DQ336689_HBc_P-D of FT:mat_peptide DQ336689_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
LSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336690_HBc_P-D Product feature CHAIN DQ336690_HBc_P-D of FT:mat_peptide DQ336690_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCPTFGREVVVEYLVSFGVWIRTPPAYKPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336691_HBc_P-D Product feature CHAIN DQ336691_HBc_P-D of FT:mat_peptide DQ336691_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVGLLSFLPSDFYPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ336692_HBc_P-D Product feature CHAIN DQ336692_HBc_P-D of FT:mat_peptide DQ336692_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ399006_HBc_P-D Product feature CHAIN DQ399006_HBc_P-D of FT:mat_peptide DQ399006_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate G1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPVYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|DQ464168_HBc_P-D Product feature CHAIN DQ464168_HBc_P-D of FT:mat_peptide DQ464168_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGGETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ464169_HBc_P-D Product feature CHAIN DQ464169_HBc_P-D of FT:mat_peptide DQ464169_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ464170_HBc_P-D Product feature CHAIN DQ464170_HBc_P-D of FT:mat_peptide DQ464170_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCRGGLKTLATWVGVNLEAPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQW
>gnl|hbvpro|DQ464172_HBc_P-D Product feature CHAIN DQ464172_HBc_P-D of FT:mat_peptide DQ464172_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTALALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPTRRT
PSPRRRRSQSPRRRRSKSQESHC
>gnl|hbvpro|DQ464173_HBc_P-D Product feature CHAIN DQ464173_HBc_P-D of FT:mat_peptide DQ464173_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFSPSDFYPSVQDLLDTALALFRDALDAPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ464174_HBc_P-D Product feature CHAIN DQ464174_HBc_P-D of FT:mat_peptide DQ464174_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ464175_HBc_P-D Product feature CHAIN DQ464175_HBc_P-D of FT:mat_peptide DQ464175_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPERCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFKQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ464176_HBc_P-D Product feature CHAIN DQ464176_HBc_P-D of FT:mat_peptide DQ464176_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLHTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREIVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ464177_HBc_P-D Product feature CHAIN DQ464177_HBc_P-D of FT:mat_peptide DQ464177_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGNLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ464178_HBc_P-D Product feature CHAIN DQ464178_HBc_P-D of FT:mat_peptide DQ464178_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ464181_HBc_P-D Product feature CHAIN DQ464181_HBc_P-D of FT:mat_peptide DQ464181_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S3). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGVKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ464182_HBc_P-D Product feature CHAIN DQ464182_HBc_P-D of FT:mat_peptide DQ464182_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQW
>gnl|hbvpro|DQ486021_HBc_P-D Product feature CHAIN DQ486021_HBc_P-D of FT:mat_peptide DQ486021_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALDAPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ486022_HBc_P-D Product feature CHAIN DQ486022_HBc_P-D of FT:mat_peptide DQ486022_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT11). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSEFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
LSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|DQ486023_HBc_P-D Product feature CHAIN DQ486023_HBc_P-D of FT:mat_peptide DQ486023_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLLNLSTWVGGNLQDQT
SRDLVVTYVNTNMGLKFRQLLWFHISCLMFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ486025_HBc_P-D Product feature CHAIN DQ486025_HBc_P-D of FT:mat_peptide DQ486025_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHWSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EF103275_HBc_P-D Product feature CHAIN EF103275_HBc_P-D of FT:mat_peptide EF103275_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF103276_HBc_P-D Product feature CHAIN EF103276_HBc_P-D of FT:mat_peptide EF103276_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF103277_HBc_P-D Product feature CHAIN EF103277_HBc_P-D of FT:mat_peptide EF103277_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF103279_HBc_P-D Product feature CHAIN EF103279_HBc_P-D of FT:mat_peptide EF103279_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran99). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF103280_HBc_P-D Product feature CHAIN EF103280_HBc_P-D of FT:mat_peptide EF103280_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran100). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF103281_HBc_P-D Product feature CHAIN EF103281_HBc_P-D of FT:mat_peptide EF103281_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU155893_HBc_P-D Product feature CHAIN EU155893_HBc_P-D of FT:mat_peptide EU155893_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRNTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEVAVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU155895_HBc_P-D Product feature CHAIN EU155895_HBc_P-D of FT:mat_peptide EU155895_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5b). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185779_HBc_P-D Product feature CHAIN EU185779_HBc_P-D of FT:mat_peptide EU185779_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H-IDU6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRQGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414054_HBc_P-D Product feature CHAIN EU414054_HBc_P-D of FT:mat_peptide EU414054_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414055_HBc_P-D Product feature CHAIN EU414055_HBc_P-D of FT:mat_peptide EU414055_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWXGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414056_HBc_P-D Product feature CHAIN EU414056_HBc_P-D of FT:mat_peptide EU414056_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRXTXIXYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPXRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414057_HBc_P-D Product feature CHAIN EU414057_HBc_P-D of FT:mat_peptide EU414057_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPXRRRSQSRESQC
>gnl|hbvpro|EU414058_HBc_P-D Product feature CHAIN EU414058_HBc_P-D of FT:mat_peptide EU414058_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414059_HBc_P-D Product feature CHAIN EU414059_HBc_P-D of FT:mat_peptide EU414059_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRX
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414060_HBc_P-D Product feature CHAIN EU414060_HBc_P-D of FT:mat_peptide EU414060_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414061_HBc_P-D Product feature CHAIN EU414061_HBc_P-D of FT:mat_peptide EU414061_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWXGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414135_HBc_P-D Product feature CHAIN EU414135_HBc_P-D of FT:mat_peptide EU414135_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414136_HBc_P-D Product feature CHAIN EU414136_HBc_P-D of FT:mat_peptide EU414136_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414138_HBc_P-D Product feature CHAIN EU414138_HBc_P-D of FT:mat_peptide EU414138_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWXGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414139_HBc_P-D Product feature CHAIN EU414139_HBc_P-D of FT:mat_peptide EU414139_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRX
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414140_HBc_P-D Product feature CHAIN EU414140_HBc_P-D of FT:mat_peptide EU414140_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414141_HBc_P-D Product feature CHAIN EU414141_HBc_P-D of FT:mat_peptide EU414141_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRXTXIXYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPXRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414142_HBc_P-D Product feature CHAIN EU414142_HBc_P-D of FT:mat_peptide EU414142_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWXGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414143_HBc_P-D Product feature CHAIN EU414143_HBc_P-D of FT:mat_peptide EU414143_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPXRRRSQSRESQC
>gnl|hbvpro|EU594382_HBc_P-D Product feature CHAIN EU594382_HBc_P-D of FT:mat_peptide EU594382_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594396_HBc_P-D Product feature CHAIN EU594396_HBc_P-D of FT:mat_peptide EU594396_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594397_HBc_P-D Product feature CHAIN EU594397_HBc_P-D of FT:mat_peptide EU594397_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594398_HBc_P-D Product feature CHAIN EU594398_HBc_P-D of FT:mat_peptide EU594398_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLITLSTWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594399_HBc_P-D Product feature CHAIN EU594399_HBc_P-D of FT:mat_peptide EU594399_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLGFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594400_HBc_P-D Product feature CHAIN EU594400_HBc_P-D of FT:mat_peptide EU594400_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594401_HBc_P-D Product feature CHAIN EU594401_HBc_P-D of FT:mat_peptide EU594401_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594402_HBc_P-D Product feature CHAIN EU594402_HBc_P-D of FT:mat_peptide EU594402_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594403_HBc_P-D Product feature CHAIN EU594403_HBc_P-D of FT:mat_peptide EU594403_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594404_HBc_P-D Product feature CHAIN EU594404_HBc_P-D of FT:mat_peptide EU594404_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594405_HBc_P-D Product feature CHAIN EU594405_HBc_P-D of FT:mat_peptide EU594405_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594407_HBc_P-D Product feature CHAIN EU594407_HBc_P-D of FT:mat_peptide EU594407_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594408_HBc_P-D Product feature CHAIN EU594408_HBc_P-D of FT:mat_peptide EU594408_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|EU594409_HBc_P-D Product feature CHAIN EU594409_HBc_P-D of FT:mat_peptide EU594409_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594410_HBc_P-D Product feature CHAIN EU594410_HBc_P-D of FT:mat_peptide EU594410_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594411_HBc_P-D Product feature CHAIN EU594411_HBc_P-D of FT:mat_peptide EU594411_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU594412_HBc_P-D Product feature CHAIN EU594412_HBc_P-D of FT:mat_peptide EU594412_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU594415_HBc_P-D Product feature CHAIN EU594415_HBc_P-D of FT:mat_peptide EU594415_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594416_HBc_P-D Product feature CHAIN EU594416_HBc_P-D of FT:mat_peptide EU594416_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594421_HBc_P-D Product feature CHAIN EU594421_HBc_P-D of FT:mat_peptide EU594421_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594422_HBc_P-D Product feature CHAIN EU594422_HBc_P-D of FT:mat_peptide EU594422_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594423_HBc_P-D Product feature CHAIN EU594423_HBc_P-D of FT:mat_peptide EU594423_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594424_HBc_P-D Product feature CHAIN EU594424_HBc_P-D of FT:mat_peptide EU594424_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594425_HBc_P-D Product feature CHAIN EU594425_HBc_P-D of FT:mat_peptide EU594425_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594426_HBc_P-D Product feature CHAIN EU594426_HBc_P-D of FT:mat_peptide EU594426_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594427_HBc_P-D Product feature CHAIN EU594427_HBc_P-D of FT:mat_peptide EU594427_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594428_HBc_P-D Product feature CHAIN EU594428_HBc_P-D of FT:mat_peptide EU594428_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594430_HBc_P-D Product feature CHAIN EU594430_HBc_P-D of FT:mat_peptide EU594430_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594431_HBc_P-D Product feature CHAIN EU594431_HBc_P-D of FT:mat_peptide EU594431_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594432_HBc_P-D Product feature CHAIN EU594432_HBc_P-D of FT:mat_peptide EU594432_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594433_HBc_P-D Product feature CHAIN EU594433_HBc_P-D of FT:mat_peptide EU594433_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594434_HBc_P-D Product feature CHAIN EU594434_HBc_P-D of FT:mat_peptide EU594434_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726844_HBc_P-D Product feature CHAIN EU726844_HBc_P-D of FT:mat_peptide EU726844_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3556). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726845_HBc_P-D Product feature CHAIN EU726845_HBc_P-D of FT:mat_peptide EU726845_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7061). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLENPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726847_HBc_P-D Product feature CHAIN EU726847_HBc_P-D of FT:mat_peptide EU726847_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3251). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726848_HBc_P-D Product feature CHAIN EU726848_HBc_P-D of FT:mat_peptide EU726848_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-5778). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726849_HBc_P-D Product feature CHAIN EU726849_HBc_P-D of FT:mat_peptide EU726849_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4672). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726850_HBc_P-D Product feature CHAIN EU726850_HBc_P-D of FT:mat_peptide EU726850_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6834). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726853_HBc_P-D Product feature CHAIN EU726853_HBc_P-D of FT:mat_peptide EU726853_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7182). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726854_HBc_P-D Product feature CHAIN EU726854_HBc_P-D of FT:mat_peptide EU726854_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3173). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726855_HBc_P-D Product feature CHAIN EU726855_HBc_P-D of FT:mat_peptide EU726855_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7179). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLEDQT
SRDLIVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726856_HBc_P-D Product feature CHAIN EU726856_HBc_P-D of FT:mat_peptide EU726856_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4450). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIHPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSREPQC
>gnl|hbvpro|EU726857_HBc_P-D Product feature CHAIN EU726857_HBc_P-D of FT:mat_peptide EU726857_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7114). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726858_HBc_P-D Product feature CHAIN EU726858_HBc_P-D of FT:mat_peptide EU726858_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3252). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETCVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726859_HBc_P-D Product feature CHAIN EU726859_HBc_P-D of FT:mat_peptide EU726859_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7075). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726860_HBc_P-D Product feature CHAIN EU726860_HBc_P-D of FT:mat_peptide EU726860_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3172). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726861_HBc_P-D Product feature CHAIN EU726861_HBc_P-D of FT:mat_peptide EU726861_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7181). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILWWGELMTLATWVGDNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVWIRTPPDYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRTSQSRESQC
>gnl|hbvpro|EU726862_HBc_P-D Product feature CHAIN EU726862_HBc_P-D of FT:mat_peptide EU726862_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7178). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726864_HBc_P-D Product feature CHAIN EU726864_HBc_P-D of FT:mat_peptide EU726864_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6822). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAVLCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726865_HBc_P-D Product feature CHAIN EU726865_HBc_P-D of FT:mat_peptide EU726865_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7474). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726868_HBc_P-D Product feature CHAIN EU726868_HBc_P-D of FT:mat_peptide EU726868_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8152). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDQT
SRDLVVTYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU726869_HBc_P-D Product feature CHAIN EU726869_HBc_P-D of FT:mat_peptide EU726869_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3886). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726871_HBc_P-D Product feature CHAIN EU726871_HBc_P-D of FT:mat_peptide EU726871_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7083). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQACLCWGELMTLATWVGTNLEDQA
SRDLVVQYVNTNMGLKFRQLLWFHISCLTFGRDIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|EU726872_HBc_P-D Product feature CHAIN EU726872_HBc_P-D of FT:mat_peptide EU726872_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3874). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU726873_HBc_P-D Product feature CHAIN EU726873_HBc_P-D of FT:mat_peptide EU726873_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6835). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU726874_HBc_P-D Product feature CHAIN EU726874_HBc_P-D of FT:mat_peptide EU726874_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7185). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726875_HBc_P-D Product feature CHAIN EU726875_HBc_P-D of FT:mat_peptide EU726875_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4757). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCTPHHTALRQAILCWGELMSLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726876_HBc_P-D Product feature CHAIN EU726876_HBc_P-D of FT:mat_peptide EU726876_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7054). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726878_HBc_P-D Product feature CHAIN EU726878_HBc_P-D of FT:mat_peptide EU726878_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4955). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726879_HBc_P-D Product feature CHAIN EU726879_HBc_P-D of FT:mat_peptide EU726879_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7180). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726880_HBc_P-D Product feature CHAIN EU726880_HBc_P-D of FT:mat_peptide EU726880_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6814). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGSNLEDPV
SRDLVVSYVNTNAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726881_HBc_P-D Product feature CHAIN EU726881_HBc_P-D of FT:mat_peptide EU726881_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6826). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726884_HBc_P-D Product feature CHAIN EU726884_HBc_P-D of FT:mat_peptide EU726884_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6845). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTAAALYREALESPEHCTPHHTALRQAIICWGELMTLATWVGGNLEDPT
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU726885_HBc_P-D Product feature CHAIN EU726885_HBc_P-D of FT:mat_peptide EU726885_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3170). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|EU726886_HBc_P-D Product feature CHAIN EU726886_HBc_P-D of FT:mat_peptide EU726886_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6836). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESNEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU726887_HBc_P-D Product feature CHAIN EU726887_HBc_P-D of FT:mat_peptide EU726887_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4652). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726888_HBc_P-D Product feature CHAIN EU726888_HBc_P-D of FT:mat_peptide EU726888_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-N001). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726891_HBc_P-D Product feature CHAIN EU726891_HBc_P-D of FT:mat_peptide EU726891_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6847). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESTEHCSPHHTALRQAILCWGDLITLSTWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|EU726892_HBc_P-D Product feature CHAIN EU726892_HBc_P-D of FT:mat_peptide EU726892_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7077). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSMLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726893_HBc_P-D Product feature CHAIN EU726893_HBc_P-D of FT:mat_peptide EU726893_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4661). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726894_HBc_P-D Product feature CHAIN EU726894_HBc_P-D of FT:mat_peptide EU726894_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3171). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726895_HBc_P-D Product feature CHAIN EU726895_HBc_P-D of FT:mat_peptide EU726895_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6021). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726897_HBc_P-D Product feature CHAIN EU726897_HBc_P-D of FT:mat_peptide EU726897_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7563). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMQLATWVGGNLDDPT
SRDLVVGYVNTHMGLKFRQLLWFHVSCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726898_HBc_P-D Product feature CHAIN EU726898_HBc_P-D of FT:mat_peptide EU726898_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4765). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726899_HBc_P-D Product feature CHAIN EU726899_HBc_P-D of FT:mat_peptide EU726899_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-0.02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726900_HBc_P-D Product feature CHAIN EU726900_HBc_P-D of FT:mat_peptide EU726900_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7132). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726901_HBc_P-D Product feature CHAIN EU726901_HBc_P-D of FT:mat_peptide EU726901_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-5779). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTHMGLKFRQLLWFHVSCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRCRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726902_HBc_P-D Product feature CHAIN EU726902_HBc_P-D of FT:mat_peptide EU726902_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7145). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726904_HBc_P-D Product feature CHAIN EU726904_HBc_P-D of FT:mat_peptide EU726904_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-0.05). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHVSLCWGDLMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726905_HBc_P-D Product feature CHAIN EU726905_HBc_P-D of FT:mat_peptide EU726905_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3892). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLSFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726906_HBc_P-D Product feature CHAIN EU726906_HBc_P-D of FT:mat_peptide EU726906_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-0.06). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726907_HBc_P-D Product feature CHAIN EU726907_HBc_P-D of FT:mat_peptide EU726907_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3861). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726909_HBc_P-D Product feature CHAIN EU726909_HBc_P-D of FT:mat_peptide EU726909_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4653). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726910_HBc_P-D Product feature CHAIN EU726910_HBc_P-D of FT:mat_peptide EU726910_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7149). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726911_HBc_P-D Product feature CHAIN EU726911_HBc_P-D of FT:mat_peptide EU726911_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7150). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726912_HBc_P-D Product feature CHAIN EU726912_HBc_P-D of FT:mat_peptide EU726912_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7063). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVSEYLVSFGVWIRTPPAYRPPNAPILSTLPEVAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|EU726914_HBc_P-D Product feature CHAIN EU726914_HBc_P-D of FT:mat_peptide EU726914_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3865). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726917_HBc_P-D Product feature CHAIN EU726917_HBc_P-D of FT:mat_peptide EU726917_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4755). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726918_HBc_P-D Product feature CHAIN EU726918_HBc_P-D of FT:mat_peptide EU726918_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-2336). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726919_HBc_P-D Product feature CHAIN EU726919_HBc_P-D of FT:mat_peptide EU726919_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-0.08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726921_HBc_P-D Product feature CHAIN EU726921_HBc_P-D of FT:mat_peptide EU726921_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L034). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726922_HBc_P-D Product feature CHAIN EU726922_HBc_P-D of FT:mat_peptide EU726922_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L033). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726923_HBc_P-D Product feature CHAIN EU726923_HBc_P-D of FT:mat_peptide EU726923_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L025). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726924_HBc_P-D Product feature CHAIN EU726924_HBc_P-D of FT:mat_peptide EU726924_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L002). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726925_HBc_P-D Product feature CHAIN EU726925_HBc_P-D of FT:mat_peptide EU726925_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L012). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|EU726926_HBc_P-D Product feature CHAIN EU726926_HBc_P-D of FT:mat_peptide EU726926_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L001). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU726929_HBc_P-D Product feature CHAIN EU726929_HBc_P-D of FT:mat_peptide EU726929_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L035). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMSLATWVGGNLEDPT
SRDLVVSYVNTNMGIKFRQLLWFHISCLMFGRDTVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726930_HBc_P-D Product feature CHAIN EU726930_HBc_P-D of FT:mat_peptide EU726930_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726931_HBc_P-D Product feature CHAIN EU726931_HBc_P-D of FT:mat_peptide EU726931_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-9954). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPESQC
>gnl|hbvpro|EU726932_HBc_P-D Product feature CHAIN EU726932_HBc_P-D of FT:mat_peptide EU726932_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-N002). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSAHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHLSCLTFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726933_HBc_P-D Product feature CHAIN EU726933_HBc_P-D of FT:mat_peptide EU726933_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7740). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNLATWVGGNLEDPP
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRSTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETSVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726935_HBc_P-D Product feature CHAIN EU726935_HBc_P-D of FT:mat_peptide EU726935_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L020). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRLQSRESQC
>gnl|hbvpro|EU726937_HBc_P-D Product feature CHAIN EU726937_HBc_P-D of FT:mat_peptide EU726937_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L003). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU726938_HBc_P-D Product feature CHAIN EU726938_HBc_P-D of FT:mat_peptide EU726938_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L005). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRKSQSPRRRRTPSREPQC
>gnl|hbvpro|EU726940_HBc_P-D Product feature CHAIN EU726940_HBc_P-D of FT:mat_peptide EU726940_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L016). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726941_HBc_P-D Product feature CHAIN EU726941_HBc_P-D of FT:mat_peptide EU726941_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L022). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTMGLKFRQLLWFHISCLTFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726943_HBc_P-D Product feature CHAIN EU726943_HBc_P-D of FT:mat_peptide EU726943_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6821). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRDQSREPQC
>gnl|hbvpro|EU726944_HBc_P-D Product feature CHAIN EU726944_HBc_P-D of FT:mat_peptide EU726944_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8121). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLQDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU726945_HBc_P-D Product feature CHAIN EU726945_HBc_P-D of FT:mat_peptide EU726945_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8102). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRRQCRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU726946_HBc_P-D Product feature CHAIN EU726946_HBc_P-D of FT:mat_peptide EU726946_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8114). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726947_HBc_P-D Product feature CHAIN EU726947_HBc_P-D of FT:mat_peptide EU726947_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8109). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU726950_HBc_P-D Product feature CHAIN EU726950_HBc_P-D of FT:mat_peptide EU726950_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3863). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|EU726951_HBc_P-D Product feature CHAIN EU726951_HBc_P-D of FT:mat_peptide EU726951_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3554). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU726952_HBc_P-D Product feature CHAIN EU726952_HBc_P-D of FT:mat_peptide EU726952_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-1927). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU726954_HBc_P-D Product feature CHAIN EU726954_HBc_P-D of FT:mat_peptide EU726954_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4965). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726957_HBc_P-D Product feature CHAIN EU726957_HBc_P-D of FT:mat_peptide EU726957_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8130). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726958_HBc_P-D Product feature CHAIN EU726958_HBc_P-D of FT:mat_peptide EU726958_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8111). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLAFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726959_HBc_P-D Product feature CHAIN EU726959_HBc_P-D of FT:mat_peptide EU726959_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8108). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726960_HBc_P-D Product feature CHAIN EU726960_HBc_P-D of FT:mat_peptide EU726960_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8122). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|EU726961_HBc_P-D Product feature CHAIN EU726961_HBc_P-D of FT:mat_peptide EU726961_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8232). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRCRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726962_HBc_P-D Product feature CHAIN EU726962_HBc_P-D of FT:mat_peptide EU726962_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726963_HBc_P-D Product feature CHAIN EU726963_HBc_P-D of FT:mat_peptide EU726963_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7113). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSHVSQC
>gnl|hbvpro|EU726964_HBc_P-D Product feature CHAIN EU726964_HBc_P-D of FT:mat_peptide EU726964_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8118). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726965_HBc_P-D Product feature CHAIN EU726965_HBc_P-D of FT:mat_peptide EU726965_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8123). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726967_HBc_P-D Product feature CHAIN EU726967_HBc_P-D of FT:mat_peptide EU726967_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3257). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726969_HBc_P-D Product feature CHAIN EU726969_HBc_P-D of FT:mat_peptide EU726969_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L023). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSRC
>gnl|hbvpro|EU726970_HBc_P-D Product feature CHAIN EU726970_HBc_P-D of FT:mat_peptide EU726970_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L026). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGSNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726971_HBc_P-D Product feature CHAIN EU726971_HBc_P-D of FT:mat_peptide EU726971_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8142). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726972_HBc_P-D Product feature CHAIN EU726972_HBc_P-D of FT:mat_peptide EU726972_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-9550). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726973_HBc_P-D Product feature CHAIN EU726973_HBc_P-D of FT:mat_peptide EU726973_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8124). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTGSALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|EU726975_HBc_P-D Product feature CHAIN EU726975_HBc_P-D of FT:mat_peptide EU726975_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L028). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPT
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRPTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726976_HBc_P-D Product feature CHAIN EU726976_HBc_P-D of FT:mat_peptide EU726976_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L029). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726977_HBc_P-D Product feature CHAIN EU726977_HBc_P-D of FT:mat_peptide EU726977_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7067). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU726979_HBc_P-D Product feature CHAIN EU726979_HBc_P-D of FT:mat_peptide EU726979_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3068). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGSNLDDPT
SRDLVVSYVNTHMGLKFRQLLWFHLSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSPSRESQC
>gnl|hbvpro|EU787436_HBc_P-D Product feature CHAIN EU787436_HBc_P-D of FT:mat_peptide EU787436_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 165). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGSNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU787437_HBc_P-D Product feature CHAIN EU787437_HBc_P-D of FT:mat_peptide EU787437_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU787438_HBc_P-D Product feature CHAIN EU787438_HBc_P-D of FT:mat_peptide EU787438_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU787439_HBc_P-D Product feature CHAIN EU787439_HBc_P-D of FT:mat_peptide EU787439_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 89). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWGGGNLEDPI
SRDLIVSYVNTNMGLKFKQLLGFHISCLTFGRKTVIEYLVSFGVWIPTPPAYKPPNAPILSTLPETTVVRQRGRSPRRRP
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU787440_HBc_P-D Product feature CHAIN EU787440_HBc_P-D of FT:mat_peptide EU787440_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU787441_HBc_P-D Product feature CHAIN EU787441_HBc_P-D of FT:mat_peptide EU787441_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU787442_HBc_P-D Product feature CHAIN EU787442_HBc_P-D of FT:mat_peptide EU787442_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU787443_HBc_P-D Product feature CHAIN EU787443_HBc_P-D of FT:mat_peptide EU787443_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate w40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|EU787445_HBc_P-D Product feature CHAIN EU787445_HBc_P-D of FT:mat_peptide EU787445_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W51). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU787446_HBc_P-D Product feature CHAIN EU787446_HBc_P-D of FT:mat_peptide EU787446_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W75). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU787447_HBc_P-D Product feature CHAIN EU787447_HBc_P-D of FT:mat_peptide EU787447_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU919197_HBc_P-D Product feature CHAIN EU919197_HBc_P-D of FT:mat_peptide EU919197_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJU). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPCKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU921418_HBc_P-D Product feature CHAIN EU921418_HBc_P-D of FT:mat_peptide EU921418_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.165.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHLSCLTFGRQTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU921419_HBc_P-D Product feature CHAIN EU921419_HBc_P-D of FT:mat_peptide EU921419_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.252.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939680_HBc_P-D Product feature CHAIN EU939680_HBc_P-D of FT:mat_peptide EU939680_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C186). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRYPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU939681_HBc_P-D Product feature CHAIN EU939681_HBc_P-D of FT:mat_peptide EU939681_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAFRPQNAPILSTLPETTVVRRRSRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ040872_HBc_P-D Product feature CHAIN FJ040872_HBc_P-D of FT:mat_peptide FJ040872_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRR
TPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349205_HBc_P-D Product feature CHAIN FJ349205_HBc_P-D of FT:mat_peptide FJ349205_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349206_HBc_P-D Product feature CHAIN FJ349206_HBc_P-D of FT:mat_peptide FJ349206_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSPSRESQC
>gnl|hbvpro|FJ349208_HBc_P-D Product feature CHAIN FJ349208_HBc_P-D of FT:mat_peptide FJ349208_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQACLCWGELMTLATWVGANLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|FJ349209_HBc_P-D Product feature CHAIN FJ349209_HBc_P-D of FT:mat_peptide FJ349209_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349211_HBc_P-D Product feature CHAIN FJ349211_HBc_P-D of FT:mat_peptide FJ349211_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H34). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLATWVGANLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|FJ349213_HBc_P-D Product feature CHAIN FJ349213_HBc_P-D of FT:mat_peptide FJ349213_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H59). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETCVVRQRHRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349214_HBc_P-D Product feature CHAIN FJ349214_HBc_P-D of FT:mat_peptide FJ349214_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H61). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQS
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349215_HBc_P-D Product feature CHAIN FJ349215_HBc_P-D of FT:mat_peptide FJ349215_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H82). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349216_HBc_P-D Product feature CHAIN FJ349216_HBc_P-D of FT:mat_peptide FJ349216_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H113). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349217_HBc_P-D Product feature CHAIN FJ349217_HBc_P-D of FT:mat_peptide FJ349217_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H129). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ349218_HBc_P-D Product feature CHAIN FJ349218_HBc_P-D of FT:mat_peptide FJ349218_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H135). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349219_HBc_P-D Product feature CHAIN FJ349219_HBc_P-D of FT:mat_peptide FJ349219_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H138). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ349220_HBc_P-D Product feature CHAIN FJ349220_HBc_P-D of FT:mat_peptide FJ349220_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H144). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLATWVGGNLDDPT
SRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ349228_HBc_P-D Product feature CHAIN FJ349228_HBc_P-D of FT:mat_peptide FJ349228_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349229_HBc_P-D Product feature CHAIN FJ349229_HBc_P-D of FT:mat_peptide FJ349229_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349230_HBc_P-D Product feature CHAIN FJ349230_HBc_P-D of FT:mat_peptide FJ349230_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349231_HBc_P-D Product feature CHAIN FJ349231_HBc_P-D of FT:mat_peptide FJ349231_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349232_HBc_P-D Product feature CHAIN FJ349232_HBc_P-D of FT:mat_peptide FJ349232_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349233_HBc_P-D Product feature CHAIN FJ349233_HBc_P-D of FT:mat_peptide FJ349233_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C54). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349234_HBc_P-D Product feature CHAIN FJ349234_HBc_P-D of FT:mat_peptide FJ349234_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C82). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|FJ349235_HBc_P-D Product feature CHAIN FJ349235_HBc_P-D of FT:mat_peptide FJ349235_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C90). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ386590_HBc_P-D Product feature CHAIN FJ386590_HBc_P-D of FT:mat_peptide FJ386590_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1841). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ562338_HBc_P-D Product feature CHAIN FJ562338_HBc_P-D of FT:mat_peptide FJ562338_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I192). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692506_HBc_P-D Product feature CHAIN FJ692506_HBc_P-D of FT:mat_peptide FJ692506_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50157). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692507_HBc_P-D Product feature CHAIN FJ692507_HBc_P-D of FT:mat_peptide FJ692507_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50158). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692532_HBc_P-D Product feature CHAIN FJ692532_HBc_P-D of FT:mat_peptide FJ692532_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50053). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692533_HBc_P-D Product feature CHAIN FJ692533_HBc_P-D of FT:mat_peptide FJ692533_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50064). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ867953_HBc_P-D Product feature CHAIN FJ867953_HBc_P-D of FT:mat_peptide FJ867953_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCMPC43). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867957_HBc_P-D Product feature CHAIN FJ867957_HBc_P-D of FT:mat_peptide FJ867957_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCMPC86). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867963_HBc_P-D Product feature CHAIN FJ867963_HBc_P-D of FT:mat_peptide FJ867963_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC7). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867964_HBc_P-D Product feature CHAIN FJ867964_HBc_P-D of FT:mat_peptide FJ867964_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867965_HBc_P-D Product feature CHAIN FJ867965_HBc_P-D of FT:mat_peptide FJ867965_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC16). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867966_HBc_P-D Product feature CHAIN FJ867966_HBc_P-D of FT:mat_peptide FJ867966_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867968_HBc_P-D Product feature CHAIN FJ867968_HBc_P-D of FT:mat_peptide FJ867968_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC38). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867970_HBc_P-D Product feature CHAIN FJ867970_HBc_P-D of FT:mat_peptide FJ867970_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867972_HBc_P-D Product feature CHAIN FJ867972_HBc_P-D of FT:mat_peptide FJ867972_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC51). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867973_HBc_P-D Product feature CHAIN FJ867973_HBc_P-D of FT:mat_peptide FJ867973_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867974_HBc_P-D Product feature CHAIN FJ867974_HBc_P-D of FT:mat_peptide FJ867974_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC63). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867975_HBc_P-D Product feature CHAIN FJ867975_HBc_P-D of FT:mat_peptide FJ867975_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC72). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867977_HBc_P-D Product feature CHAIN FJ867977_HBc_P-D of FT:mat_peptide FJ867977_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC83). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867979_HBc_P-D Product feature CHAIN FJ867979_HBc_P-D of FT:mat_peptide FJ867979_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC89). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867981_HBc_P-D Product feature CHAIN FJ867981_HBc_P-D of FT:mat_peptide FJ867981_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC92). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867982_HBc_P-D Product feature CHAIN FJ867982_HBc_P-D of FT:mat_peptide FJ867982_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC95). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867983_HBc_P-D Product feature CHAIN FJ867983_HBc_P-D of FT:mat_peptide FJ867983_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867984_HBc_P-D Product feature CHAIN FJ867984_HBc_P-D of FT:mat_peptide FJ867984_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC139). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867996_HBc_P-D Product feature CHAIN FJ867996_HBc_P-D of FT:mat_peptide FJ867996_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LCNPC21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867998_HBc_P-D Product feature CHAIN FJ867998_HBc_P-D of FT:mat_peptide FJ867998_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LCNPC48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867999_HBc_P-D Product feature CHAIN FJ867999_HBc_P-D of FT:mat_peptide FJ867999_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LCNPC65). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868004_HBc_P-D Product feature CHAIN FJ868004_HBc_P-D of FT:mat_peptide FJ868004_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHMPC32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868005_HBc_P-D Product feature CHAIN FJ868005_HBc_P-D of FT:mat_peptide FJ868005_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHMPC46). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868009_HBc_P-D Product feature CHAIN FJ868009_HBc_P-D of FT:mat_peptide FJ868009_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNPC26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868010_HBc_P-D Product feature CHAIN FJ868010_HBc_P-D of FT:mat_peptide FJ868010_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNPC45). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868011_HBc_P-D Product feature CHAIN FJ868011_HBc_P-D of FT:mat_peptide FJ868011_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNPC69). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868012_HBc_P-D Product feature CHAIN FJ868012_HBc_P-D of FT:mat_peptide FJ868012_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNPC82). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868013_HBc_P-D Product feature CHAIN FJ868013_HBc_P-D of FT:mat_peptide FJ868013_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNPC93). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ899792_HBc_P-D Product feature CHAIN FJ899792_HBc_P-D of FT:mat_peptide FJ899792_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNMEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRAPPAFRPQNAPILSTLPETTVVRRRSRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904395_HBc_P-D Product feature CHAIN FJ904395_HBc_P-D of FT:mat_peptide FJ904395_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A10a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCSPHHTALRQATLCWGELMQLATWVGANLEDQT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRPTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904399_HBc_P-D Product feature CHAIN FJ904399_HBc_P-D of FT:mat_peptide FJ904399_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A18). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDVLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETSVVRRRGRSPRRRT
PSPRXRRXQSXRRRRSQSRESQCK
>gnl|hbvpro|FJ904402_HBc_P-D Product feature CHAIN FJ904402_HBc_P-D of FT:mat_peptide FJ904402_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPSRRRCQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904410_HBc_P-D Product feature CHAIN FJ904410_HBc_P-D of FT:mat_peptide FJ904410_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A54b). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTATALFRDALESPEHCSPHHTALRQAILCWGDVMNIATWVGVNLQDQA
SRDQVVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|FJ904412_HBc_P-D Product feature CHAIN FJ904412_HBc_P-D of FT:mat_peptide FJ904412_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A56). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTLGRDTVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904415_HBc_P-D Product feature CHAIN FJ904415_HBc_P-D of FT:mat_peptide FJ904415_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A63). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEHSVVRRRGRSPRRRT
PSRSSRRCQSAGSRRSQSRESQC
>gnl|hbvpro|FJ904418_HBc_P-D Product feature CHAIN FJ904418_HBc_P-D of FT:mat_peptide FJ904418_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A69a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPT
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904419_HBc_P-D Product feature CHAIN FJ904419_HBc_P-D of FT:mat_peptide FJ904419_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A70). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELLSLSTWVGVNLDNQA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRXTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904420_HBc_P-D Product feature CHAIN FJ904420_HBc_P-D of FT:mat_peptide FJ904420_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904421_HBc_P-D Product feature CHAIN FJ904421_HBc_P-D of FT:mat_peptide FJ904421_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71b). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904422_HBc_P-D Product feature CHAIN FJ904422_HBc_P-D of FT:mat_peptide FJ904422_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSLRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLVWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904424_HBc_P-D Product feature CHAIN FJ904424_HBc_P-D of FT:mat_peptide FJ904424_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A79a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ904426_HBc_P-D Product feature CHAIN FJ904426_HBc_P-D of FT:mat_peptide FJ904426_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDPT
SRDLVVSYVNNNMGVKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ904427_HBc_P-D Product feature CHAIN FJ904427_HBc_P-D of FT:mat_peptide FJ904427_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTSHHTALRQAILCWGELMTLATWVGSNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904429_HBc_P-D Product feature CHAIN FJ904429_HBc_P-D of FT:mat_peptide FJ904429_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPT
SRDLVVSYVNSHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPNAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FJ904432_HBc_P-D Product feature CHAIN FJ904432_HBc_P-D of FT:mat_peptide FJ904432_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPXRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|FJ904433_HBc_C-D Product feature CHAIN FJ904433_HBc_C-D of FT:mat_peptide FJ904433_HBc_C-D of [Viruses] Hepatitis B Virus genotype D (isolate B15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVNYVNSNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPPYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSREXQC
>gnl|hbvpro|FJ904435_HBc_P-D Product feature CHAIN FJ904435_HBc_P-D of FT:mat_peptide FJ904435_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPFDFFPSVRDFLDSALALYRDSLEFPEPCSPPHXALRPTLFCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904438_HBc_P-D Product feature CHAIN FJ904438_HBc_P-D of FT:mat_peptide FJ904438_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVVEYLVSFGVWIRTPPPYRPTNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|FJ904439_HBc_P-D Product feature CHAIN FJ904439_HBc_P-D of FT:mat_peptide FJ904439_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPANAPILSTLPETAVVRSRSRSLRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ904443_HBc_P-D Product feature CHAIN FJ904443_HBc_P-D of FT:mat_peptide FJ904443_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904445_HBc_P-D Product feature CHAIN FJ904445_HBc_P-D of FT:mat_peptide FJ904445_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B62). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLXVDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRFPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904446_HBc_P-D Product feature CHAIN FJ904446_HBc_P-D of FT:mat_peptide FJ904446_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B64a). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ167301_HBc_P-D Product feature CHAIN GQ167301_HBc_P-D of FT:mat_peptide GQ167301_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM452). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|GQ167302_HBc_P-D Product feature CHAIN GQ167302_HBc_P-D of FT:mat_peptide GQ167302_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4521). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|GQ183448_HBc_P-D Product feature CHAIN GQ183448_HBc_P-D of FT:mat_peptide GQ183448_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4629). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|GQ183449_HBc_P-D Product feature CHAIN GQ183449_HBc_P-D of FT:mat_peptide GQ183449_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4591). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183450_HBc_P-D Product feature CHAIN GQ183450_HBc_P-D of FT:mat_peptide GQ183450_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4589). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183451_HBc_P-D Product feature CHAIN GQ183451_HBc_P-D of FT:mat_peptide GQ183451_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4588). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183452_HBc_P-D Product feature CHAIN GQ183452_HBc_P-D of FT:mat_peptide GQ183452_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4590). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183453_HBc_P-D Product feature CHAIN GQ183453_HBc_P-D of FT:mat_peptide GQ183453_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4574). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183454_HBc_P-D Product feature CHAIN GQ183454_HBc_P-D of FT:mat_peptide GQ183454_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4582). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183455_HBc_P-D Product feature CHAIN GQ183455_HBc_P-D of FT:mat_peptide GQ183455_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4573). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183456_HBc_P-D Product feature CHAIN GQ183456_HBc_P-D of FT:mat_peptide GQ183456_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4572). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183457_HBc_P-D Product feature CHAIN GQ183457_HBc_P-D of FT:mat_peptide GQ183457_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4583). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183458_HBc_P-D Product feature CHAIN GQ183458_HBc_P-D of FT:mat_peptide GQ183458_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4587). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183459_HBc_P-D Product feature CHAIN GQ183459_HBc_P-D of FT:mat_peptide GQ183459_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4585). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183460_HBc_P-D Product feature CHAIN GQ183460_HBc_P-D of FT:mat_peptide GQ183460_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4584). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183461_HBc_P-D Product feature CHAIN GQ183461_HBc_P-D of FT:mat_peptide GQ183461_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4586). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183462_HBc_P-D Product feature CHAIN GQ183462_HBc_P-D of FT:mat_peptide GQ183462_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4567). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183463_HBc_P-D Product feature CHAIN GQ183463_HBc_P-D of FT:mat_peptide GQ183463_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4613). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183464_HBc_P-D Product feature CHAIN GQ183464_HBc_P-D of FT:mat_peptide GQ183464_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4703). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183465_HBc_P-D Product feature CHAIN GQ183465_HBc_P-D of FT:mat_peptide GQ183465_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4614). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183466_HBc_P-D Product feature CHAIN GQ183466_HBc_P-D of FT:mat_peptide GQ183466_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4577). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183467_HBc_P-D Product feature CHAIN GQ183467_HBc_P-D of FT:mat_peptide GQ183467_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4705). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183468_HBc_P-D Product feature CHAIN GQ183468_HBc_P-D of FT:mat_peptide GQ183468_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4632). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183469_HBc_P-D Product feature CHAIN GQ183469_HBc_P-D of FT:mat_peptide GQ183469_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4602). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183470_HBc_P-D Product feature CHAIN GQ183470_HBc_P-D of FT:mat_peptide GQ183470_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4639). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|GQ183471_HBc_P-D Product feature CHAIN GQ183471_HBc_P-D of FT:mat_peptide GQ183471_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4610). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183472_HBc_P-D Product feature CHAIN GQ183472_HBc_P-D of FT:mat_peptide GQ183472_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4691). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183473_HBc_P-D Product feature CHAIN GQ183473_HBc_P-D of FT:mat_peptide GQ183473_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4601). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ183474_HBc_P-D Product feature CHAIN GQ183474_HBc_P-D of FT:mat_peptide GQ183474_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4594). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ183475_HBc_P-D Product feature CHAIN GQ183475_HBc_P-D of FT:mat_peptide GQ183475_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4575). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVHTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRKT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183476_HBc_P-D Product feature CHAIN GQ183476_HBc_P-D of FT:mat_peptide GQ183476_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4603). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183477_HBc_P-D Product feature CHAIN GQ183477_HBc_P-D of FT:mat_peptide GQ183477_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4604). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183478_HBc_P-D Product feature CHAIN GQ183478_HBc_P-D of FT:mat_peptide GQ183478_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4605). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183479_HBc_P-D Product feature CHAIN GQ183479_HBc_P-D of FT:mat_peptide GQ183479_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4607). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183480_HBc_P-D Product feature CHAIN GQ183480_HBc_P-D of FT:mat_peptide GQ183480_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4609). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183481_HBc_P-D Product feature CHAIN GQ183481_HBc_P-D of FT:mat_peptide GQ183481_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4569). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183482_HBc_P-D Product feature CHAIN GQ183482_HBc_P-D of FT:mat_peptide GQ183482_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4570). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183483_HBc_P-D Product feature CHAIN GQ183483_HBc_P-D of FT:mat_peptide GQ183483_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4566). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ183484_HBc_P-D Product feature CHAIN GQ183484_HBc_P-D of FT:mat_peptide GQ183484_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4598). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ184322_HBc_P-D Product feature CHAIN GQ184322_HBc_P-D of FT:mat_peptide GQ184322_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4522). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSRSPRRRRSKSRDSQC
>gnl|hbvpro|GQ205380_HBc_P-D Product feature CHAIN GQ205380_HBc_P-D of FT:mat_peptide GQ205380_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1245). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|GQ205382_HBc_P-D Product feature CHAIN GQ205382_HBc_P-D of FT:mat_peptide GQ205382_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1360d). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|GQ205384_HBc_P-D Product feature CHAIN GQ205384_HBc_P-D of FT:mat_peptide GQ205384_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1434d). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|GQ205385_HBc_P-D Product feature CHAIN GQ205385_HBc_P-D of FT:mat_peptide GQ205385_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1469). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAFRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|GQ205388_HBc_P-D Product feature CHAIN GQ205388_HBc_P-D of FT:mat_peptide GQ205388_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1562). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|GQ205389_HBc_P-D Product feature CHAIN GQ205389_HBc_P-D of FT:mat_peptide GQ205389_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1667). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|GQ377589_HBc_P-D Product feature CHAIN GQ377589_HBc_P-D of FT:mat_peptide GQ377589_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate J145). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477452_HBc_P-D Product feature CHAIN GQ477452_HBc_P-D of FT:mat_peptide GQ477452_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477453_HBc_P-D Product feature CHAIN GQ477453_HBc_P-D of FT:mat_peptide GQ477453_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P39). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDQG
SRDLVVSYVNTHMGLKFRQLLWFHVSCLMFGRAVVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETSVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|GQ477454_HBc_P-D Product feature CHAIN GQ477454_HBc_P-D of FT:mat_peptide GQ477454_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P68). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIEPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477455_HBc_P-D Product feature CHAIN GQ477455_HBc_P-D of FT:mat_peptide GQ477455_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P73). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRHLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ477456_HBc_P-D Product feature CHAIN GQ477456_HBc_P-D of FT:mat_peptide GQ477456_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P84). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPTVRDLLDTASALYREALESPEHVSAHHTALRQAILCWGDLMTLATWVGANLDDPQ
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRPRSKSPRRRRSQSRESKC
>gnl|hbvpro|GQ477457_HBc_P-D Product feature CHAIN GQ477457_HBc_P-D of FT:mat_peptide GQ477457_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P118). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477458_HBc_P-D Product feature CHAIN GQ477458_HBc_P-D of FT:mat_peptide GQ477458_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P126). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDYFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ477459_HBc_P-D Product feature CHAIN GQ477459_HBc_P-D of FT:mat_peptide GQ477459_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P127). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ922000_HBc_P-D Product feature CHAIN GQ922000_HBc_P-D of FT:mat_peptide GQ922000_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3552). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAPLLSFLPHDFFPSIRDLLDTATALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGVNLEDPT
FRERVVSYVNDNMGLKFRQLLWFHISCLTFGRDVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|GQ922001_HBc_P-D Product feature CHAIN GQ922001_HBc_P-D of FT:mat_peptide GQ922001_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3654). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ922002_HBc_P-D Product feature CHAIN GQ922002_HBc_P-D of FT:mat_peptide GQ922002_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3624). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ922003_HBc_P-D Product feature CHAIN GQ922003_HBc_P-D of FT:mat_peptide GQ922003_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3225). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTAAALYRNALESPEHCSPHHTAIRQAILCWGELMXLATWVGANLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ922004_HBc_P-D Product feature CHAIN GQ922004_HBc_P-D of FT:mat_peptide GQ922004_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3284). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYRDALESPHHCSPHHTALRQAILCWGDLMNLATWVGTNLEDPA
SRDQVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ922005_HBc_P-D Product feature CHAIN GQ922005_HBc_P-D of FT:mat_peptide GQ922005_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B2894). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTAAALFRDALESPEHCSAHHTAIRQAVLCWGELIGLATWVGTNLEDQA
SRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|GQ924652_HBc_P-D Product feature CHAIN GQ924652_HBc_P-D of FT:mat_peptide GQ924652_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M89). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|GU357846_HBc_P-D Product feature CHAIN GU357846_HBc_P-D of FT:mat_peptide GU357846_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456635_HBc_P-D Product feature CHAIN GU456635_HBc_P-D of FT:mat_peptide GU456635_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAFLCWGELMNLATWVGVNLEDPA
SRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|GU456636_HBc_P-D Product feature CHAIN GU456636_HBc_P-D of FT:mat_peptide GU456636_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456637_HBc_P-D Product feature CHAIN GU456637_HBc_P-D of FT:mat_peptide GU456637_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T49). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDAASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVLEFLVSFGVWIRTPPAYRPTNAPILSTLPETCVVRRRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456638_HBc_P-D Product feature CHAIN GU456638_HBc_P-D of FT:mat_peptide GU456638_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRFPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456639_HBc_P-D Product feature CHAIN GU456639_HBc_P-D of FT:mat_peptide GU456639_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T129). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGASVELLSFLPQDFYPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGGNLEDQT
SRDLVVTYVNTNMGLKFRQLLWFHVSCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRSHRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456640_HBc_P-D Product feature CHAIN GU456640_HBc_P-D of FT:mat_peptide GU456640_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456641_HBc_P-D Product feature CHAIN GU456641_HBc_P-D of FT:mat_peptide GU456641_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T53). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVQLLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|GU456642_HBc_P-D Product feature CHAIN GU456642_HBc_P-D of FT:mat_peptide GU456642_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T70). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPNDFFPSLRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLIVTYVNTNMGLKFRQLLWFHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|GU456643_HBc_P-D Product feature CHAIN GU456643_HBc_P-D of FT:mat_peptide GU456643_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T52). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLEDPT
SRDLVVSYVNTTIGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPPYRPQNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456644_HBc_P-D Product feature CHAIN GU456644_HBc_P-D of FT:mat_peptide GU456644_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T58). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAISCWGDLLNLSTWVGSNLEDQT
SRDLVVSYVNTTSGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456645_HBc_P-D Product feature CHAIN GU456645_HBc_P-D of FT:mat_peptide GU456645_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T80). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRESLESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|GU456646_HBc_P-D Product feature CHAIN GU456646_HBc_P-D of FT:mat_peptide GU456646_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T77). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456647_HBc_P-D Product feature CHAIN GU456647_HBc_P-D of FT:mat_peptide GU456647_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T130). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRESLESPEHCSLHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRCKSRESQC
>gnl|hbvpro|GU456648_HBc_P-D Product feature CHAIN GU456648_HBc_P-D of FT:mat_peptide GU456648_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T85). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456649_HBc_P-D Product feature CHAIN GU456649_HBc_P-D of FT:mat_peptide GU456649_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T57). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456650_HBc_P-D Product feature CHAIN GU456650_HBc_P-D of FT:mat_peptide GU456650_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T62). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAFLCWGELMNLATWVGGNLEDPT
SRDLIVSYVNTNMGLKFRQLLWFHISCLNFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456651_HBc_P-D Product feature CHAIN GU456651_HBc_P-D of FT:mat_peptide GU456651_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASIELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPPC
>gnl|hbvpro|GU456652_HBc_P-D Product feature CHAIN GU456652_HBc_P-D of FT:mat_peptide GU456652_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456653_HBc_P-D Product feature CHAIN GU456653_HBc_P-D of FT:mat_peptide GU456653_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T59). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456654_HBc_P-D Product feature CHAIN GU456654_HBc_P-D of FT:mat_peptide GU456654_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T39). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGGNLEDQQ
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|GU456655_HBc_P-D Product feature CHAIN GU456655_HBc_P-D of FT:mat_peptide GU456655_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T95). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAFLCWGELMNLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456656_HBc_P-D Product feature CHAIN GU456656_HBc_P-D of FT:mat_peptide GU456656_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHDHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456657_HBc_P-D Product feature CHAIN GU456657_HBc_P-D of FT:mat_peptide GU456657_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T83). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGDLTNLATWVGGNLDDPT
SRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPVAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|GU456658_HBc_P-D Product feature CHAIN GU456658_HBc_P-D of FT:mat_peptide GU456658_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T114). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASIELLSFLPTDFFPSVRDLLDTASALFREPLESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456659_HBc_P-D Product feature CHAIN GU456659_HBc_P-D of FT:mat_peptide GU456659_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFSPHDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456660_HBc_P-D Product feature CHAIN GU456660_HBc_P-D of FT:mat_peptide GU456660_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T64). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456661_HBc_P-D Product feature CHAIN GU456661_HBc_P-D of FT:mat_peptide GU456661_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T99). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456662_HBc_P-D Product feature CHAIN GU456662_HBc_P-D of FT:mat_peptide GU456662_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T23). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456663_HBc_P-D Product feature CHAIN GU456663_HBc_P-D of FT:mat_peptide GU456663_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T86). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456664_HBc_P-D Product feature CHAIN GU456664_HBc_P-D of FT:mat_peptide GU456664_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAILCWGDLMNLATWVGSNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHLSCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456665_HBc_P-D Product feature CHAIN GU456665_HBc_P-D of FT:mat_peptide GU456665_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELITLSTWVGGNLEDPT
SRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456666_HBc_P-D Product feature CHAIN GU456666_HBc_P-D of FT:mat_peptide GU456666_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRHACLCWGDLMNLATWVGGNLEDPT
SRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRQTVVEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456667_HBc_P-D Product feature CHAIN GU456667_HBc_P-D of FT:mat_peptide GU456667_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T120). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456668_HBc_P-D Product feature CHAIN GU456668_HBc_P-D of FT:mat_peptide GU456668_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRQRSRFPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456669_HBc_P-D Product feature CHAIN GU456669_HBc_P-D of FT:mat_peptide GU456669_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T94). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVRSRRRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|GU456670_HBc_P-D Product feature CHAIN GU456670_HBc_P-D of FT:mat_peptide GU456670_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|GU456671_HBc_P-D Product feature CHAIN GU456671_HBc_P-D of FT:mat_peptide GU456671_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T56). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVNYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|GU456672_HBc_P-D Product feature CHAIN GU456672_HBc_P-D of FT:mat_peptide GU456672_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T73). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATTELLSFLPMDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMSLATWVGGNLEDQT
SRDLVVSYVNTNMGLKFRQILWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456673_HBc_P-D Product feature CHAIN GU456673_HBc_P-D of FT:mat_peptide GU456673_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T75). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFYPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456674_HBc_P-D Product feature CHAIN GU456674_HBc_P-D of FT:mat_peptide GU456674_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPADFFPSVRDLLDTAAALYRDALESHDHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPHRRRSQSRGSQC
>gnl|hbvpro|GU456675_HBc_P-D Product feature CHAIN GU456675_HBc_P-D of FT:mat_peptide GU456675_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASIELLSFLPSDFFPSVRDLLDTAAALYRDALESQEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHVSCLMFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456676_HBc_P-D Product feature CHAIN GU456676_HBc_P-D of FT:mat_peptide GU456676_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T98). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456677_HBc_P-D Product feature CHAIN GU456677_HBc_P-D of FT:mat_peptide GU456677_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMALATWVGGNLEDQT
SRDLVVRYVNTNMGLKFRQLLWFHVSCLIFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456678_HBc_P-D Product feature CHAIN GU456678_HBc_P-D of FT:mat_peptide GU456678_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T97). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAYLCWGELLGLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREMVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456679_HBc_P-D Product feature CHAIN GU456679_HBc_P-D of FT:mat_peptide GU456679_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T63). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPVDFYPSVRDLLDTASALYREALESPQHVSPHHTALRQAILCWGDLITLSTWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRGRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|GU456680_HBc_P-D Product feature CHAIN GU456680_HBc_P-D of FT:mat_peptide GU456680_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T88). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456681_HBc_P-D Product feature CHAIN GU456681_HBc_P-D of FT:mat_peptide GU456681_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T79). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAPALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU456682_HBc_P-D Product feature CHAIN GU456682_HBc_P-D of FT:mat_peptide GU456682_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAFLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLMFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVIRQRSRSSRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU456683_HBc_P-D Product feature CHAIN GU456683_HBc_P-D of FT:mat_peptide GU456683_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T101). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|GU456684_HBc_P-D Product feature CHAIN GU456684_HBc_P-D of FT:mat_peptide GU456684_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T60). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMSLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETCVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HE805987_HBc_P-D Product feature CHAIN HE805987_HBc_P-D of FT:mat_peptide HE805987_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 11999). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
LVMGHHKEFGATVELLSFLPSDFFPSVRXLLDTASAIYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTBMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM042266_HBc_P-D Product feature CHAIN HM042266_HBc_P-D of FT:mat_peptide HM042266_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 472). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIHTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|HM042267_HBc_P-D Product feature CHAIN HM042267_HBc_P-D of FT:mat_peptide HM042267_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 473). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM042272_HBc_P-D Product feature CHAIN HM042272_HBc_P-D of FT:mat_peptide HM042272_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 478). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM042273_HBc_P-D Product feature CHAIN HM042273_HBc_P-D of FT:mat_peptide HM042273_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 479). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM042276_HBc_P-D Product feature CHAIN HM042276_HBc_P-D of FT:mat_peptide HM042276_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 482). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM042277_HBc_P-D Product feature CHAIN HM042277_HBc_P-D of FT:mat_peptide HM042277_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 483). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM042283_HBc_P-D Product feature CHAIN HM042283_HBc_P-D of FT:mat_peptide HM042283_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 489). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750151_HBc_P-D Product feature CHAIN HM750151_HBc_P-D of FT:mat_peptide HM750151_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSD-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750152_HBc_P-D Product feature CHAIN HM750152_HBc_P-D of FT:mat_peptide HM750152_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate QHN-99). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRKRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750153_HBc_P-D Product feature CHAIN HM750153_HBc_P-D of FT:mat_peptide HM750153_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJW-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750154_HBc_P-D Product feature CHAIN HM750154_HBc_P-D of FT:mat_peptide HM750154_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XGW-23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750155_HBc_P-D Product feature CHAIN HM750155_HBc_P-D of FT:mat_peptide HM750155_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCLGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM750156_HBc_P-D Product feature CHAIN HM750156_HBc_P-D of FT:mat_peptide HM750156_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ236014_HBc_P-D Product feature CHAIN HQ236014_HBc_P-D of FT:mat_peptide HQ236014_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ236015_HBc_P-D Product feature CHAIN HQ236015_HBc_P-D of FT:mat_peptide HQ236015_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|HQ236016_HBc_P-D Product feature CHAIN HQ236016_HBc_P-D of FT:mat_peptide HQ236016_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|HQ641710_HBc_P-D Product feature CHAIN HQ641710_HBc_P-D of FT:mat_peptide HQ641710_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|HQ700439_HBc_P-D Product feature CHAIN HQ700439_HBc_P-D of FT:mat_peptide HQ700439_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AD03_1999). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|HQ700440_HBc_P-D Product feature CHAIN HQ700440_HBc_P-D of FT:mat_peptide HQ700440_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AD05_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700441_HBc_P-D Product feature CHAIN HQ700441_HBc_P-D of FT:mat_peptide HQ700441_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN10_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700442_HBc_P-D Product feature CHAIN HQ700442_HBc_P-D of FT:mat_peptide HQ700442_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700443_HBc_P-D Product feature CHAIN HQ700443_HBc_P-D of FT:mat_peptide HQ700443_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700444_HBc_P-D Product feature CHAIN HQ700444_HBc_P-D of FT:mat_peptide HQ700444_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN19_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700445_HBc_P-D Product feature CHAIN HQ700445_HBc_P-D of FT:mat_peptide HQ700445_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700446_HBc_P-D Product feature CHAIN HQ700446_HBc_P-D of FT:mat_peptide HQ700446_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700447_HBc_P-D Product feature CHAIN HQ700447_HBc_P-D of FT:mat_peptide HQ700447_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700448_HBc_P-D Product feature CHAIN HQ700448_HBc_P-D of FT:mat_peptide HQ700448_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLMTLATWVGGNLEDPX
SRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700449_HBc_P-D Product feature CHAIN HQ700449_HBc_P-D of FT:mat_peptide HQ700449_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE06_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700450_HBc_P-D Product feature CHAIN HQ700450_HBc_P-D of FT:mat_peptide HQ700450_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE09_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700451_HBc_P-D Product feature CHAIN HQ700451_HBc_P-D of FT:mat_peptide HQ700451_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GI11_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700454_HBc_P-D Product feature CHAIN HQ700454_HBc_P-D of FT:mat_peptide HQ700454_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700455_HBc_P-D Product feature CHAIN HQ700455_HBc_P-D of FT:mat_peptide HQ700455_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPXXRRXQXPRRKRXQXRESQC
>gnl|hbvpro|HQ700458_HBc_P-D Product feature CHAIN HQ700458_HBc_P-D of FT:mat_peptide HQ700458_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE35_1997). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSAHHTALRQAILCWGDLMNLATWVGTNLEDQP
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|HQ700459_HBc_P-D Product feature CHAIN HQ700459_HBc_P-D of FT:mat_peptide HQ700459_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE55_1993). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700463_HBc_P-D Product feature CHAIN HQ700463_HBc_P-D of FT:mat_peptide HQ700463_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HI43_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRXTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700464_HBc_P-D Product feature CHAIN HQ700464_HBc_P-D of FT:mat_peptide HQ700464_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_KA40_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700466_HBc_P-D Product feature CHAIN HQ700466_HBc_P-D of FT:mat_peptide HQ700466_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700467_HBc_P-D Product feature CHAIN HQ700467_HBc_P-D of FT:mat_peptide HQ700467_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1999). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700468_HBc_P-D Product feature CHAIN HQ700468_HBc_P-D of FT:mat_peptide HQ700468_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI27_1984). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700469_HBc_P-D Product feature CHAIN HQ700469_HBc_P-D of FT:mat_peptide HQ700469_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700470_HBc_P-D Product feature CHAIN HQ700470_HBc_P-D of FT:mat_peptide HQ700470_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700471_HBc_P-D Product feature CHAIN HQ700471_HBc_P-D of FT:mat_peptide HQ700471_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO70_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700472_HBc_P-D Product feature CHAIN HQ700472_HBc_P-D of FT:mat_peptide HQ700472_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO77_1997). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|HQ700473_HBc_P-D Product feature CHAIN HQ700473_HBc_P-D of FT:mat_peptide HQ700473_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700474_HBc_P-D Product feature CHAIN HQ700474_HBc_P-D of FT:mat_peptide HQ700474_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSSLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700477_HBc_P-D Product feature CHAIN HQ700477_HBc_P-D of FT:mat_peptide HQ700477_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1984). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLMTLATWVGGNLEDPI
SRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700478_HBc_P-D Product feature CHAIN HQ700478_HBc_P-D of FT:mat_peptide HQ700478_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1994). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700479_HBc_P-D Product feature CHAIN HQ700479_HBc_P-D of FT:mat_peptide HQ700479_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA11_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700480_HBc_P-D Product feature CHAIN HQ700480_HBc_P-D of FT:mat_peptide HQ700480_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700481_HBc_P-D Product feature CHAIN HQ700481_HBc_P-D of FT:mat_peptide HQ700481_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHVILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700482_HBc_P-D Product feature CHAIN HQ700482_HBc_P-D of FT:mat_peptide HQ700482_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA40_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700483_HBc_P-D Product feature CHAIN HQ700483_HBc_P-D of FT:mat_peptide HQ700483_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA120_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700484_HBc_P-D Product feature CHAIN HQ700484_HBc_P-D of FT:mat_peptide HQ700484_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA229_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700487_HBc_P-D Product feature CHAIN HQ700487_HBc_P-D of FT:mat_peptide HQ700487_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TU25_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700488_HBc_P-D Product feature CHAIN HQ700488_HBc_P-D of FT:mat_peptide HQ700488_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1984). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700489_HBc_P-D Product feature CHAIN HQ700489_HBc_P-D of FT:mat_peptide HQ700489_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1999). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRXPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700510_HBc_P-D Product feature CHAIN HQ700510_HBc_P-D of FT:mat_peptide HQ700510_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_128225_2003). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTAXRQAILCWGELMTLATWVGVNLEDPA
SRELVVSYVNXNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700511_HBc_P-D Product feature CHAIN HQ700511_HBc_P-D of FT:mat_peptide HQ700511_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_164317_2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700512_HBc_P-D Product feature CHAIN HQ700512_HBc_P-D of FT:mat_peptide HQ700512_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_182089_2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700513_HBc_P-D Product feature CHAIN HQ700513_HBc_P-D of FT:mat_peptide HQ700513_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_16600_2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700514_HBc_P-D Product feature CHAIN HQ700514_HBc_P-D of FT:mat_peptide HQ700514_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_1664337_2001). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ700553_HBc_P-D Product feature CHAIN HQ700553_HBc_P-D of FT:mat_peptide HQ700553_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1999). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ833465_HBc_P-D Product feature CHAIN HQ833465_HBc_P-D of FT:mat_peptide HQ833465_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ833466_HBc_P-D Product feature CHAIN HQ833466_HBc_P-D of FT:mat_peptide HQ833466_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB26). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAXVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|HQ833467_HBc_P-D Product feature CHAIN HQ833467_HBc_P-D of FT:mat_peptide HQ833467_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ833468_HBc_P-D Product feature CHAIN HQ833468_HBc_P-D of FT:mat_peptide HQ833468_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB52). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPX
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|HQ833469_HBc_P-D Product feature CHAIN HQ833469_HBc_P-D of FT:mat_peptide HQ833469_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB79). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ833470_HBc_P-D Product feature CHAIN HQ833470_HBc_P-D of FT:mat_peptide HQ833470_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB80). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HQ833471_HBc_P-D Product feature CHAIN HQ833471_HBc_P-D of FT:mat_peptide HQ833471_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB97). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439692_HBc_P-D Product feature CHAIN JF439692_HBc_P-D of FT:mat_peptide JF439692_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN132). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439695_HBc_P-D Product feature CHAIN JF439695_HBc_P-D of FT:mat_peptide JF439695_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN135). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439696_HBc_P-D Product feature CHAIN JF439696_HBc_P-D of FT:mat_peptide JF439696_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439699_HBc_P-D Product feature CHAIN JF439699_HBc_P-D of FT:mat_peptide JF439699_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439700_HBc_P-D Product feature CHAIN JF439700_HBc_P-D of FT:mat_peptide JF439700_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN143). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNRGLKFRQLLWLHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASTLSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439701_HBc_P-D Product feature CHAIN JF439701_HBc_P-D of FT:mat_peptide JF439701_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN144). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNRGLKFRQLLWLHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASTLSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439703_HBc_P-D Product feature CHAIN JF439703_HBc_P-D of FT:mat_peptide JF439703_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN146). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439704_HBc_P-D Product feature CHAIN JF439704_HBc_P-D of FT:mat_peptide JF439704_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN149). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPTLSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439705_HBc_P-D Product feature CHAIN JF439705_HBc_P-D of FT:mat_peptide JF439705_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN150). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPTLSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439712_HBc_P-D Product feature CHAIN JF439712_HBc_P-D of FT:mat_peptide JF439712_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN158). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439718_HBc_P-D Product feature CHAIN JF439718_HBc_P-D of FT:mat_peptide JF439718_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN167). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVSTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754588_HBc_P-D Product feature CHAIN JF754588_HBc_P-D of FT:mat_peptide JF754588_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK61). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754590_HBc_P-D Product feature CHAIN JF754590_HBc_P-D of FT:mat_peptide JF754590_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDST
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754591_HBc_P-D Product feature CHAIN JF754591_HBc_P-D of FT:mat_peptide JF754591_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754592_HBc_P-D Product feature CHAIN JF754592_HBc_P-D of FT:mat_peptide JF754592_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK64). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPNDFFPSARDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDQH
SRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754593_HBc_P-D Product feature CHAIN JF754593_HBc_P-D of FT:mat_peptide JF754593_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK170). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTATALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNDNMGLKFRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754594_HBc_P-D Product feature CHAIN JF754594_HBc_P-D of FT:mat_peptide JF754594_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK165). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALFRQDLESPEHVSAHHTALRQAILCWGELMNLATWVGGNLDDPT
SRDQVVSYVNTNMGLKFRQLLWFHISCISFGRTTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754595_HBc_P-D Product feature CHAIN JF754595_HBc_P-D of FT:mat_peptide JF754595_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK164). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|JF754596_HBc_P-D Product feature CHAIN JF754596_HBc_P-D of FT:mat_peptide JF754596_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK106). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754597_HBc_P-D Product feature CHAIN JF754597_HBc_P-D of FT:mat_peptide JF754597_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK105). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754598_HBc_P-D Product feature CHAIN JF754598_HBc_P-D of FT:mat_peptide JF754598_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK104). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754599_HBc_P-D Product feature CHAIN JF754599_HBc_P-D of FT:mat_peptide JF754599_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK173). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754600_HBc_P-D Product feature CHAIN JF754600_HBc_P-D of FT:mat_peptide JF754600_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK91). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPT
SRDLVVSYVNSNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPPYRPANAPILSTLPETAVIRPRGRSLRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754601_HBc_P-D Product feature CHAIN JF754601_HBc_P-D of FT:mat_peptide JF754601_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK88). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754602_HBc_P-D Product feature CHAIN JF754602_HBc_P-D of FT:mat_peptide JF754602_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK83). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETAVVRPRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754603_HBc_P-D Product feature CHAIN JF754603_HBc_P-D of FT:mat_peptide JF754603_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTHMGIKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JF754604_HBc_P-D Product feature CHAIN JF754604_HBc_P-D of FT:mat_peptide JF754604_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK79). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHVSAHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF754605_HBc_P-D Product feature CHAIN JF754605_HBc_P-D of FT:mat_peptide JF754605_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK77). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754606_HBc_P-D Product feature CHAIN JF754606_HBc_P-D of FT:mat_peptide JF754606_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK73). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754607_HBc_P-D Product feature CHAIN JF754607_HBc_P-D of FT:mat_peptide JF754607_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPANAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF754608_HBc_P-D Product feature CHAIN JF754608_HBc_P-D of FT:mat_peptide JF754608_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK63). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754609_HBc_P-D Product feature CHAIN JF754609_HBc_P-D of FT:mat_peptide JF754609_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK45). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVQLLSFLPEDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNLATWVGSNLEPTA
RDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVIRRRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754610_HBc_P-D Product feature CHAIN JF754610_HBc_P-D of FT:mat_peptide JF754610_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK157). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754611_HBc_P-D Product feature CHAIN JF754611_HBc_P-D of FT:mat_peptide JF754611_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK152). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLMFGRHTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEATVIRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754612_HBc_P-D Product feature CHAIN JF754612_HBc_P-D of FT:mat_peptide JF754612_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK148). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTATALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNMGIKFRQLLWFHISCLMFGRDTVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETCVIRQRSRTSRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|JF754614_HBc_P-D Product feature CHAIN JF754614_HBc_P-D of FT:mat_peptide JF754614_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754615_HBc_P-D Product feature CHAIN JF754615_HBc_P-D of FT:mat_peptide JF754615_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK141). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754617_HBc_P-D Product feature CHAIN JF754617_HBc_P-D of FT:mat_peptide JF754617_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK131). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAGLYREALESPEHCSAHHTALRQAILCWGDLINLSTWVGSNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSMLPETSVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF754618_HBc_P-D Product feature CHAIN JF754618_HBc_P-D of FT:mat_peptide JF754618_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK129). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|JF754619_HBc_P-D Product feature CHAIN JF754619_HBc_P-D of FT:mat_peptide JF754619_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK62). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPPDFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|JF754621_HBc_P-D Product feature CHAIN JF754621_HBc_P-D of FT:mat_peptide JF754621_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK161). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGDLMTLATWVGANLQDPA
SRDQVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754622_HBc_P-D Product feature CHAIN JF754622_HBc_P-D of FT:mat_peptide JF754622_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK16). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCTPHHTALRQAILCWGDLMNLGTWVGANLQDQH
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754623_HBc_P-D Product feature CHAIN JF754623_HBc_P-D of FT:mat_peptide JF754623_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK171). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754624_HBc_P-D Product feature CHAIN JF754624_HBc_P-D of FT:mat_peptide JF754624_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754625_HBc_P-D Product feature CHAIN JF754625_HBc_P-D of FT:mat_peptide JF754625_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK25). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTAKALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLDDQG
SREQVVSYVNTNMGLKFRQILWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754626_HBc_P-D Product feature CHAIN JF754626_HBc_P-D of FT:mat_peptide JF754626_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPDDFFPSVRDLLDATSALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQT
SRDLVVSYVNTHMGLKFRQLLWFHFSCIMFGRETVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|JF754627_HBc_P-D Product feature CHAIN JF754627_HBc_P-D of FT:mat_peptide JF754627_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754628_HBc_P-D Product feature CHAIN JF754628_HBc_P-D of FT:mat_peptide JF754628_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754629_HBc_P-D Product feature CHAIN JF754629_HBc_P-D of FT:mat_peptide JF754629_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK176). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESHEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF754630_HBc_P-D Product feature CHAIN JF754630_HBc_P-D of FT:mat_peptide JF754630_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK175). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLCFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRVRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF754631_HBc_P-D Product feature CHAIN JF754631_HBc_P-D of FT:mat_peptide JF754631_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK193). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFYPSVRDLLDTASALYREALESPEHCTPHHTALRQAIICWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|JF754632_HBc_P-D Product feature CHAIN JF754632_HBc_P-D of FT:mat_peptide JF754632_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK186). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDST
SRDLVVSYVNTNMGLKFRQLLWFHISCLMFGRDIVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754633_HBc_P-D Product feature CHAIN JF754633_HBc_P-D of FT:mat_peptide JF754633_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK128). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF754634_HBc_P-D Product feature CHAIN JF754634_HBc_P-D of FT:mat_peptide JF754634_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JF754635_HBc_P-D Product feature CHAIN JF754635_HBc_P-D of FT:mat_peptide JF754635_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK113). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALFRQALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040750_HBc_P-D Product feature CHAIN JN040750_HBc_P-D of FT:mat_peptide JN040750_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919078). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN040751_HBc_P-D Product feature CHAIN JN040751_HBc_P-D of FT:mat_peptide JN040751_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919047). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040752_HBc_P-D Product feature CHAIN JN040752_HBc_P-D of FT:mat_peptide JN040752_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919033). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040753_HBc_P-D Product feature CHAIN JN040753_HBc_P-D of FT:mat_peptide JN040753_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919064). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGSNLEDPV
SRDLVVSYVNTNAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|JN040754_HBc_P-D Product feature CHAIN JN040754_HBc_P-D of FT:mat_peptide JN040754_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919045). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAGVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040755_HBc_P-D Product feature CHAIN JN040755_HBc_P-D of FT:mat_peptide JN040755_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919086). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|JN040756_HBc_P-D Product feature CHAIN JN040756_HBc_P-D of FT:mat_peptide JN040756_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919039). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|JN040757_HBc_P-D Product feature CHAIN JN040757_HBc_P-D of FT:mat_peptide JN040757_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919056). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040758_HBc_P-D Product feature CHAIN JN040758_HBc_P-D of FT:mat_peptide JN040758_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919037). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040759_HBc_P-D Product feature CHAIN JN040759_HBc_P-D of FT:mat_peptide JN040759_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919063). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040761_HBc_P-D Product feature CHAIN JN040761_HBc_P-D of FT:mat_peptide JN040761_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919002). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLPYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040762_HBc_P-D Product feature CHAIN JN040762_HBc_P-D of FT:mat_peptide JN040762_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919007). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRGALESSEHCSPHHTALRQAVLCWGDLINLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN040765_HBc_P-D Product feature CHAIN JN040765_HBc_P-D of FT:mat_peptide JN040765_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSILPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040766_HBc_P-D Product feature CHAIN JN040766_HBc_P-D of FT:mat_peptide JN040766_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919046). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREAQC
>gnl|hbvpro|JN040767_HBc_P-D Product feature CHAIN JN040767_HBc_P-D of FT:mat_peptide JN040767_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919019). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRASQC
>gnl|hbvpro|JN040768_HBc_P-D Product feature CHAIN JN040768_HBc_P-D of FT:mat_peptide JN040768_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919051). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLMFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040769_HBc_P-D Product feature CHAIN JN040769_HBc_P-D of FT:mat_peptide JN040769_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919015). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040770_HBc_P-D Product feature CHAIN JN040770_HBc_P-D of FT:mat_peptide JN040770_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919087). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040771_HBc_P-D Product feature CHAIN JN040771_HBc_P-D of FT:mat_peptide JN040771_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919013). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMSLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLISFGVWMRTPPAYRPPNAPILSTLPETSVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040772_HBc_P-D Product feature CHAIN JN040772_HBc_P-D of FT:mat_peptide JN040772_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919065). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN040773_HBc_P-D Product feature CHAIN JN040773_HBc_P-D of FT:mat_peptide JN040773_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919084). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESTEHCSPHHTALRQAILCWGDLITLSTWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|JN040774_HBc_P-D Product feature CHAIN JN040774_HBc_P-D of FT:mat_peptide JN040774_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919088). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTHMGLKFRQLLWFHVSCLTFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN040775_HBc_P-D Product feature CHAIN JN040775_HBc_P-D of FT:mat_peptide JN040775_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919049). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHVSLCWGDLMNLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040776_HBc_P-D Product feature CHAIN JN040776_HBc_P-D of FT:mat_peptide JN040776_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919043). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLQDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040777_HBc_P-D Product feature CHAIN JN040777_HBc_P-D of FT:mat_peptide JN040777_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919017). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|JN040778_HBc_P-D Product feature CHAIN JN040778_HBc_P-D of FT:mat_peptide JN040778_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919038). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040779_HBc_P-D Product feature CHAIN JN040779_HBc_P-D of FT:mat_peptide JN040779_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919070). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDQT
SRDLVVTYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040780_HBc_P-D Product feature CHAIN JN040780_HBc_P-D of FT:mat_peptide JN040780_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919072). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVQLLSFLPVDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAIICWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040781_HBc_P-D Product feature CHAIN JN040781_HBc_P-D of FT:mat_peptide JN040781_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919029). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQACLCWGELMNLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN040782_HBc_P-D Product feature CHAIN JN040782_HBc_P-D of FT:mat_peptide JN040782_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919041). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGSNLEDPV
SRDLVVSYVNTNAGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETSVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|JN040783_HBc_P-D Product feature CHAIN JN040783_HBc_P-D of FT:mat_peptide JN040783_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919090). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRCRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040784_HBc_P-D Product feature CHAIN JN040784_HBc_P-D of FT:mat_peptide JN040784_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919030). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040785_HBc_P-D Product feature CHAIN JN040785_HBc_P-D of FT:mat_peptide JN040785_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919022). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040786_HBc_P-D Product feature CHAIN JN040786_HBc_P-D of FT:mat_peptide JN040786_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919035). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040788_HBc_P-D Product feature CHAIN JN040788_HBc_P-D of FT:mat_peptide JN040788_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919024). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040790_HBc_P-D Product feature CHAIN JN040790_HBc_P-D of FT:mat_peptide JN040790_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919054). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040791_HBc_P-D Product feature CHAIN JN040791_HBc_P-D of FT:mat_peptide JN040791_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919082). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNSNMGLKFRQLLWFHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRFPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040792_HBc_P-D Product feature CHAIN JN040792_HBc_P-D of FT:mat_peptide JN040792_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919079). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGKLEDPI
SRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRFPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040793_HBc_P-D Product feature CHAIN JN040793_HBc_P-D of FT:mat_peptide JN040793_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919083). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRFPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040794_HBc_P-D Product feature CHAIN JN040794_HBc_P-D of FT:mat_peptide JN040794_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919075). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040795_HBc_P-D Product feature CHAIN JN040795_HBc_P-D of FT:mat_peptide JN040795_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919003). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALFREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|JN040796_HBc_P-D Product feature CHAIN JN040796_HBc_P-D of FT:mat_peptide JN040796_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919018). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKELGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN040797_HBc_P-D Product feature CHAIN JN040797_HBc_P-D of FT:mat_peptide JN040797_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919021). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040799_HBc_P-D Product feature CHAIN JN040799_HBc_P-D of FT:mat_peptide JN040799_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919080). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN040800_HBc_P-D Product feature CHAIN JN040800_HBc_P-D of FT:mat_peptide JN040800_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919012). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLATASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGGNLEDQT
SRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|JN040801_HBc_P-D Product feature CHAIN JN040801_HBc_P-D of FT:mat_peptide JN040801_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919042). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLATASALYREALESPEHCSPHHTALRQEILCWGELMNLATWVGGNLEDPT
SRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|JN040802_HBc_P-D Product feature CHAIN JN040802_HBc_P-D of FT:mat_peptide JN040802_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919074). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040804_HBc_P-D Product feature CHAIN JN040804_HBc_P-D of FT:mat_peptide JN040804_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919028). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN040805_HBc_P-D Product feature CHAIN JN040805_HBc_P-D of FT:mat_peptide JN040805_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919058). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040806_HBc_P-D Product feature CHAIN JN040806_HBc_P-D of FT:mat_peptide JN040806_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919066). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRFPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040807_HBc_P-D Product feature CHAIN JN040807_HBc_P-D of FT:mat_peptide JN040807_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919034). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040808_HBc_P-D Product feature CHAIN JN040808_HBc_P-D of FT:mat_peptide JN040808_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919011). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPHRRRSQSRESQC
>gnl|hbvpro|JN040809_HBc_P-D Product feature CHAIN JN040809_HBc_P-D of FT:mat_peptide JN040809_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919014). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040810_HBc_P-D Product feature CHAIN JN040810_HBc_P-D of FT:mat_peptide JN040810_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919060). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040811_HBc_P-D Product feature CHAIN JN040811_HBc_P-D of FT:mat_peptide JN040811_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919048). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|JN040812_HBc_P-D Product feature CHAIN JN040812_HBc_P-D of FT:mat_peptide JN040812_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919027). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLIVSYVNTNMGLKFRQILWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|JN040813_HBc_P-D Product feature CHAIN JN040813_HBc_P-D of FT:mat_peptide JN040813_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919025). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040814_HBc_P-D Product feature CHAIN JN040814_HBc_P-D of FT:mat_peptide JN040814_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919032). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN040815_HBc_P-D Product feature CHAIN JN040815_HBc_P-D of FT:mat_peptide JN040815_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919073). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040816_HBc_P-D Product feature CHAIN JN040816_HBc_P-D of FT:mat_peptide JN040816_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919016). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040817_HBc_P-D Product feature CHAIN JN040817_HBc_P-D of FT:mat_peptide JN040817_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919020). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN040818_HBc_P-D Product feature CHAIN JN040818_HBc_P-D of FT:mat_peptide JN040818_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919081). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISYLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040819_HBc_P-D Product feature CHAIN JN040819_HBc_P-D of FT:mat_peptide JN040819_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919067). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQILWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040820_HBc_P-D Product feature CHAIN JN040820_HBc_P-D of FT:mat_peptide JN040820_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919010). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040821_HBc_P-D Product feature CHAIN JN040821_HBc_P-D of FT:mat_peptide JN040821_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919085). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLQDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040822_HBc_P-D Product feature CHAIN JN040822_HBc_P-D of FT:mat_peptide JN040822_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919044). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040823_HBc_P-D Product feature CHAIN JN040823_HBc_P-D of FT:mat_peptide JN040823_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919005). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040824_HBc_P-D Product feature CHAIN JN040824_HBc_P-D of FT:mat_peptide JN040824_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919071). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN040826_HBc_P-D Product feature CHAIN JN040826_HBc_P-D of FT:mat_peptide JN040826_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919055). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040827_HBc_P-D Product feature CHAIN JN040827_HBc_P-D of FT:mat_peptide JN040827_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919008). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040828_HBc_P-D Product feature CHAIN JN040828_HBc_P-D of FT:mat_peptide JN040828_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919069). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLENPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040829_HBc_P-D Product feature CHAIN JN040829_HBc_P-D of FT:mat_peptide JN040829_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919089). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGSNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN040830_HBc_P-D Product feature CHAIN JN040830_HBc_P-D of FT:mat_peptide JN040830_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919052). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNVGLKFRQLLWFHISCLIFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN132126_HBc_P-D Product feature CHAIN JN132126_HBc_P-D of FT:mat_peptide JN132126_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-7642). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQCK
>gnl|hbvpro|JN132127_HBc_P-D Product feature CHAIN JN132127_HBc_P-D of FT:mat_peptide JN132127_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5204). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN132128_HBc_P-D Product feature CHAIN JN132128_HBc_P-D of FT:mat_peptide JN132128_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5256). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN132130_HBc_P-D Product feature CHAIN JN132130_HBc_P-D of FT:mat_peptide JN132130_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5314). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN132131_HBc_P-D Product feature CHAIN JN132131_HBc_P-D of FT:mat_peptide JN132131_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5255). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGGETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRCRKSQSRESQC
>gnl|hbvpro|JN132132_HBc_P-D Product feature CHAIN JN132132_HBc_P-D of FT:mat_peptide JN132132_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-7974). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN257148_HBc_P-D Product feature CHAIN JN257148_HBc_P-D of FT:mat_peptide JN257148_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMF). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|JN257149_HBc_P-D Product feature CHAIN JN257149_HBc_P-D of FT:mat_peptide JN257149_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSFN). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYREALESPEHCSPHHTALRQAILCWGXLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRXPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257150_HBc_P-D Product feature CHAIN JN257150_HBc_P-D of FT:mat_peptide JN257150_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABS). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257151_HBc_P-D Product feature CHAIN JN257151_HBc_P-D of FT:mat_peptide JN257151_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHHR). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257152_HBc_P-D Product feature CHAIN JN257152_HBc_P-D of FT:mat_peptide JN257152_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRJB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLXTLXTWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257153_HBc_P-D Product feature CHAIN JN257153_HBc_P-D of FT:mat_peptide JN257153_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMTLATWVGGNLQDPV
SRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVVEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257155_HBc_P-D Product feature CHAIN JN257155_HBc_P-D of FT:mat_peptide JN257155_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJHM1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257159_HBc_P-D Product feature CHAIN JN257159_HBc_P-D of FT:mat_peptide JN257159_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMRW). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257160_HBc_P-D Product feature CHAIN JN257160_HBc_P-D of FT:mat_peptide JN257160_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHATR1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN257161_HBc_P-D Product feature CHAIN JN257161_HBc_P-D of FT:mat_peptide JN257161_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHATR2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN257162_HBc_P-D Product feature CHAIN JN257162_HBc_P-D of FT:mat_peptide JN257162_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSDQ). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLZDXT
SRDLVVXYVNXNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257163_HBc_P-D Product feature CHAIN JN257163_HBc_P-D of FT:mat_peptide JN257163_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAZI). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVZLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN257165_HBc_P-D Product feature CHAIN JN257165_HBc_P-D of FT:mat_peptide JN257165_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDIVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN257166_HBc_P-D Product feature CHAIN JN257166_HBc_P-D of FT:mat_peptide JN257166_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL2). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDIVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN257169_HBc_P-D Product feature CHAIN JN257169_HBc_P-D of FT:mat_peptide JN257169_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAFF). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257170_HBc_P-D Product feature CHAIN JN257170_HBc_P-D of FT:mat_peptide JN257170_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJWB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN257171_HBc_P-D Product feature CHAIN JN257171_HBc_P-D of FT:mat_peptide JN257171_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKML). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257172_HBc_P-D Product feature CHAIN JN257172_HBc_P-D of FT:mat_peptide JN257172_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMYD1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257173_HBc_P-D Product feature CHAIN JN257173_HBc_P-D of FT:mat_peptide JN257173_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMYD2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257176_HBc_P-D Product feature CHAIN JN257176_HBc_P-D of FT:mat_peptide JN257176_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPXDFFPSVRDLLDTASALFREPLESTEHCSPHHTALRQAILCWGELMXLATWVGGNLZDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREREC
>gnl|hbvpro|JN257177_HBc_P-D Product feature CHAIN JN257177_HBc_P-D of FT:mat_peptide JN257177_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ2). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGATVQLLSFLPXDFFPSVRDLLDTASALFREPLESTEHCSPHHTALRQAILCWGELMXLATWVGGNLZDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREQHQC
>gnl|hbvpro|JN257178_HBc_P-D Product feature CHAIN JN257178_HBc_P-D of FT:mat_peptide JN257178_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHTRK). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGXLMTLATWVGVNLZDPA
SRXLVVSXVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPXNAPILSTLPETXVVRRRXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257179_HBc_P-D Product feature CHAIN JN257179_HBc_P-D of FT:mat_peptide JN257179_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMJD1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257181_HBc_P-D Product feature CHAIN JN257181_HBc_P-D of FT:mat_peptide JN257181_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHNDA). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257182_HBc_P-D Product feature CHAIN JN257182_HBc_P-D of FT:mat_peptide JN257182_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMSL). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257183_HBc_P-D Product feature CHAIN JN257183_HBc_P-D of FT:mat_peptide JN257183_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKSH). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSIRDLLDTAAALYGEALQSPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLIVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257185_HBc_P-D Product feature CHAIN JN257185_HBc_P-D of FT:mat_peptide JN257185_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHZYD). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257186_HBc_P-D Product feature CHAIN JN257186_HBc_P-D of FT:mat_peptide JN257186_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHDHM). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257187_HBc_P-D Product feature CHAIN JN257187_HBc_P-D of FT:mat_peptide JN257187_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL1). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257188_HBc_P-D Product feature CHAIN JN257188_HBc_P-D of FT:mat_peptide JN257188_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257190_HBc_P-D Product feature CHAIN JN257190_HBc_P-D of FT:mat_peptide JN257190_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHYHY). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDXVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257193_HBc_P-D Product feature CHAIN JN257193_HBc_P-D of FT:mat_peptide JN257193_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257194_HBc_P-D Product feature CHAIN JN257194_HBc_P-D of FT:mat_peptide JN257194_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257195_HBc_P-D Product feature CHAIN JN257195_HBc_P-D of FT:mat_peptide JN257195_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMTLATWVGGNLQDPV
SRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVVEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257196_HBc_P-D Product feature CHAIN JN257196_HBc_P-D of FT:mat_peptide JN257196_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABR1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257199_HBc_P-D Product feature CHAIN JN257199_HBc_P-D of FT:mat_peptide JN257199_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSOD2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257200_HBc_P-D Product feature CHAIN JN257200_HBc_P-D of FT:mat_peptide JN257200_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMNM). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN257201_HBc_P-D Product feature CHAIN JN257201_HBc_P-D of FT:mat_peptide JN257201_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFAD). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN257202_HBc_P-D Product feature CHAIN JN257202_HBc_P-D of FT:mat_peptide JN257202_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSLI). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAIQCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN257203_HBc_P-D Product feature CHAIN JN257203_HBc_P-D of FT:mat_peptide JN257203_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJKF). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257205_HBc_P-D Product feature CHAIN JN257205_HBc_P-D of FT:mat_peptide JN257205_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRYD). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257209_HBc_P-D Product feature CHAIN JN257209_HBc_P-D of FT:mat_peptide JN257209_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMR2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLXXLXTWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN257211_HBc_P-D Product feature CHAIN JN257211_HBc_P-D of FT:mat_peptide JN257211_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHBRH1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN558561_HBc_P-D Product feature CHAIN JN558561_HBc_P-D of FT:mat_peptide JN558561_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5077). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN558562_HBc_P-D Product feature CHAIN JN558562_HBc_P-D of FT:mat_peptide JN558562_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5283). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSSGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN558563_HBc_P-D Product feature CHAIN JN558563_HBc_P-D of FT:mat_peptide JN558563_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-8082). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN558564_HBc_P-D Product feature CHAIN JN558564_HBc_P-D of FT:mat_peptide JN558564_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN642126_HBc_P-D Product feature CHAIN JN642126_HBc_P-D of FT:mat_peptide JN642126_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642128_HBc_P-D Product feature CHAIN JN642128_HBc_P-D of FT:mat_peptide JN642128_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb11). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQECLCWGELMTLATWVGSNLEDQR
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRCRGRAPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642129_HBc_P-D Product feature CHAIN JN642129_HBc_P-D of FT:mat_peptide JN642129_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSAHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642130_HBc_P-D Product feature CHAIN JN642130_HBc_P-D of FT:mat_peptide JN642130_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN642131_HBc_P-D Product feature CHAIN JN642131_HBc_P-D of FT:mat_peptide JN642131_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642132_HBc_P-D Product feature CHAIN JN642132_HBc_P-D of FT:mat_peptide JN642132_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTARALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|JN642133_HBc_P-D Product feature CHAIN JN642133_HBc_P-D of FT:mat_peptide JN642133_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN642134_HBc_P-D Product feature CHAIN JN642134_HBc_P-D of FT:mat_peptide JN642134_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRVRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|JN642135_HBc_P-D Product feature CHAIN JN642135_HBc_P-D of FT:mat_peptide JN642135_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTYHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRATVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQQRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642136_HBc_P-D Product feature CHAIN JN642136_HBc_P-D of FT:mat_peptide JN642136_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPEDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDQT
SRDLVVTYVNTHMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642138_HBc_P-D Product feature CHAIN JN642138_HBc_P-D of FT:mat_peptide JN642138_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSYHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642140_HBc_P-D Product feature CHAIN JN642140_HBc_P-D of FT:mat_peptide JN642140_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMSLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVRPRGRTPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN642142_HBc_P-D Product feature CHAIN JN642142_HBc_P-D of FT:mat_peptide JN642142_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTHMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642143_HBc_P-D Product feature CHAIN JN642143_HBc_P-D of FT:mat_peptide JN642143_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb33). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642144_HBc_P-D Product feature CHAIN JN642144_HBc_P-D of FT:mat_peptide JN642144_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSAHHTALRQAILCWGELINLITWVGVNLDNPA
SRDLVVSYVNDHMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642145_HBc_P-D Product feature CHAIN JN642145_HBc_P-D of FT:mat_peptide JN642145_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSPSPRRRRSQSRESQC
>gnl|hbvpro|JN642146_HBc_P-D Product feature CHAIN JN642146_HBc_P-D of FT:mat_peptide JN642146_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAIQCWGELMSLATWVGSNLEDPT
SRDLVVGYVNSNMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642147_HBc_P-D Product feature CHAIN JN642147_HBc_P-D of FT:mat_peptide JN642147_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb39). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN642148_HBc_P-D Product feature CHAIN JN642148_HBc_P-D of FT:mat_peptide JN642148_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPDHCTPHHTALRQAILCWGELMTLATWVGANLEDQA
SRDLVVSYVNTNMGLKFRQILWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642149_HBc_P-D Product feature CHAIN JN642149_HBc_P-D of FT:mat_peptide JN642149_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPV
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN642150_HBc_P-D Product feature CHAIN JN642150_HBc_P-D of FT:mat_peptide JN642150_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642151_HBc_P-D Product feature CHAIN JN642151_HBc_P-D of FT:mat_peptide JN642151_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN642153_HBc_P-D Product feature CHAIN JN642153_HBc_P-D of FT:mat_peptide JN642153_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVWIRTPLAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN642154_HBc_P-D Product feature CHAIN JN642154_HBc_P-D of FT:mat_peptide JN642154_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPLAYRPTNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|JN642155_HBc_P-D Product feature CHAIN JN642155_HBc_P-D of FT:mat_peptide JN642155_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb49). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642156_HBc_P-D Product feature CHAIN JN642156_HBc_P-D of FT:mat_peptide JN642156_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|JN642157_HBc_P-D Product feature CHAIN JN642157_HBc_P-D of FT:mat_peptide JN642157_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPLAYRPTNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|JN642158_HBc_P-D Product feature CHAIN JN642158_HBc_P-D of FT:mat_peptide JN642158_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb57). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLMFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN642159_HBc_P-D Product feature CHAIN JN642159_HBc_P-D of FT:mat_peptide JN642159_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb52). Complete genome. [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGASVELLSFLPGDFFPSIRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN642161_HBc_P-D Product feature CHAIN JN642161_HBc_P-D of FT:mat_peptide JN642161_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb54). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAIQCWGELMSLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN642162_HBc_P-D Product feature CHAIN JN642162_HBc_P-D of FT:mat_peptide JN642162_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb58). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPPVRALLDTAQALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRELVVSYVNTNMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642163_HBc_P-D Product feature CHAIN JN642163_HBc_P-D of FT:mat_peptide JN642163_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb59). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN642164_HBc_P-D Product feature CHAIN JN642164_HBc_P-D of FT:mat_peptide JN642164_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb60). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHVSPHHTALRQAYLCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNNTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642165_HBc_P-D Product feature CHAIN JN642165_HBc_P-D of FT:mat_peptide JN642165_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRRRTLRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN642166_HBc_P-D Product feature CHAIN JN642166_HBc_P-D of FT:mat_peptide JN642166_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSLRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|JN642167_HBc_P-D Product feature CHAIN JN642167_HBc_P-D of FT:mat_peptide JN642167_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESCEHCSPHHTALRQAIFCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|JN664909_HBc_P-D Product feature CHAIN JN664909_HBc_P-D of FT:mat_peptide JN664909_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB36_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664910_HBc_P-D Product feature CHAIN JN664910_HBc_P-D of FT:mat_peptide JN664910_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB43_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664911_HBc_P-D Product feature CHAIN JN664911_HBc_P-D of FT:mat_peptide JN664911_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB47_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664912_HBc_P-D Product feature CHAIN JN664912_HBc_P-D of FT:mat_peptide JN664912_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB49_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664913_HBc_P-D Product feature CHAIN JN664913_HBc_P-D of FT:mat_peptide JN664913_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN01_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664914_HBc_P-D Product feature CHAIN JN664914_HBc_P-D of FT:mat_peptide JN664914_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN48_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPS
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664917_HBc_P-D Product feature CHAIN JN664917_HBc_P-D of FT:mat_peptide JN664917_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SKR_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664918_HBc_P-D Product feature CHAIN JN664918_HBc_P-D of FT:mat_peptide JN664918_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2198_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664919_HBc_P-D Product feature CHAIN JN664919_HBc_P-D of FT:mat_peptide JN664919_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2320_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVIMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664920_HBc_P-D Product feature CHAIN JN664920_HBc_P-D of FT:mat_peptide JN664920_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1903_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPA
SRELVVSYVNANMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664921_HBc_P-D Product feature CHAIN JN664921_HBc_P-D of FT:mat_peptide JN664921_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN47_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664922_HBc_P-D Product feature CHAIN JN664922_HBc_P-D of FT:mat_peptide JN664922_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DH01_IC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVTNLATWVGSNLEDQA
SRELVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664924_HBc_P-D Product feature CHAIN JN664924_HBc_P-D of FT:mat_peptide JN664924_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN32_CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664926_HBc_P-D Product feature CHAIN JN664926_HBc_P-D of FT:mat_peptide JN664926_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN63_CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN664927_HBc_P-D Product feature CHAIN JN664927_HBc_P-D of FT:mat_peptide JN664927_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE20_CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664928_HBc_P-D Product feature CHAIN JN664928_HBc_P-D of FT:mat_peptide JN664928_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE27_CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664930_HBc_P-D Product feature CHAIN JN664930_HBc_P-D of FT:mat_peptide JN664930_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEN9_CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664931_HBc_P-D Product feature CHAIN JN664931_HBc_P-D of FT:mat_peptide JN664931_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB6_CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664932_HBc_P-D Product feature CHAIN JN664932_HBc_P-D of FT:mat_peptide JN664932_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2235_CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGSNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664936_HBc_P-D Product feature CHAIN JN664936_HBc_P-D of FT:mat_peptide JN664936_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate E3529_LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664937_HBc_P-D Product feature CHAIN JN664937_HBc_P-D of FT:mat_peptide JN664937_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN45_LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664938_HBc_P-D Product feature CHAIN JN664938_HBc_P-D of FT:mat_peptide JN664938_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN46_LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN664939_HBc_P-D Product feature CHAIN JN664939_HBc_P-D of FT:mat_peptide JN664939_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN71_LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN664941_HBc_P-D Product feature CHAIN JN664941_HBc_P-D of FT:mat_peptide JN664941_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB21_LC). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLATASALYREALESPEHCSPHHTALRQAILCWGELMDLATWVGVNLEDPA
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGKDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN664947_HBc_P-D Product feature CHAIN JN664947_HBc_P-D of FT:mat_peptide JN664947_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB41_LC). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JN664948_HBc_P-D Product feature CHAIN JN664948_HBc_P-D of FT:mat_peptide JN664948_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN64_LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPA
SRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN687947_HBc_P-D Product feature CHAIN JN687947_HBc_P-D of FT:mat_peptide JN687947_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-3111). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVGYVNTTVGLKFRQLLWSHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN688678_HBc_P-D Product feature CHAIN JN688678_HBc_P-D of FT:mat_peptide JN688678_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV007). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGVNLEDPG
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEIVVVRRRGRTXRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN688679_HBc_P-D Product feature CHAIN JN688679_HBc_P-D of FT:mat_peptide JN688679_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV010). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPVDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAIICWGELMTLATWVGVNLEDPG
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN688683_HBc_P-D Product feature CHAIN JN688683_HBc_P-D of FT:mat_peptide JN688683_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV087). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQP
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVKQQGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN688685_HBc_P-D Product feature CHAIN JN688685_HBc_P-D of FT:mat_peptide JN688685_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV097). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVTYVNTNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN688695_HBc_P-D Product feature CHAIN JN688695_HBc_P-D of FT:mat_peptide JN688695_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV128). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRXALESPEHISPHHTAIRQAILCWGELMTLAPWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIXTPPAYRPPNAPILSTLPETTVVRRRGRSHRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN688708_HBc_P-D Product feature CHAIN JN688708_HBc_P-D of FT:mat_peptide JN688708_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV142). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRDIVIEYLVSFGVWIRTPPPYRPNNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN688710_HBc_P-D Product feature CHAIN JN688710_HBc_P-D of FT:mat_peptide JN688710_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV144). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPAVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRPRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN688711_HBc_P-D Product feature CHAIN JN688711_HBc_P-D of FT:mat_peptide JN688711_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV161). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATLELLSFLPSDFXPSVRDLLDTASALXREALESPEHCSPHHTALRQAIFCWGEXMTLATWVGXNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVFFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSRRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|JN688712_HBc_P-D Product feature CHAIN JN688712_HBc_P-D of FT:mat_peptide JN688712_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV163). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRDALESPEHCSPHHTAIRQAILCWGELMNLATWVGVNLDDPT
SREAITSYVNTNMGLKFRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSNSRDSQC
>gnl|hbvpro|JN688713_HBc_P-D Product feature CHAIN JN688713_HBc_P-D of FT:mat_peptide JN688713_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV173). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPXDFFPXVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDQS
SRDLVVSYVNNNMGXKFRQLLWFHISCLTFGREVVIEYLVXFGVWIRTPPAYRPPNAPILSTLPETTVVRREGRSPRRRT
PSPSRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JN688722_HBc_P-D Product feature CHAIN JN688722_HBc_P-D of FT:mat_peptide JN688722_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV228). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGDLMNLGTWVGVNLEDQA
SRDRVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN697591_HBc_P-D Product feature CHAIN JN697591_HBc_P-D of FT:mat_peptide JN697591_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5293). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSSGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|JN792903_HBc_P-D Product feature CHAIN JN792903_HBc_P-D of FT:mat_peptide JN792903_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 310000127). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN792904_HBc_P-D Product feature CHAIN JN792904_HBc_P-D of FT:mat_peptide JN792904_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002943). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHVSAHHTALRQAILCWGELMTLATWVGANLDDPA
SRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN792905_HBc_P-D Product feature CHAIN JN792905_HBc_P-D of FT:mat_peptide JN792905_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000345). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHVSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDQVVSYVNTNMGLKFRQLLWFHISCITFGRPTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JN792906_HBc_P-D Product feature CHAIN JN792906_HBc_P-D of FT:mat_peptide JN792906_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002958). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHVSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRLTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN792907_HBc_P-D Product feature CHAIN JN792907_HBc_P-D of FT:mat_peptide JN792907_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000473). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRPRSKSPRRRRSQSREPQC
>gnl|hbvpro|JN792908_HBc_P-D Product feature CHAIN JN792908_HBc_P-D of FT:mat_peptide JN792908_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002951). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPIDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDQG
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRPRSKSPRRRRSQSREPQC
>gnl|hbvpro|JN792909_HBc_P-D Product feature CHAIN JN792909_HBc_P-D of FT:mat_peptide JN792909_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000479). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN792910_HBc_P-D Product feature CHAIN JN792910_HBc_P-D of FT:mat_peptide JN792910_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 109001205). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN792911_HBc_P-D Product feature CHAIN JN792911_HBc_P-D of FT:mat_peptide JN792911_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002952). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRTRT
PSPRRRRSKSPRRRRSQSREPQC
>gnl|hbvpro|JN792912_HBc_P-D Product feature CHAIN JN792912_HBc_P-D of FT:mat_peptide JN792912_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 307000449). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRTRT
PSPRRRRSKSPRRRRSQSREPQC
>gnl|hbvpro|JQ287601_HBc_P-D Product feature CHAIN JQ287601_HBc_P-D of FT:mat_peptide JQ287601_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV469/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287602_HBc_P-D Product feature CHAIN JQ287602_HBc_P-D of FT:mat_peptide JQ287602_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV470/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287603_HBc_P-D Product feature CHAIN JQ287603_HBc_P-D of FT:mat_peptide JQ287603_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV471/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287604_HBc_P-D Product feature CHAIN JQ287604_HBc_P-D of FT:mat_peptide JQ287604_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV472/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287605_HBc_P-D Product feature CHAIN JQ287605_HBc_P-D of FT:mat_peptide JQ287605_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV473/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287606_HBc_P-D Product feature CHAIN JQ287606_HBc_P-D of FT:mat_peptide JQ287606_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV474/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287607_HBc_P-D Product feature CHAIN JQ287607_HBc_P-D of FT:mat_peptide JQ287607_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV475/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287608_HBc_P-D Product feature CHAIN JQ287608_HBc_P-D of FT:mat_peptide JQ287608_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV476/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287609_HBc_P-D Product feature CHAIN JQ287609_HBc_P-D of FT:mat_peptide JQ287609_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV477/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287610_HBc_P-D Product feature CHAIN JQ287610_HBc_P-D of FT:mat_peptide JQ287610_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV478/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287611_HBc_P-D Product feature CHAIN JQ287611_HBc_P-D of FT:mat_peptide JQ287611_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV479/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287612_HBc_P-D Product feature CHAIN JQ287612_HBc_P-D of FT:mat_peptide JQ287612_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV480/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287613_HBc_P-D Product feature CHAIN JQ287613_HBc_P-D of FT:mat_peptide JQ287613_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV481/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287614_HBc_P-D Product feature CHAIN JQ287614_HBc_P-D of FT:mat_peptide JQ287614_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV482/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287615_HBc_P-D Product feature CHAIN JQ287615_HBc_P-D of FT:mat_peptide JQ287615_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV483/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287616_HBc_P-D Product feature CHAIN JQ287616_HBc_P-D of FT:mat_peptide JQ287616_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV484/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287617_HBc_P-D Product feature CHAIN JQ287617_HBc_P-D of FT:mat_peptide JQ287617_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV485/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287618_HBc_P-D Product feature CHAIN JQ287618_HBc_P-D of FT:mat_peptide JQ287618_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV486/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287619_HBc_P-D Product feature CHAIN JQ287619_HBc_P-D of FT:mat_peptide JQ287619_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV487/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ287620_HBc_P-D Product feature CHAIN JQ287620_HBc_P-D of FT:mat_peptide JQ287620_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV488/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ287621_HBc_P-D Product feature CHAIN JQ287621_HBc_P-D of FT:mat_peptide JQ287621_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV489/NCDC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ687530_HBc_P-D Product feature CHAIN JQ687530_HBc_P-D of FT:mat_peptide JQ687530_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 200). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPKRRT
PSPRKRRSQSPRRKRSQSRESQC
>gnl|hbvpro|JQ687531_HBc_P-D Product feature CHAIN JQ687531_HBc_P-D of FT:mat_peptide JQ687531_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 205). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYAEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHLSVLKQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|JQ707476_HBc_P-D Product feature CHAIN JQ707476_HBc_P-D of FT:mat_peptide JQ707476_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707477_HBc_P-D Product feature CHAIN JQ707477_HBc_P-D of FT:mat_peptide JQ707477_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707478_HBc_P-D Product feature CHAIN JQ707478_HBc_P-D of FT:mat_peptide JQ707478_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707479_HBc_P-D Product feature CHAIN JQ707479_HBc_P-D of FT:mat_peptide JQ707479_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707480_HBc_P-D Product feature CHAIN JQ707480_HBc_P-D of FT:mat_peptide JQ707480_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|JQ707481_HBc_P-D Product feature CHAIN JQ707481_HBc_P-D of FT:mat_peptide JQ707481_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707482_HBc_P-D Product feature CHAIN JQ707482_HBc_P-D of FT:mat_peptide JQ707482_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C17-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707483_HBc_P-D Product feature CHAIN JQ707483_HBc_P-D of FT:mat_peptide JQ707483_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707484_HBc_P-D Product feature CHAIN JQ707484_HBc_P-D of FT:mat_peptide JQ707484_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C19). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRKALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707485_HBc_P-D Product feature CHAIN JQ707485_HBc_P-D of FT:mat_peptide JQ707485_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707486_HBc_P-D Product feature CHAIN JQ707486_HBc_P-D of FT:mat_peptide JQ707486_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707487_HBc_P-D Product feature CHAIN JQ707487_HBc_P-D of FT:mat_peptide JQ707487_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707488_HBc_P-D Product feature CHAIN JQ707488_HBc_P-D of FT:mat_peptide JQ707488_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707489_HBc_P-D Product feature CHAIN JQ707489_HBc_P-D of FT:mat_peptide JQ707489_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707490_HBc_P-D Product feature CHAIN JQ707490_HBc_P-D of FT:mat_peptide JQ707490_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707491_HBc_P-D Product feature CHAIN JQ707491_HBc_P-D of FT:mat_peptide JQ707491_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C3). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRCRSRRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707492_HBc_P-D Product feature CHAIN JQ707492_HBc_P-D of FT:mat_peptide JQ707492_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C30). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707493_HBc_P-D Product feature CHAIN JQ707493_HBc_P-D of FT:mat_peptide JQ707493_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707494_HBc_P-D Product feature CHAIN JQ707494_HBc_P-D of FT:mat_peptide JQ707494_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707495_HBc_P-D Product feature CHAIN JQ707495_HBc_P-D of FT:mat_peptide JQ707495_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C33). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707496_HBc_P-D Product feature CHAIN JQ707496_HBc_P-D of FT:mat_peptide JQ707496_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C34-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707497_HBc_P-D Product feature CHAIN JQ707497_HBc_P-D of FT:mat_peptide JQ707497_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDRLDTTSALYREALESPEHCSPHHTALRQAILCWGELRTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707498_HBc_P-D Product feature CHAIN JQ707498_HBc_P-D of FT:mat_peptide JQ707498_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C37). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLTTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707499_HBc_P-D Product feature CHAIN JQ707499_HBc_P-D of FT:mat_peptide JQ707499_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707500_HBc_P-D Product feature CHAIN JQ707500_HBc_P-D of FT:mat_peptide JQ707500_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707501_HBc_P-D Product feature CHAIN JQ707501_HBc_P-D of FT:mat_peptide JQ707501_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C41). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETGIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707502_HBc_P-D Product feature CHAIN JQ707502_HBc_P-D of FT:mat_peptide JQ707502_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707503_HBc_P-D Product feature CHAIN JQ707503_HBc_P-D of FT:mat_peptide JQ707503_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707504_HBc_P-D Product feature CHAIN JQ707504_HBc_P-D of FT:mat_peptide JQ707504_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C44). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGVNLEAPA
SRDLVVSYVNTDMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707505_HBc_P-D Product feature CHAIN JQ707505_HBc_P-D of FT:mat_peptide JQ707505_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707506_HBc_P-D Product feature CHAIN JQ707506_HBc_P-D of FT:mat_peptide JQ707506_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C46). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707507_HBc_P-D Product feature CHAIN JQ707507_HBc_P-D of FT:mat_peptide JQ707507_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707508_HBc_P-D Product feature CHAIN JQ707508_HBc_P-D of FT:mat_peptide JQ707508_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707509_HBc_P-D Product feature CHAIN JQ707509_HBc_P-D of FT:mat_peptide JQ707509_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLTTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPTYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707510_HBc_P-D Product feature CHAIN JQ707510_HBc_P-D of FT:mat_peptide JQ707510_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707511_HBc_P-D Product feature CHAIN JQ707511_HBc_P-D of FT:mat_peptide JQ707511_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707512_HBc_P-D Product feature CHAIN JQ707512_HBc_P-D of FT:mat_peptide JQ707512_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C1-22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707513_HBc_P-D Product feature CHAIN JQ707513_HBc_P-D of FT:mat_peptide JQ707513_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707514_HBc_P-D Product feature CHAIN JQ707514_HBc_P-D of FT:mat_peptide JQ707514_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707515_HBc_P-D Product feature CHAIN JQ707515_HBc_P-D of FT:mat_peptide JQ707515_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707516_HBc_P-D Product feature CHAIN JQ707516_HBc_P-D of FT:mat_peptide JQ707516_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707517_HBc_P-D Product feature CHAIN JQ707517_HBc_P-D of FT:mat_peptide JQ707517_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707518_HBc_P-D Product feature CHAIN JQ707518_HBc_P-D of FT:mat_peptide JQ707518_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C17-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707519_HBc_P-D Product feature CHAIN JQ707519_HBc_P-D of FT:mat_peptide JQ707519_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707520_HBc_P-D Product feature CHAIN JQ707520_HBc_P-D of FT:mat_peptide JQ707520_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707521_HBc_P-D Product feature CHAIN JQ707521_HBc_P-D of FT:mat_peptide JQ707521_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVSTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707522_HBc_P-D Product feature CHAIN JQ707522_HBc_P-D of FT:mat_peptide JQ707522_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707523_HBc_P-D Product feature CHAIN JQ707523_HBc_P-D of FT:mat_peptide JQ707523_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707524_HBc_P-D Product feature CHAIN JQ707524_HBc_P-D of FT:mat_peptide JQ707524_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707525_HBc_P-D Product feature CHAIN JQ707525_HBc_P-D of FT:mat_peptide JQ707525_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707526_HBc_P-D Product feature CHAIN JQ707526_HBc_P-D of FT:mat_peptide JQ707526_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707527_HBc_P-D Product feature CHAIN JQ707527_HBc_P-D of FT:mat_peptide JQ707527_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707528_HBc_P-D Product feature CHAIN JQ707528_HBc_P-D of FT:mat_peptide JQ707528_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707529_HBc_P-D Product feature CHAIN JQ707529_HBc_P-D of FT:mat_peptide JQ707529_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGINLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707530_HBc_P-D Product feature CHAIN JQ707530_HBc_P-D of FT:mat_peptide JQ707530_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707682_HBc_P-D Product feature CHAIN JQ707682_HBc_P-D of FT:mat_peptide JQ707682_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_1-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707683_HBc_P-D Product feature CHAIN JQ707683_HBc_P-D of FT:mat_peptide JQ707683_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707684_HBc_P-D Product feature CHAIN JQ707684_HBc_P-D of FT:mat_peptide JQ707684_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707685_HBc_P-D Product feature CHAIN JQ707685_HBc_P-D of FT:mat_peptide JQ707685_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707686_HBc_P-D Product feature CHAIN JQ707686_HBc_P-D of FT:mat_peptide JQ707686_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707687_HBc_P-D Product feature CHAIN JQ707687_HBc_P-D of FT:mat_peptide JQ707687_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707688_HBc_P-D Product feature CHAIN JQ707688_HBc_P-D of FT:mat_peptide JQ707688_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707689_HBc_P-D Product feature CHAIN JQ707689_HBc_P-D of FT:mat_peptide JQ707689_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707690_HBc_P-D Product feature CHAIN JQ707690_HBc_P-D of FT:mat_peptide JQ707690_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707691_HBc_P-D Product feature CHAIN JQ707691_HBc_P-D of FT:mat_peptide JQ707691_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707692_HBc_P-D Product feature CHAIN JQ707692_HBc_P-D of FT:mat_peptide JQ707692_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707693_HBc_P-D Product feature CHAIN JQ707693_HBc_P-D of FT:mat_peptide JQ707693_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707694_HBc_P-D Product feature CHAIN JQ707694_HBc_P-D of FT:mat_peptide JQ707694_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707695_HBc_P-D Product feature CHAIN JQ707695_HBc_P-D of FT:mat_peptide JQ707695_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELVTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707696_HBc_P-D Product feature CHAIN JQ707696_HBc_P-D of FT:mat_peptide JQ707696_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707697_HBc_P-D Product feature CHAIN JQ707697_HBc_P-D of FT:mat_peptide JQ707697_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707698_HBc_P-D Product feature CHAIN JQ707698_HBc_P-D of FT:mat_peptide JQ707698_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707699_HBc_P-D Product feature CHAIN JQ707699_HBc_P-D of FT:mat_peptide JQ707699_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707700_HBc_P-D Product feature CHAIN JQ707700_HBc_P-D of FT:mat_peptide JQ707700_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_36-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707701_HBc_P-D Product feature CHAIN JQ707701_HBc_P-D of FT:mat_peptide JQ707701_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707702_HBc_P-D Product feature CHAIN JQ707702_HBc_P-D of FT:mat_peptide JQ707702_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707703_HBc_P-D Product feature CHAIN JQ707703_HBc_P-D of FT:mat_peptide JQ707703_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707704_HBc_P-D Product feature CHAIN JQ707704_HBc_P-D of FT:mat_peptide JQ707704_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCFTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707705_HBc_P-D Product feature CHAIN JQ707705_HBc_P-D of FT:mat_peptide JQ707705_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707706_HBc_P-D Product feature CHAIN JQ707706_HBc_P-D of FT:mat_peptide JQ707706_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_8-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ927384_HBc_P-D Product feature CHAIN JQ927384_HBc_P-D of FT:mat_peptide JQ927384_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KM2109). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRDALESPEHCSPHHTTLRQAILCWGELMNLATWVGANLQDQA
SRDLVVNYVNTNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVXRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JX036342_HBc_P-D Product feature CHAIN JX036342_HBc_P-D of FT:mat_peptide JX036342_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y2-212_CD). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAQLLSFLPADFFPSVRDLLDTASALYREALESPEHVSSHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDPVVSYVNTNMGLKFRQLLWFHISCLTFGRATVIEYLVSFGVWIRTPPAYRPPNAPILSALPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JX036343_HBc_P-D Product feature CHAIN JX036343_HBc_P-D of FT:mat_peptide JX036343_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y2-27_D). Partial genome (Contains: HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHVSSHHTALRQAILCWGDLMSLATWVGSNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRGSPSRGSQC
>gnl|hbvpro|JX036344_HBc_P-D Product feature CHAIN JX036344_HBc_P-D of FT:mat_peptide JX036344_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y2-25_D). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASAQLLSFLPADFFPSVRDLLDTASALYREALESPEHVSSHHTALRQAILCWGDLMSLATWVGSNLDVPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|JX096954_HBc_P-D Product feature CHAIN JX096954_HBc_P-D of FT:mat_peptide JX096954_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1-3242). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX096955_HBc_P-D Product feature CHAIN JX096955_HBc_P-D of FT:mat_peptide JX096955_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2-3051). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMALATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX096956_HBc_P-D Product feature CHAIN JX096956_HBc_P-D of FT:mat_peptide JX096956_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5-6154). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX096957_HBc_P-D Product feature CHAIN JX096957_HBc_P-D of FT:mat_peptide JX096957_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6-2646). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX096958_HBc_P-D Product feature CHAIN JX096958_HBc_P-D of FT:mat_peptide JX096958_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7-1276). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX310733_HBc_P-D Product feature CHAIN JX310733_HBc_P-D of FT:mat_peptide JX310733_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D23_1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX310734_HBc_P-D Product feature CHAIN JX310734_HBc_P-D of FT:mat_peptide JX310734_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D23_3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX310735_HBc_P-D Product feature CHAIN JX310735_HBc_P-D of FT:mat_peptide JX310735_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D23_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JX470760_HBc_P-D Product feature CHAIN JX470760_HBc_P-D of FT:mat_peptide JX470760_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H-IDU6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX898689_HBc_P-D Product feature CHAIN JX898689_HBc_P-D of FT:mat_peptide JX898689_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX898691_HBc_P-D Product feature CHAIN JX898691_HBc_P-D of FT:mat_peptide JX898691_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX898692_HBc_P-D Product feature CHAIN JX898692_HBc_P-D of FT:mat_peptide JX898692_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX898694_HBc_P-D Product feature CHAIN JX898694_HBc_P-D of FT:mat_peptide JX898694_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX898697_HBc_P-D Product feature CHAIN JX898697_HBc_P-D of FT:mat_peptide JX898697_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC012652_HBc_P-D Product feature CHAIN KC012652_HBc_P-D of FT:mat_peptide KC012652_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774436_HBc_P-D Product feature CHAIN KC774436_HBc_P-D of FT:mat_peptide KC774436_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1008). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774437_HBc_P-D Product feature CHAIN KC774437_HBc_P-D of FT:mat_peptide KC774437_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1009). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774440_HBc_P-D Product feature CHAIN KC774440_HBc_P-D of FT:mat_peptide KC774440_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1028). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774444_HBc_P-D Product feature CHAIN KC774444_HBc_P-D of FT:mat_peptide KC774444_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1038). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774445_HBc_P-D Product feature CHAIN KC774445_HBc_P-D of FT:mat_peptide KC774445_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1040). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRKRRSQSPRRKRSQSRESQC
>gnl|hbvpro|KC774459_HBc_P-D Product feature CHAIN KC774459_HBc_P-D of FT:mat_peptide KC774459_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1111). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDTYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774460_HBc_P-D Product feature CHAIN KC774460_HBc_P-D of FT:mat_peptide KC774460_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1112). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774462_HBc_P-D Product feature CHAIN KC774462_HBc_P-D of FT:mat_peptide KC774462_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dxa2047). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC774477_HBc_P-D Product feature CHAIN KC774477_HBc_P-D of FT:mat_peptide KC774477_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dxn1031). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKKTVIEYLVSFGVWIPTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875275_HBc_P-D Product feature CHAIN KC875275_HBc_P-D of FT:mat_peptide KC875275_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV39). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875276_HBc_P-D Product feature CHAIN KC875276_HBc_P-D of FT:mat_peptide KC875276_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPESTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875277_HBc_P-D Product feature CHAIN KC875277_HBc_P-D of FT:mat_peptide KC875277_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875278_HBc_P-D Product feature CHAIN KC875278_HBc_P-D of FT:mat_peptide KC875278_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQPLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875279_HBc_P-D Product feature CHAIN KC875279_HBc_P-D of FT:mat_peptide KC875279_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875280_HBc_P-D Product feature CHAIN KC875280_HBc_P-D of FT:mat_peptide KC875280_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875281_HBc_P-D Product feature CHAIN KC875281_HBc_P-D of FT:mat_peptide KC875281_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875282_HBc_P-D Product feature CHAIN KC875282_HBc_P-D of FT:mat_peptide KC875282_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875283_HBc_P-D Product feature CHAIN KC875283_HBc_P-D of FT:mat_peptide KC875283_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875284_HBc_P-D Product feature CHAIN KC875284_HBc_P-D of FT:mat_peptide KC875284_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV28). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875285_HBc_P-D Product feature CHAIN KC875285_HBc_P-D of FT:mat_peptide KC875285_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV29). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875286_HBc_P-D Product feature CHAIN KC875286_HBc_P-D of FT:mat_peptide KC875286_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875287_HBc_P-D Product feature CHAIN KC875287_HBc_P-D of FT:mat_peptide KC875287_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875288_HBc_P-D Product feature CHAIN KC875288_HBc_P-D of FT:mat_peptide KC875288_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV56). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875289_HBc_P-D Product feature CHAIN KC875289_HBc_P-D of FT:mat_peptide KC875289_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV55). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875290_HBc_P-D Product feature CHAIN KC875290_HBc_P-D of FT:mat_peptide KC875290_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV57). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875291_HBc_P-D Product feature CHAIN KC875291_HBc_P-D of FT:mat_peptide KC875291_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV58). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875292_HBc_P-D Product feature CHAIN KC875292_HBc_P-D of FT:mat_peptide KC875292_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875293_HBc_P-D Product feature CHAIN KC875293_HBc_P-D of FT:mat_peptide KC875293_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV69). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875294_HBc_P-D Product feature CHAIN KC875294_HBc_P-D of FT:mat_peptide KC875294_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV70). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875295_HBc_P-D Product feature CHAIN KC875295_HBc_P-D of FT:mat_peptide KC875295_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV81). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875296_HBc_P-D Product feature CHAIN KC875296_HBc_P-D of FT:mat_peptide KC875296_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV82). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875297_HBc_P-D Product feature CHAIN KC875297_HBc_P-D of FT:mat_peptide KC875297_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV84). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875298_HBc_P-D Product feature CHAIN KC875298_HBc_P-D of FT:mat_peptide KC875298_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV76). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC875299_HBc_P-D Product feature CHAIN KC875299_HBc_P-D of FT:mat_peptide KC875299_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV85). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875300_HBc_P-D Product feature CHAIN KC875300_HBc_P-D of FT:mat_peptide KC875300_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV80). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875301_HBc_P-D Product feature CHAIN KC875301_HBc_P-D of FT:mat_peptide KC875301_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV89). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875302_HBc_P-D Product feature CHAIN KC875302_HBc_P-D of FT:mat_peptide KC875302_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV86). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875303_HBc_P-D Product feature CHAIN KC875303_HBc_P-D of FT:mat_peptide KC875303_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV92). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875304_HBc_P-D Product feature CHAIN KC875304_HBc_P-D of FT:mat_peptide KC875304_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV91). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875305_HBc_P-D Product feature CHAIN KC875305_HBc_P-D of FT:mat_peptide KC875305_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV41). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875306_HBc_P-D Product feature CHAIN KC875306_HBc_P-D of FT:mat_peptide KC875306_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV71). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875307_HBc_P-D Product feature CHAIN KC875307_HBc_P-D of FT:mat_peptide KC875307_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV74). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875308_HBc_P-D Product feature CHAIN KC875308_HBc_P-D of FT:mat_peptide KC875308_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV72). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875309_HBc_P-D Product feature CHAIN KC875309_HBc_P-D of FT:mat_peptide KC875309_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALSQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875310_HBc_P-D Product feature CHAIN KC875310_HBc_P-D of FT:mat_peptide KC875310_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875311_HBc_P-D Product feature CHAIN KC875311_HBc_P-D of FT:mat_peptide KC875311_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875312_HBc_P-D Product feature CHAIN KC875312_HBc_P-D of FT:mat_peptide KC875312_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV22). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC875313_HBc_P-D Product feature CHAIN KC875313_HBc_P-D of FT:mat_peptide KC875313_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875314_HBc_P-D Product feature CHAIN KC875314_HBc_P-D of FT:mat_peptide KC875314_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV2). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPPVRDLLDTASALYREALESPEHCSPHHTALRQANLCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875315_HBc_P-D Product feature CHAIN KC875315_HBc_P-D of FT:mat_peptide KC875315_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV8). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHITCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875316_HBc_P-D Product feature CHAIN KC875316_HBc_P-D of FT:mat_peptide KC875316_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLGFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875317_HBc_P-D Product feature CHAIN KC875317_HBc_P-D of FT:mat_peptide KC875317_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC875318_HBc_P-D Product feature CHAIN KC875318_HBc_P-D of FT:mat_peptide KC875318_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV40). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875319_HBc_P-D Product feature CHAIN KC875319_HBc_P-D of FT:mat_peptide KC875319_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875320_HBc_P-D Product feature CHAIN KC875320_HBc_P-D of FT:mat_peptide KC875320_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875321_HBc_P-D Product feature CHAIN KC875321_HBc_P-D of FT:mat_peptide KC875321_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV19). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875322_HBc_P-D Product feature CHAIN KC875322_HBc_P-D of FT:mat_peptide KC875322_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV54). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875323_HBc_P-D Product feature CHAIN KC875323_HBc_P-D of FT:mat_peptide KC875323_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV53). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875324_HBc_P-D Product feature CHAIN KC875324_HBc_P-D of FT:mat_peptide KC875324_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV59). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875325_HBc_P-D Product feature CHAIN KC875325_HBc_P-D of FT:mat_peptide KC875325_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV60). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875326_HBc_P-D Product feature CHAIN KC875326_HBc_P-D of FT:mat_peptide KC875326_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV37). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC875328_HBc_P-D Product feature CHAIN KC875328_HBc_P-D of FT:mat_peptide KC875328_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV83). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAMLCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC875329_HBc_P-D Product feature CHAIN KC875329_HBc_P-D of FT:mat_peptide KC875329_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV90). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFLSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875330_HBc_P-D Product feature CHAIN KC875330_HBc_P-D of FT:mat_peptide KC875330_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV87). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875331_HBc_P-D Product feature CHAIN KC875331_HBc_P-D of FT:mat_peptide KC875331_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV88). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC875332_HBc_P-D Product feature CHAIN KC875332_HBc_P-D of FT:mat_peptide KC875332_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875333_HBc_P-D Product feature CHAIN KC875333_HBc_P-D of FT:mat_peptide KC875333_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV75). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KC875334_HBc_P-D Product feature CHAIN KC875334_HBc_P-D of FT:mat_peptide KC875334_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV47). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875335_HBc_P-D Product feature CHAIN KC875335_HBc_P-D of FT:mat_peptide KC875335_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV44). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875336_HBc_P-D Product feature CHAIN KC875336_HBc_P-D of FT:mat_peptide KC875336_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875337_HBc_P-D Product feature CHAIN KC875337_HBc_P-D of FT:mat_peptide KC875337_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875340_HBc_P-D Product feature CHAIN KC875340_HBc_P-D of FT:mat_peptide KC875340_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV34). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|KC875341_HBc_P-D Product feature CHAIN KC875341_HBc_P-D of FT:mat_peptide KC875341_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV67). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|KC875342_HBc_P-D Product feature CHAIN KC875342_HBc_P-D of FT:mat_peptide KC875342_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV79). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLLFHISCLTFGRQTVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDPQC
>gnl|hbvpro|KF018177_HBc_P-D Product feature CHAIN KF018177_HBc_P-D of FT:mat_peptide KF018177_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRDALESPEHCSPHHTAIRHVFLCWGDLMNLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018180_HBc_P-D Product feature CHAIN KF018180_HBc_P-D of FT:mat_peptide KF018180_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018181_HBc_P-D Product feature CHAIN KF018181_HBc_P-D of FT:mat_peptide KF018181_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRHVILCWGDLMNLATWVGGNLEDPI
SRDLVVNYVNSNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETSVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018182_HBc_P-D Product feature CHAIN KF018182_HBc_P-D of FT:mat_peptide KF018182_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAWLCWGELMNLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPPYRPTNAPILSTLPETTVVRQRVRTLRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018184_HBc_P-D Product feature CHAIN KF018184_HBc_P-D of FT:mat_peptide KF018184_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018185_HBc_P-D Product feature CHAIN KF018185_HBc_P-D of FT:mat_peptide KF018185_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPT
SRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018187_HBc_P-D Product feature CHAIN KF018187_HBc_P-D of FT:mat_peptide KF018187_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018189_HBc_P-D Product feature CHAIN KF018189_HBc_P-D of FT:mat_peptide KF018189_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018190_HBc_P-D Product feature CHAIN KF018190_HBc_P-D of FT:mat_peptide KF018190_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018191_HBc_P-D Product feature CHAIN KF018191_HBc_P-D of FT:mat_peptide KF018191_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018192_HBc_P-D Product feature CHAIN KF018192_HBc_P-D of FT:mat_peptide KF018192_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018194_HBc_P-D Product feature CHAIN KF018194_HBc_P-D of FT:mat_peptide KF018194_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF018195_HBc_P-D Product feature CHAIN KF018195_HBc_P-D of FT:mat_peptide KF018195_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRSGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF061167_HBc_P-D Product feature CHAIN KF061167_HBc_P-D of FT:mat_peptide KF061167_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_1a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF061168_HBc_P-D Product feature CHAIN KF061168_HBc_P-D of FT:mat_peptide KF061168_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_3a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREXLESPEHCSPHHTALRQAILCWGXLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF061169_HBc_P-D Product feature CHAIN KF061169_HBc_P-D of FT:mat_peptide KF061169_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_7a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF061170_HBc_P-D Product feature CHAIN KF061170_HBc_P-D of FT:mat_peptide KF061170_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_13a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPSRRRSQSRESQC
>gnl|hbvpro|KF170739_HBc_P-D Product feature CHAIN KF170739_HBc_P-D of FT:mat_peptide KF170739_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_024). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLTTWVGGNLEDPV
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF192830_HBc_P-D Product feature CHAIN KF192830_HBc_P-D of FT:mat_peptide KF192830_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP71). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF192831_HBc_P-D Product feature CHAIN KF192831_HBc_P-D of FT:mat_peptide KF192831_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP59). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF192832_HBc_P-D Product feature CHAIN KF192832_HBc_P-D of FT:mat_peptide KF192832_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF192834_HBc_P-D Product feature CHAIN KF192834_HBc_P-D of FT:mat_peptide KF192834_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP63). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471640_HBc_P-D Product feature CHAIN KF471640_HBc_P-D of FT:mat_peptide KF471640_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-86). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVNLLSFLPADYFPSVRDLLDTASALYREALESSEHCTPHHTALRQAILCWGDLINLSTWVGSNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KF471641_HBc_P-D Product feature CHAIN KF471641_HBc_P-D of FT:mat_peptide KF471641_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-66). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF471642_HBc_P-D Product feature CHAIN KF471642_HBc_P-D of FT:mat_peptide KF471642_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGDLMSLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KF471644_HBc_P-D Product feature CHAIN KF471644_HBc_P-D of FT:mat_peptide KF471644_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-52). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471645_HBc_P-D Product feature CHAIN KF471645_HBc_P-D of FT:mat_peptide KF471645_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-50). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KF471646_HBc_P-D Product feature CHAIN KF471646_HBc_P-D of FT:mat_peptide KF471646_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471647_HBc_P-D Product feature CHAIN KF471647_HBc_P-D of FT:mat_peptide KF471647_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471649_HBc_P-D Product feature CHAIN KF471649_HBc_P-D of FT:mat_peptide KF471649_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-31). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471650_HBc_P-D Product feature CHAIN KF471650_HBc_P-D of FT:mat_peptide KF471650_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471651_HBc_P-D Product feature CHAIN KF471651_HBc_P-D of FT:mat_peptide KF471651_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471652_HBc_P-D Product feature CHAIN KF471652_HBc_P-D of FT:mat_peptide KF471652_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-20). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471653_HBc_P-D Product feature CHAIN KF471653_HBc_P-D of FT:mat_peptide KF471653_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-18). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471654_HBc_P-D Product feature CHAIN KF471654_HBc_P-D of FT:mat_peptide KF471654_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREPLESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KF471655_HBc_P-D Product feature CHAIN KF471655_HBc_P-D of FT:mat_peptide KF471655_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF471656_HBc_P-D Product feature CHAIN KF471656_HBc_P-D of FT:mat_peptide KF471656_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRELLWFHISCLTFGRETGIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471657_HBc_P-D Product feature CHAIN KF471657_HBc_P-D of FT:mat_peptide KF471657_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471658_HBc_P-D Product feature CHAIN KF471658_HBc_P-D of FT:mat_peptide KF471658_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG_4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KF471659_HBc_P-D Product feature CHAIN KF471659_HBc_P-D of FT:mat_peptide KF471659_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF471660_HBc_P-D Product feature CHAIN KF471660_HBc_P-D of FT:mat_peptide KF471660_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF584078_HBc_P-D Product feature CHAIN KF584078_HBc_P-D of FT:mat_peptide KF584078_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M2_81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLGTASALYREALESPEHCSPHHTALRQAILCWGDLMNLGTWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRCRTPRRGT
PSPRRRRSQPPRRRRSQSRESQC
>gnl|hbvpro|KF584161_HBc_P-D Product feature CHAIN KF584161_HBc_P-D of FT:mat_peptide KF584161_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF584162_HBc_P-D Product feature CHAIN KF584162_HBc_P-D of FT:mat_peptide KF584162_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1b). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF584163_HBc_P-D Product feature CHAIN KF584163_HBc_P-D of FT:mat_peptide KF584163_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF584164_HBc_P-D Product feature CHAIN KF584164_HBc_P-D of FT:mat_peptide KF584164_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2b). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF584165_HBc_P-D Product feature CHAIN KF584165_HBc_P-D of FT:mat_peptide KF584165_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Da). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF584166_HBc_P-D Product feature CHAIN KF584166_HBc_P-D of FT:mat_peptide KF584166_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Db). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF679989_HBc_P-D Product feature CHAIN KF679989_HBc_P-D of FT:mat_peptide KF679989_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-49). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF679990_HBc_P-D Product feature CHAIN KF679990_HBc_P-D of FT:mat_peptide KF679990_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-57). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SREQVVSYVNTNMGLKFRQLLWFHVSCLTFGREVVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRQRGRSLRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KF679992_HBc_P-D Product feature CHAIN KF679992_HBc_P-D of FT:mat_peptide KF679992_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-75). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF679993_HBc_P-D Product feature CHAIN KF679993_HBc_P-D of FT:mat_peptide KF679993_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-76). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF679994_HBc_P-D Product feature CHAIN KF679994_HBc_P-D of FT:mat_peptide KF679994_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF679995_HBc_P-D Product feature CHAIN KF679995_HBc_P-D of FT:mat_peptide KF679995_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF679996_HBc_P-D Product feature CHAIN KF679996_HBc_P-D of FT:mat_peptide KF679996_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF679997_HBc_P-D Product feature CHAIN KF679997_HBc_P-D of FT:mat_peptide KF679997_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-56). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF679998_HBc_P-D Product feature CHAIN KF679998_HBc_P-D of FT:mat_peptide KF679998_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-63). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779209_HBc_P-D Product feature CHAIN KF779209_HBc_P-D of FT:mat_peptide KF779209_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5536). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779212_HBc_P-D Product feature CHAIN KF779212_HBc_P-D of FT:mat_peptide KF779212_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5739). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779214_HBc_P-D Product feature CHAIN KF779214_HBc_P-D of FT:mat_peptide KF779214_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5754). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779216_HBc_P-D Product feature CHAIN KF779216_HBc_P-D of FT:mat_peptide KF779216_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5770). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPGRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779217_HBc_P-D Product feature CHAIN KF779217_HBc_P-D of FT:mat_peptide KF779217_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779218_HBc_P-D Product feature CHAIN KF779218_HBc_P-D of FT:mat_peptide KF779218_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5876). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPIQSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSHSRESQC
>gnl|hbvpro|KF779220_HBc_P-D Product feature CHAIN KF779220_HBc_P-D of FT:mat_peptide KF779220_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5910). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPDYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779222_HBc_P-D Product feature CHAIN KF779222_HBc_P-D of FT:mat_peptide KF779222_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5978). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779223_HBc_P-D Product feature CHAIN KF779223_HBc_P-D of FT:mat_peptide KF779223_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6024). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779224_HBc_P-D Product feature CHAIN KF779224_HBc_P-D of FT:mat_peptide KF779224_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6026). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRPRSLSPRRRRSQSREPQC
>gnl|hbvpro|KF779225_HBc_P-D Product feature CHAIN KF779225_HBc_P-D of FT:mat_peptide KF779225_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6036). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779228_HBc_P-D Product feature CHAIN KF779228_HBc_P-D of FT:mat_peptide KF779228_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6067). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779229_HBc_P-D Product feature CHAIN KF779229_HBc_P-D of FT:mat_peptide KF779229_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6077). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779230_HBc_P-D Product feature CHAIN KF779230_HBc_P-D of FT:mat_peptide KF779230_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6078). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779285_HBc_P-D Product feature CHAIN KF779285_HBc_P-D of FT:mat_peptide KF779285_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0596). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779288_HBc_P-D Product feature CHAIN KF779288_HBc_P-D of FT:mat_peptide KF779288_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0643). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779289_HBc_P-D Product feature CHAIN KF779289_HBc_P-D of FT:mat_peptide KF779289_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSLSPRRRRSQSRESQC
>gnl|hbvpro|KF779292_HBc_P-D Product feature CHAIN KF779292_HBc_P-D of FT:mat_peptide KF779292_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0767). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779296_HBc_P-D Product feature CHAIN KF779296_HBc_P-D of FT:mat_peptide KF779296_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0869). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779301_HBc_P-D Product feature CHAIN KF779301_HBc_P-D of FT:mat_peptide KF779301_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT1003). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPASRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779302_HBc_P-D Product feature CHAIN KF779302_HBc_P-D of FT:mat_peptide KF779302_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT1009). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779303_HBc_P-D Product feature CHAIN KF779303_HBc_P-D of FT:mat_peptide KF779303_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT1018). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779318_HBc_P-D Product feature CHAIN KF779318_HBc_P-D of FT:mat_peptide KF779318_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PNF4312). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779340_HBc_P-D Product feature CHAIN KF779340_HBc_P-D of FT:mat_peptide KF779340_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PNF4854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779341_HBc_P-D Product feature CHAIN KF779341_HBc_P-D of FT:mat_peptide KF779341_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PNF4864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779376_HBc_P-D Product feature CHAIN KF779376_HBc_P-D of FT:mat_peptide KF779376_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6029). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779377_HBc_P-D Product feature CHAIN KF779377_HBc_P-D of FT:mat_peptide KF779377_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779382_HBc_P-D Product feature CHAIN KF779382_HBc_P-D of FT:mat_peptide KF779382_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6295). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGTNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798260_HBc_P-D Product feature CHAIN KF798260_HBc_P-D of FT:mat_peptide KF798260_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798273_HBc_P-D Product feature CHAIN KF798273_HBc_P-D of FT:mat_peptide KF798273_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798281_HBc_P-D Product feature CHAIN KF798281_HBc_P-D of FT:mat_peptide KF798281_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-23). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798282_HBc_P-D Product feature CHAIN KF798282_HBc_P-D of FT:mat_peptide KF798282_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798283_HBc_P-D Product feature CHAIN KF798283_HBc_P-D of FT:mat_peptide KF798283_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798299_HBc_P-D Product feature CHAIN KF798299_HBc_P-D of FT:mat_peptide KF798299_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-41). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798301_HBc_P-D Product feature CHAIN KF798301_HBc_P-D of FT:mat_peptide KF798301_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-43). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLWWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798306_HBc_P-D Product feature CHAIN KF798306_HBc_P-D of FT:mat_peptide KF798306_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798307_HBc_P-D Product feature CHAIN KF798307_HBc_P-D of FT:mat_peptide KF798307_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-49). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF896606_HBc_P-D Product feature CHAIN KF896606_HBc_P-D of FT:mat_peptide KF896606_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LAV01). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922432_HBc_P-D Product feature CHAIN KF922432_HBc_P-D of FT:mat_peptide KF922432_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate N011). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ470885_HBc_P-D Product feature CHAIN KJ470885_HBc_P-D of FT:mat_peptide KJ470885_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8136). Partial genome (Contains: HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ470889_HBc_P-D Product feature CHAIN KJ470889_HBc_P-D of FT:mat_peptide KJ470889_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8034). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ470893_HBc_P-D Product feature CHAIN KJ470893_HBc_P-D of FT:mat_peptide KJ470893_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8118). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ470894_HBc_P-D Product feature CHAIN KJ470894_HBc_P-D of FT:mat_peptide KJ470894_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8066). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTHHHTAIRQAILCWGELMTLATWVGTNLEDPA
SRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ470895_HBc_P-D Product feature CHAIN KJ470895_HBc_P-D of FT:mat_peptide KJ470895_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8120). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTATALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDQS
SRDLVVSYVNTHMGLKFRQLLWYHTSCLMFGRETVQEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ470896_HBc_P-D Product feature CHAIN KJ470896_HBc_P-D of FT:mat_peptide KJ470896_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8122). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKXTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPXRRRSQSRESQC
>gnl|hbvpro|KJ647350_HBc_P-D Product feature CHAIN KJ647350_HBc_P-D of FT:mat_peptide KJ647350_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV197). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAIFCWGELMHLATWEGVNLEDXA
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRATVIEYLVSFGVWIRTPPPYRPSNAPILSTLPETTLIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ647352_HBc_P-D Product feature CHAIN KJ647352_HBc_P-D of FT:mat_peptide KJ647352_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV219). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMXLATWVGVNLEDQA
SRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSXLPETTVVRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ647353_HBc_P-D Product feature CHAIN KJ647353_HBc_P-D of FT:mat_peptide KJ647353_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV230). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPKRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KJ647355_HBc_P-D Product feature CHAIN KJ647355_HBc_P-D of FT:mat_peptide KJ647355_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV247). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVQLLSFLPADFFPSVRDFLDTATALFRDALESPEHCSPHHTALRQATLCWGELMTLATWVGGNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLSFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ843187_HBc_P-D Product feature CHAIN KJ843187_HBc_P-D of FT:mat_peptide KJ843187_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ag26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM519455_HBc_P-D Product feature CHAIN KM519455_HBc_P-D of FT:mat_peptide KM519455_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_WT_SA). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524338_HBc_P-D Product feature CHAIN KM524338_HBc_P-D of FT:mat_peptide KM524338_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV136_EP-CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524339_HBc_P-D Product feature CHAIN KM524339_HBc_P-D of FT:mat_peptide KM524339_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV064_EP-CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|KM524340_HBc_P-D Product feature CHAIN KM524340_HBc_P-D of FT:mat_peptide KM524340_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV094_EP-CHB). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|KM524341_HBc_P-D Product feature CHAIN KM524341_HBc_P-D of FT:mat_peptide KM524341_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV128_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524345_HBc_P-D Product feature CHAIN KM524345_HBc_P-D of FT:mat_peptide KM524345_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK082_EP-CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524346_HBc_P-D Product feature CHAIN KM524346_HBc_P-D of FT:mat_peptide KM524346_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK096_EP-CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRQGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524347_HBc_P-D Product feature CHAIN KM524347_HBc_P-D of FT:mat_peptide KM524347_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK102_EP-CHB). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFRVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524348_HBc_P-D Product feature CHAIN KM524348_HBc_P-D of FT:mat_peptide KM524348_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK129_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWGGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIPTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524349_HBc_P-D Product feature CHAIN KM524349_HBc_P-D of FT:mat_peptide KM524349_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-015_HIV-HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524350_HBc_P-D Product feature CHAIN KM524350_HBc_P-D of FT:mat_peptide KM524350_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-017_HIV-HBV). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524351_HBc_P-D Product feature CHAIN KM524351_HBc_P-D of FT:mat_peptide KM524351_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-020_HIV-HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524352_HBc_P-D Product feature CHAIN KM524352_HBc_P-D of FT:mat_peptide KM524352_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-025_HIV-HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524353_HBc_P-D Product feature CHAIN KM524353_HBc_P-D of FT:mat_peptide KM524353_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-031_HIV-HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524354_HBc_P-D Product feature CHAIN KM524354_HBc_P-D of FT:mat_peptide KM524354_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-058_HIV-HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524355_HBc_P-D Product feature CHAIN KM524355_HBc_P-D of FT:mat_peptide KM524355_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-092_HIV-HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524356_HBc_P-D Product feature CHAIN KM524356_HBc_P-D of FT:mat_peptide KM524356_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-123_HIV-HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM524358_HBc_P-D Product feature CHAIN KM524358_HBc_P-D of FT:mat_peptide KM524358_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV.I-057_HIV-HBV). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREPLESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLSFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSRDPQC
>gnl|hbvpro|KM524361_HBc_P-D Product feature CHAIN KM524361_HBc_P-D of FT:mat_peptide KM524361_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV.I-112_HIV-HBV). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVMEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM577668_HBc_P-D Product feature CHAIN KM577668_HBc_P-D of FT:mat_peptide KM577668_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDQVVSYVNNNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KM577669_HBc_P-D Product feature CHAIN KM577669_HBc_P-D of FT:mat_peptide KM577669_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDYFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SREQVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSKSREPQC
>gnl|hbvpro|KM577670_HBc_P-D Product feature CHAIN KM577670_HBc_P-D of FT:mat_peptide KM577670_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSLRDLLDTASALYRQALEAPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHLSCLTFGRQTVIEYLVSFGVWIRTPPPYRPPNAPILSILPETCVIRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM577671_HBc_P-D Product feature CHAIN KM577671_HBc_P-D of FT:mat_peptide KM577671_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-9). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWRELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606644_HBc_P-D Product feature CHAIN KM606644_HBc_P-D of FT:mat_peptide KM606644_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba3a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPANRPPNAPILSTLPESTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606645_HBc_P-D Product feature CHAIN KM606645_HBc_P-D of FT:mat_peptide KM606645_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba4a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTATALYRDALESPEHCSPHHTALRQATLCWGELMTLATWVGTNLEDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KM606654_HBc_P-D Product feature CHAIN KM606654_HBc_P-D of FT:mat_peptide KM606654_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba23a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRDALESPQHCSPHHTALRQAILCWGELMTLATWVGTNLDDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606655_HBc_P-D Product feature CHAIN KM606655_HBc_P-D of FT:mat_peptide KM606655_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba25a). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESSEHCSPHHTALRQAVLCWGDLMTLATWVGTNLEDPT
SRDLVVSYVNTNAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIQSTLPETTVVRRRGRSPRTRT
PSPRIRRSHSPRRIRSQSRESQC
>gnl|hbvpro|KM606664_HBc_P-D Product feature CHAIN KM606664_HBc_P-D of FT:mat_peptide KM606664_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba39a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDQP
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606670_HBc_P-D Product feature CHAIN KM606670_HBc_P-D of FT:mat_peptide KM606670_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba49a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPA
SRDLVVNYVNTNAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KM606675_HBc_P-D Product feature CHAIN KM606675_HBc_P-D of FT:mat_peptide KM606675_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba57a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSQESHC
>gnl|hbvpro|KM606682_HBc_P-D Product feature CHAIN KM606682_HBc_P-D of FT:mat_peptide KM606682_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba68a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETILEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606686_HBc_P-D Product feature CHAIN KM606686_HBc_P-D of FT:mat_peptide KM606686_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba74a). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606690_HBc_P-D Product feature CHAIN KM606690_HBc_P-D of FT:mat_peptide KM606690_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba81a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDAIKSPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606697_HBc_P-D Product feature CHAIN KM606697_HBc_P-D of FT:mat_peptide KM606697_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba95a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606698_HBc_P-D Product feature CHAIN KM606698_HBc_P-D of FT:mat_peptide KM606698_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba97a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDQA
SRDLVVSYVNTNMGLKFKQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606744_HBc_P-D Product feature CHAIN KM606744_HBc_P-D of FT:mat_peptide KM606744_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606745_HBc_P-D Product feature CHAIN KM606745_HBc_P-D of FT:mat_peptide KM606745_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606752_HBc_P-D Product feature CHAIN KM606752_HBc_P-D of FT:mat_peptide KM606752_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba100). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSRESQC
>gnl|hbvpro|KM606753_HBc_P-D Product feature CHAIN KM606753_HBc_P-D of FT:mat_peptide KM606753_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba109). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606755_HBc_P-D Product feature CHAIN KM606755_HBc_P-D of FT:mat_peptide KM606755_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba139). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESSEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPT
SRDLVVSYVNTNAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQCRESQG
>gnl|hbvpro|KP090177_HBc_P-D Product feature CHAIN KP090177_HBc_P-D of FT:mat_peptide KP090177_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP090178_HBc_P-D Product feature CHAIN KP090178_HBc_P-D of FT:mat_peptide KP090178_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRKRT
PSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP090179_HBc_P-D Product feature CHAIN KP090179_HBc_P-D of FT:mat_peptide KP090179_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPGRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP090180_HBc_P-D Product feature CHAIN KP090180_HBc_P-D of FT:mat_peptide KP090180_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP090181_HBc_P-D Product feature CHAIN KP090181_HBc_P-D of FT:mat_peptide KP090181_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR40). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPESQC
>gnl|hbvpro|KP168419_HBc_P-D Product feature CHAIN KP168419_HBc_P-D of FT:mat_peptide KP168419_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KN109). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRDALESPEHCSPHHTTLRQAILCWGELMNLATWVGANLQDQA
SRDLVVNYVNTNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP322599_HBc_P-D Product feature CHAIN KP322599_HBc_P-D of FT:mat_peptide KP322599_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2811). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP322600_HBc_P-D Product feature CHAIN KP322600_HBc_P-D of FT:mat_peptide KP322600_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2812). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP322601_HBc_P-D Product feature CHAIN KP322601_HBc_P-D of FT:mat_peptide KP322601_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2813). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671684_HBc_P-D Product feature CHAIN KP671684_HBc_P-D of FT:mat_peptide KP671684_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-2PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671685_HBc_P-D Product feature CHAIN KP671685_HBc_P-D of FT:mat_peptide KP671685_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-4PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671686_HBc_P-D Product feature CHAIN KP671686_HBc_P-D of FT:mat_peptide KP671686_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-5PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671687_HBc_P-D Product feature CHAIN KP671687_HBc_P-D of FT:mat_peptide KP671687_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-6PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671688_HBc_P-D Product feature CHAIN KP671688_HBc_P-D of FT:mat_peptide KP671688_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-7PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671689_HBc_P-D Product feature CHAIN KP671689_HBc_P-D of FT:mat_peptide KP671689_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-8PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671690_HBc_P-D Product feature CHAIN KP671690_HBc_P-D of FT:mat_peptide KP671690_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-9PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671691_HBc_P-D Product feature CHAIN KP671691_HBc_P-D of FT:mat_peptide KP671691_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-10PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671692_HBc_P-D Product feature CHAIN KP671692_HBc_P-D of FT:mat_peptide KP671692_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-11PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRETLKSPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671693_HBc_P-D Product feature CHAIN KP671693_HBc_P-D of FT:mat_peptide KP671693_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-12PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671694_HBc_P-D Product feature CHAIN KP671694_HBc_P-D of FT:mat_peptide KP671694_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-13PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671695_HBc_P-D Product feature CHAIN KP671695_HBc_P-D of FT:mat_peptide KP671695_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-14PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671696_HBc_P-D Product feature CHAIN KP671696_HBc_P-D of FT:mat_peptide KP671696_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-15PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671697_HBc_P-D Product feature CHAIN KP671697_HBc_P-D of FT:mat_peptide KP671697_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-17PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671698_HBc_P-D Product feature CHAIN KP671698_HBc_P-D of FT:mat_peptide KP671698_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-18PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLATWVGGNLEDPI
SRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWLRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671699_HBc_P-D Product feature CHAIN KP671699_HBc_P-D of FT:mat_peptide KP671699_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-19PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP671700_HBc_P-D Product feature CHAIN KP671700_HBc_P-D of FT:mat_peptide KP671700_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-20PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGDLMSLATWVGSNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP856975_HBc_P-D Product feature CHAIN KP856975_HBc_P-D of FT:mat_peptide KP856975_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFYPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP856976_HBc_P-D Product feature CHAIN KP856976_HBc_P-D of FT:mat_peptide KP856976_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGASVELLSFLPTDFYPSVRDLLDTAXALYRXALESPEHCTPHHTALRQAIQCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|KP856977_HBc_P-D Product feature CHAIN KP856977_HBc_P-D of FT:mat_peptide KP856977_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP856978_HBc_P-D Product feature CHAIN KP856978_HBc_P-D of FT:mat_peptide KP856978_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPPYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|KP856981_HBc_P-D Product feature CHAIN KP856981_HBc_P-D of FT:mat_peptide KP856981_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGANLEDPS
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRDTVQEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP856984_HBc_P-D Product feature CHAIN KP856984_HBc_P-D of FT:mat_peptide KP856984_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP856986_HBc_P-D Product feature CHAIN KP856986_HBc_P-D of FT:mat_peptide KP856986_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVXRRRGRSPRRRT
PSPRRRRSQSPRRRRXQSRESQC
>gnl|hbvpro|KP856989_HBc_P-D Product feature CHAIN KP856989_HBc_P-D of FT:mat_peptide KP856989_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRNALESPEHCSAHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP856990_HBc_P-D Product feature CHAIN KP856990_HBc_P-D of FT:mat_peptide KP856990_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQACICWGELMTLATWVGANLDDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP856993_HBc_P-D Product feature CHAIN KP856993_HBc_P-D of FT:mat_peptide KP856993_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPEDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVGYVNSHMGIKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP856996_HBc_P-D Product feature CHAIN KP856996_HBc_P-D of FT:mat_peptide KP856996_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTHMGLKFRQLLWFHTSCITFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|KP856997_HBc_P-D Product feature CHAIN KP856997_HBc_P-D of FT:mat_peptide KP856997_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELVSFLPTDFYPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857000_HBc_P-D Product feature CHAIN KP857000_HBc_P-D of FT:mat_peptide KP857000_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESHEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQT
SRDLVVSYVNTHMGLKFRQLLWFHVSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP857003_HBc_P-D Product feature CHAIN KP857003_HBc_P-D of FT:mat_peptide KP857003_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPHRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857004_HBc_P-D Product feature CHAIN KP857004_HBc_P-D of FT:mat_peptide KP857004_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857005_HBc_P-D Product feature CHAIN KP857005_HBc_P-D of FT:mat_peptide KP857005_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNSTMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857006_HBc_P-D Product feature CHAIN KP857006_HBc_P-D of FT:mat_peptide KP857006_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857007_HBc_P-D Product feature CHAIN KP857007_HBc_P-D of FT:mat_peptide KP857007_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPX
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETXVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857008_HBc_P-D Product feature CHAIN KP857008_HBc_P-D of FT:mat_peptide KP857008_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KP857013_HBc_P-D Product feature CHAIN KP857013_HBc_P-D of FT:mat_peptide KP857013_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDXDPYKEFGASVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMXLATWVGGNLEDPV
SRXLVVGYVNTXVGLKFRQLLWFHISCLTFGREVVXEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRSSRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857015_HBc_P-D Product feature CHAIN KP857015_HBc_P-D of FT:mat_peptide KP857015_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857016_HBc_P-D Product feature CHAIN KP857016_HBc_P-D of FT:mat_peptide KP857016_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857017_HBc_P-D Product feature CHAIN KP857017_HBc_P-D of FT:mat_peptide KP857017_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALYREALESPEHCTPHHTALRQAIICWGELMTLATWVGGNLDDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857018_HBc_P-D Product feature CHAIN KP857018_HBc_P-D of FT:mat_peptide KP857018_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAIICWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLCFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETXVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP857019_HBc_P-D Product feature CHAIN KP857019_HBc_P-D of FT:mat_peptide KP857019_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPTVRDLLDTASALFREALESPEHVSPHHTALRQAILCWGDLMNLATWVGGNLEDPT
SRDLVVGYVNTTVGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVRQRGRSLRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857020_HBc_P-D Product feature CHAIN KP857020_HBc_P-D of FT:mat_peptide KP857020_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857021_HBc_P-D Product feature CHAIN KP857021_HBc_P-D of FT:mat_peptide KP857021_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHVSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|KP857022_HBc_P-D Product feature CHAIN KP857022_HBc_P-D of FT:mat_peptide KP857022_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|KP857023_HBc_P-D Product feature CHAIN KP857023_HBc_P-D of FT:mat_peptide KP857023_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857024_HBc_P-D Product feature CHAIN KP857024_HBc_P-D of FT:mat_peptide KP857024_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857025_HBc_P-D Product feature CHAIN KP857025_HBc_P-D of FT:mat_peptide KP857025_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857026_HBc_P-D Product feature CHAIN KP857026_HBc_P-D of FT:mat_peptide KP857026_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857027_HBc_P-D Product feature CHAIN KP857027_HBc_P-D of FT:mat_peptide KP857027_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857028_HBc_P-D Product feature CHAIN KP857028_HBc_P-D of FT:mat_peptide KP857028_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFRDALESPEHCSAHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVVEYLVAFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRPPRRRT
PSPRRRSSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP857029_HBc_P-D Product feature CHAIN KP857029_HBc_P-D of FT:mat_peptide KP857029_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTAFALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLADPT
SRDQVVSYVNTNMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857030_HBc_P-D Product feature CHAIN KP857030_HBc_P-D of FT:mat_peptide KP857030_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFREALESPQHCSPHHTALRQAYLCWGELMNLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857031_HBc_P-D Product feature CHAIN KP857031_HBc_P-D of FT:mat_peptide KP857031_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTVSALYREALESPEHCTPHHTAIRQAVLCWMELMKLATWVGGNLQDPV
SRDLVVSYVNDNMGLKFRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857032_HBc_P-D Product feature CHAIN KP857032_HBc_P-D of FT:mat_peptide KP857032_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNSSMGIKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPPYRPSNAPILSTLPEITVVRPRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857033_HBc_P-D Product feature CHAIN KP857033_HBc_P-D of FT:mat_peptide KP857033_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLDDPS
SRDLVVGYVNTHMGLKFRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857034_HBc_P-D Product feature CHAIN KP857034_HBc_P-D of FT:mat_peptide KP857034_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857035_HBc_P-D Product feature CHAIN KP857035_HBc_P-D of FT:mat_peptide KP857035_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857036_HBc_P-D Product feature CHAIN KP857036_HBc_P-D of FT:mat_peptide KP857036_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857037_HBc_P-D Product feature CHAIN KP857037_HBc_P-D of FT:mat_peptide KP857037_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRGRRSQSPRSRRSPSRGSQC
>gnl|hbvpro|KP857038_HBc_P-D Product feature CHAIN KP857038_HBc_P-D of FT:mat_peptide KP857038_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857039_HBc_P-D Product feature CHAIN KP857039_HBc_P-D of FT:mat_peptide KP857039_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGDLINLSTWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSEC
>gnl|hbvpro|KP857040_HBc_P-D Product feature CHAIN KP857040_HBc_P-D of FT:mat_peptide KP857040_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KP857041_HBc_P-D Product feature CHAIN KP857041_HBc_P-D of FT:mat_peptide KP857041_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDQP
SRDLVVSYVNTNVGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|KP857042_HBc_P-D Product feature CHAIN KP857042_HBc_P-D of FT:mat_peptide KP857042_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLGTWVGGNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857043_HBc_P-D Product feature CHAIN KP857043_HBc_P-D of FT:mat_peptide KP857043_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGDLMNLATWVGANLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857045_HBc_P-D Product feature CHAIN KP857045_HBc_P-D of FT:mat_peptide KP857045_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857046_HBc_P-D Product feature CHAIN KP857046_HBc_P-D of FT:mat_peptide KP857046_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP857047_HBc_P-D Product feature CHAIN KP857047_HBc_P-D of FT:mat_peptide KP857047_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857048_HBc_P-D Product feature CHAIN KP857048_HBc_P-D of FT:mat_peptide KP857048_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQG
SRDLVVSYVNNNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857049_HBc_P-D Product feature CHAIN KP857049_HBc_P-D of FT:mat_peptide KP857049_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVQLLSFLPSDFFPSIRDLLDTAAALFGEALESPEHCTPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857050_HBc_P-D Product feature CHAIN KP857050_HBc_P-D of FT:mat_peptide KP857050_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGSNLEDPV
SRDLVVNYVNTTAGIKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPLNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857051_HBc_P-D Product feature CHAIN KP857051_HBc_P-D of FT:mat_peptide KP857051_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSRC
>gnl|hbvpro|KP857053_HBc_P-D Product feature CHAIN KP857053_HBc_P-D of FT:mat_peptide KP857053_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857094_HBc_P-D Product feature CHAIN KP857094_HBc_P-D of FT:mat_peptide KP857094_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857097_HBc_P-D Product feature CHAIN KP857097_HBc_P-D of FT:mat_peptide KP857097_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857099_HBc_P-D Product feature CHAIN KP857099_HBc_P-D of FT:mat_peptide KP857099_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857100_HBc_P-D Product feature CHAIN KP857100_HBc_P-D of FT:mat_peptide KP857100_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857104_HBc_P-D Product feature CHAIN KP857104_HBc_P-D of FT:mat_peptide KP857104_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857105_HBc_P-D Product feature CHAIN KP857105_HBc_P-D of FT:mat_peptide KP857105_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857106_HBc_P-D Product feature CHAIN KP857106_HBc_P-D of FT:mat_peptide KP857106_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857107_HBc_P-D Product feature CHAIN KP857107_HBc_P-D of FT:mat_peptide KP857107_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857109_HBc_P-D Product feature CHAIN KP857109_HBc_P-D of FT:mat_peptide KP857109_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPAHCSPHHTALRQATICWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857110_HBc_P-D Product feature CHAIN KP857110_HBc_P-D of FT:mat_peptide KP857110_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857111_HBc_P-D Product feature CHAIN KP857111_HBc_P-D of FT:mat_peptide KP857111_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857114_HBc_P-D Product feature CHAIN KP857114_HBc_P-D of FT:mat_peptide KP857114_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALDSPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857115_HBc_P-D Product feature CHAIN KP857115_HBc_P-D of FT:mat_peptide KP857115_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDYFPSVRDLLDTARALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRFTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857116_HBc_P-D Product feature CHAIN KP857116_HBc_P-D of FT:mat_peptide KP857116_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857117_HBc_P-D Product feature CHAIN KP857117_HBc_P-D of FT:mat_peptide KP857117_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KP995092_HBc_P-D Product feature CHAIN KP995092_HBc_P-D of FT:mat_peptide KP995092_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 57-Cirrhosis). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
DIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQTS
RDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRTP
SPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP995100_HBc_P-D Product feature CHAIN KP995100_HBc_P-D of FT:mat_peptide KP995100_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 49-Cirrhosis). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR905423_HBc_P-D Product feature CHAIN KR905423_HBc_P-D of FT:mat_peptide KR905423_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KR905424_HBc_P-D Product feature CHAIN KR905424_HBc_P-D of FT:mat_peptide KR905424_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151620_HBc_P-D Product feature CHAIN KT151620_HBc_P-D of FT:mat_peptide KT151620_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT347090_HBc_P-D Product feature CHAIN KT347090_HBc_P-D of FT:mat_peptide KT347090_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGMTMG). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366465_HBc_P-D Product feature CHAIN KT366465_HBc_P-D of FT:mat_peptide KT366465_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.49). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366491_HBc_P-D Product feature CHAIN KT366491_HBc_P-D of FT:mat_peptide KT366491_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KT366493_HBc_P-D Product feature CHAIN KT366493_HBc_P-D of FT:mat_peptide KT366493_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.41). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366494_HBc_P-D Product feature CHAIN KT366494_HBc_P-D of FT:mat_peptide KT366494_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.42). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366495_HBc_P-D Product feature CHAIN KT366495_HBc_P-D of FT:mat_peptide KT366495_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.45). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366496_HBc_P-D Product feature CHAIN KT366496_HBc_P-D of FT:mat_peptide KT366496_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.46). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|KT366497_HBc_P-D Product feature CHAIN KT366497_HBc_P-D of FT:mat_peptide KT366497_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.48). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366498_HBc_P-D Product feature CHAIN KT366498_HBc_P-D of FT:mat_peptide KT366498_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366499_HBc_P-D Product feature CHAIN KT366499_HBc_P-D of FT:mat_peptide KT366499_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366500_HBc_P-D Product feature CHAIN KT366500_HBc_P-D of FT:mat_peptide KT366500_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366501_HBc_P-D Product feature CHAIN KT366501_HBc_P-D of FT:mat_peptide KT366501_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366502_HBc_P-D Product feature CHAIN KT366502_HBc_P-D of FT:mat_peptide KT366502_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366506_HBc_P-D Product feature CHAIN KT366506_HBc_P-D of FT:mat_peptide KT366506_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366507_HBc_P-D Product feature CHAIN KT366507_HBc_P-D of FT:mat_peptide KT366507_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.24). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366508_HBc_P-D Product feature CHAIN KT366508_HBc_P-D of FT:mat_peptide KT366508_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.25). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366509_HBc_P-D Product feature CHAIN KT366509_HBc_P-D of FT:mat_peptide KT366509_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.26). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366510_HBc_P-D Product feature CHAIN KT366510_HBc_P-D of FT:mat_peptide KT366510_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.36). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366511_HBc_P-D Product feature CHAIN KT366511_HBc_P-D of FT:mat_peptide KT366511_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.37). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749821_HBc_P-D Product feature CHAIN KT749821_HBc_P-D of FT:mat_peptide KT749821_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTPSRESQC
>gnl|hbvpro|KT749823_HBc_P-D Product feature CHAIN KT749823_HBc_P-D of FT:mat_peptide KT749823_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL3). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLRDTASALYRDALESSEHCTPHHTALRQAILCWVELMSLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KT749827_HBc_P-D Product feature CHAIN KT749827_HBc_P-D of FT:mat_peptide KT749827_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAFLCWGELMTLATWVGTNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KT749828_HBc_P-D Product feature CHAIN KT749828_HBc_P-D of FT:mat_peptide KT749828_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749845_HBc_P-D Product feature CHAIN KT749845_HBc_P-D of FT:mat_peptide KT749845_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL24). Partial genome (Contains: HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELISFLPSDFFPSVRDLLATAQALYRDALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SREQVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPANAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KT749855_HBc_P-D Product feature CHAIN KT749855_HBc_P-D of FT:mat_peptide KT749855_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL23b). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQILWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT963508_HBc_P-D Product feature CHAIN KT963508_HBc_P-D of FT:mat_peptide KT963508_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668433_HBc_P-D Product feature CHAIN KU668433_HBc_P-D of FT:mat_peptide KU668433_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV071). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTFATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNALILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|KU668434_HBc_P-D Product feature CHAIN KU668434_HBc_P-D of FT:mat_peptide KU668434_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV072). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668435_HBc_P-D Product feature CHAIN KU668435_HBc_P-D of FT:mat_peptide KU668435_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV102). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTFATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|KU668436_HBc_P-D Product feature CHAIN KU668436_HBc_P-D of FT:mat_peptide KU668436_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV103). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668437_HBc_P-D Product feature CHAIN KU668437_HBc_P-D of FT:mat_peptide KU668437_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV108). Complete genome. [Hepadnaviridae] (length=183 residues).
RDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668438_HBc_P-D Product feature CHAIN KU668438_HBc_P-D of FT:mat_peptide KU668438_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV111). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668439_HBc_P-D Product feature CHAIN KU668439_HBc_P-D of FT:mat_peptide KU668439_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV124). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668441_HBc_P-D Product feature CHAIN KU668441_HBc_P-D of FT:mat_peptide KU668441_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV170). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668442_HBc_P-D Product feature CHAIN KU668442_HBc_P-D of FT:mat_peptide KU668442_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV175). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHAPLRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668444_HBc_P-D Product feature CHAIN KU668444_HBc_P-D of FT:mat_peptide KU668444_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV180). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLLVSYVNSNMGLKFRPLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668445_HBc_P-D Product feature CHAIN KU668445_HBc_P-D of FT:mat_peptide KU668445_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV181). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALQSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668446_HBc_P-D Product feature CHAIN KU668446_HBc_P-D of FT:mat_peptide KU668446_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV183). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668447_HBc_P-D Product feature CHAIN KU668447_HBc_P-D of FT:mat_peptide KU668447_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV191). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGVTVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668448_HBc_P-D Product feature CHAIN KU668448_HBc_P-D of FT:mat_peptide KU668448_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV192). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPA
TRDLLLNYVNTNMGLPVLPRLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU668449_HBc_P-D Product feature CHAIN KU668449_HBc_P-D of FT:mat_peptide KU668449_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV207). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736924_HBc_P-D Product feature CHAIN KU736924_HBc_P-D of FT:mat_peptide KU736924_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736925_HBc_P-D Product feature CHAIN KU736925_HBc_P-D of FT:mat_peptide KU736925_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736926_HBc_P-D Product feature CHAIN KU736926_HBc_P-D of FT:mat_peptide KU736926_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_18). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESXEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRXLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736927_HBc_P-D Product feature CHAIN KU736927_HBc_P-D of FT:mat_peptide KU736927_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPXVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX196208_HBc_P-D Product feature CHAIN KX196208_HBc_P-D of FT:mat_peptide KX196208_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL093). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196209_HBc_P-D Product feature CHAIN KX196209_HBc_P-D of FT:mat_peptide KX196209_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL094). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196210_HBc_P-D Product feature CHAIN KX196210_HBc_P-D of FT:mat_peptide KX196210_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL095). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196211_HBc_P-D Product feature CHAIN KX196211_HBc_P-D of FT:mat_peptide KX196211_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL096). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196212_HBc_P-D Product feature CHAIN KX196212_HBc_P-D of FT:mat_peptide KX196212_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL097). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196213_HBc_P-D Product feature CHAIN KX196213_HBc_P-D of FT:mat_peptide KX196213_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL098). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196214_HBc_P-D Product feature CHAIN KX196214_HBc_P-D of FT:mat_peptide KX196214_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL099). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPESTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196215_HBc_P-D Product feature CHAIN KX196215_HBc_P-D of FT:mat_peptide KX196215_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0100). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196216_HBc_P-D Product feature CHAIN KX196216_HBc_P-D of FT:mat_peptide KX196216_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0101). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196217_HBc_P-D Product feature CHAIN KX196217_HBc_P-D of FT:mat_peptide KX196217_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0102). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196218_HBc_P-D Product feature CHAIN KX196218_HBc_P-D of FT:mat_peptide KX196218_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0103). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196219_HBc_P-D Product feature CHAIN KX196219_HBc_P-D of FT:mat_peptide KX196219_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0104). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196220_HBc_P-D Product feature CHAIN KX196220_HBc_P-D of FT:mat_peptide KX196220_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0105). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196221_HBc_P-D Product feature CHAIN KX196221_HBc_P-D of FT:mat_peptide KX196221_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0106). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196222_HBc_P-D Product feature CHAIN KX196222_HBc_P-D of FT:mat_peptide KX196222_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0107). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX196224_HBc_P-D Product feature CHAIN KX196224_HBc_P-D of FT:mat_peptide KX196224_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0109). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196225_HBc_P-D Product feature CHAIN KX196225_HBc_P-D of FT:mat_peptide KX196225_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0110). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196226_HBc_P-D Product feature CHAIN KX196226_HBc_P-D of FT:mat_peptide KX196226_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0111). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196227_HBc_P-D Product feature CHAIN KX196227_HBc_P-D of FT:mat_peptide KX196227_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0112). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196228_HBc_P-D Product feature CHAIN KX196228_HBc_P-D of FT:mat_peptide KX196228_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0113). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196229_HBc_P-D Product feature CHAIN KX196229_HBc_P-D of FT:mat_peptide KX196229_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0114). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLLFHISCLTFGRQTVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDPQC
>gnl|hbvpro|KX196230_HBc_P-D Product feature CHAIN KX196230_HBc_P-D of FT:mat_peptide KX196230_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0115). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196231_HBc_P-D Product feature CHAIN KX196231_HBc_P-D of FT:mat_peptide KX196231_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0116). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196232_HBc_P-D Product feature CHAIN KX196232_HBc_P-D of FT:mat_peptide KX196232_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0117). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196233_HBc_P-D Product feature CHAIN KX196233_HBc_P-D of FT:mat_peptide KX196233_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0118). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196234_HBc_P-D Product feature CHAIN KX196234_HBc_P-D of FT:mat_peptide KX196234_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0119). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX196235_HBc_P-D Product feature CHAIN KX196235_HBc_P-D of FT:mat_peptide KX196235_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0120). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFLSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX196236_HBc_P-D Product feature CHAIN KX196236_HBc_P-D of FT:mat_peptide KX196236_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0121). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX260231_HBc_P-D Product feature CHAIN KX260231_HBc_P-D of FT:mat_peptide KX260231_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR-32). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276856_HBc_P-D Product feature CHAIN KX276856_HBc_P-D of FT:mat_peptide KX276856_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDQP
SRDLVVGYVNTNMGVKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRQRGRSPRRRT
PSPRRRRSKSPRRRRSKSRDSQC
>gnl|hbvpro|KX276857_HBc_P-D Product feature CHAIN KX276857_HBc_P-D of FT:mat_peptide KX276857_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTAXALYREALESPEHCXPHHTALRQAILCWGXLMTLATWVGVNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHXSCXTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSXSRESQC
>gnl|hbvpro|KX357622_HBc_P-D Product feature CHAIN KX357622_HBc_P-D of FT:mat_peptide KX357622_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GD104ETH). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTAAALYRDALESPEHCTPHHTALRQAILCWGELMNLATWVGVNLEDQT
SRDQVVSYVNTNMGLKFRQLLWFHISSLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRDSQC
>gnl|hbvpro|KX357637_HBc_P-D Product feature CHAIN KX357637_HBc_P-D of FT:mat_peptide KX357637_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK20ETH). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357638_HBc_P-D Product feature CHAIN KX357638_HBc_P-D of FT:mat_peptide KX357638_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AA95ETH). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHVILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357639_HBc_P-D Product feature CHAIN KX357639_HBc_P-D of FT:mat_peptide KX357639_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GD82ETH). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827290_HBc_P-D Product feature CHAIN KX827290_HBc_P-D of FT:mat_peptide KX827290_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno1.2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSGFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827291_HBc_P-D Product feature CHAIN KX827291_HBc_P-D of FT:mat_peptide KX827291_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno2.2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827292_HBc_P-D Product feature CHAIN KX827292_HBc_P-D of FT:mat_peptide KX827292_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno3.1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILPTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827300_HBc_P-D Product feature CHAIN KX827300_HBc_P-D of FT:mat_peptide KX827300_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno21.2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX827301_HBc_P-D Product feature CHAIN KX827301_HBc_P-D of FT:mat_peptide KX827301_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno30.4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353911_HBc_P-D Product feature CHAIN KY353911_HBc_P-D of FT:mat_peptide KY353911_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-HBV.22). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVKLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353914_HBc_P-D Product feature CHAIN KY353914_HBc_P-D of FT:mat_peptide KY353914_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-HBV.45). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353920_HBc_P-D Product feature CHAIN KY353920_HBc_P-D of FT:mat_peptide KY353920_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-HBV.25). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353921_HBc_P-D Product feature CHAIN KY353921_HBc_P-D of FT:mat_peptide KY353921_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-HBV.26). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY382412_HBc_P-D Product feature CHAIN KY382412_HBc_P-D of FT:mat_peptide KY382412_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1_1896). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY382414_HBc_P-D Product feature CHAIN KY382414_HBc_P-D of FT:mat_peptide KY382414_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1_wt). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY629630_HBc_P-D Product feature CHAIN KY629630_HBc_P-D of FT:mat_peptide KY629630_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TYM13097). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY629633_HBc_P-D Product feature CHAIN KY629633_HBc_P-D of FT:mat_peptide KY629633_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KLMY14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRQTVXEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KY629634_HBc_P-D Product feature CHAIN KY629634_HBc_P-D of FT:mat_peptide KY629634_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KLMY16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDIVLEYLVSFGVWIRTPPAYRPANAPILSTLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|L27106_HBc_P-D Product feature CHAIN L27106_HBc_P-D of FT:mat_peptide L27106_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMNLATWVGGNLEDPT
SRDLIVNYVNTNMGLRFRQLLWFHLSCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRPQSPRRRRSQSRGSQC
>gnl|hbvpro|LC365689_HBc_P-D Product feature CHAIN LC365689_HBc_P-D of FT:mat_peptide LC365689_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HB17-0791). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LK995390_HBc_P-D Product feature CHAIN LK995390_HBc_P-D of FT:mat_peptide LK995390_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NAT2037627). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
FRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPISSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LK995394_HBc_P-D Product feature CHAIN LK995394_HBc_P-D of FT:mat_peptide LK995394_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NAT2037662). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRHSQC
>gnl|hbvpro|LK995395_HBc_P-D Product feature CHAIN LK995395_HBc_P-D of FT:mat_peptide LK995395_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NAT2037632). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992438_HBc_P-D Product feature CHAIN LT992438_HBc_P-D of FT:mat_peptide LT992438_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992439_HBc_P-D Product feature CHAIN LT992439_HBc_P-D of FT:mat_peptide LT992439_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992444_HBc_P-D Product feature CHAIN LT992444_HBc_P-D of FT:mat_peptide LT992444_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992454_HBc_P-D Product feature CHAIN LT992454_HBc_P-D of FT:mat_peptide LT992454_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA222). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|M32138_HBc_P-D Product feature CHAIN M32138_HBc_P-D of FT:mat_peptide M32138_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-21). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|MF488704_HBc_P-D Product feature CHAIN MF488704_HBc_P-D of FT:mat_peptide MF488704_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-PCP229). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHSALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF618339_HBc_P-D Product feature CHAIN MF618339_HBc_P-D of FT:mat_peptide MF618339_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV006). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF618340_HBc_P-D Product feature CHAIN MF618340_HBc_P-D of FT:mat_peptide MF618340_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV009). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF618341_HBc_P-D Product feature CHAIN MF618341_HBc_P-D of FT:mat_peptide MF618341_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV011). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF618342_HBc_P-D Product feature CHAIN MF618342_HBc_P-D of FT:mat_peptide MF618342_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV053). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTFATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|MF618343_HBc_P-D Product feature CHAIN MF618343_HBc_P-D of FT:mat_peptide MF618343_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV054). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF618348_HBc_P-D Product feature CHAIN MF618348_HBc_P-D of FT:mat_peptide MF618348_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV137). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF618349_HBc_P-D Product feature CHAIN MF618349_HBc_P-D of FT:mat_peptide MF618349_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV165). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|MF925358_HBc_P-D Product feature CHAIN MF925358_HBc_P-D of FT:mat_peptide MF925358_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV01). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925363_HBc_P-D Product feature CHAIN MF925363_HBc_P-D of FT:mat_peptide MF925363_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV07). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925364_HBc_P-D Product feature CHAIN MF925364_HBc_P-D of FT:mat_peptide MF925364_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV08). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925366_HBc_P-D Product feature CHAIN MF925366_HBc_P-D of FT:mat_peptide MF925366_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV10). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVEILSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLMFGRETVSEFLVSFGVWIRTPPAYRPQNAPILSTLPETCVVRQRRRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925379_HBc_P-D Product feature CHAIN MF925379_HBc_P-D of FT:mat_peptide MF925379_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV23). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925383_HBc_P-D Product feature CHAIN MF925383_HBc_P-D of FT:mat_peptide MF925383_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLGTWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925390_HBc_P-D Product feature CHAIN MF925390_HBc_P-D of FT:mat_peptide MF925390_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV34). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRCGSTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925391_HBc_P-D Product feature CHAIN MF925391_HBc_P-D of FT:mat_peptide MF925391_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV35). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925393_HBc_P-D Product feature CHAIN MF925393_HBc_P-D of FT:mat_peptide MF925393_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV38). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MG491126_HBc_P-D Product feature CHAIN MG491126_HBc_P-D of FT:mat_peptide MG491126_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan4Hs). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASLELLSFLPTDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAYLCWGELMSLATWVGGNLQDPV
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRES
>gnl|hbvpro|MG491127_HBc_P-D Product feature CHAIN MG491127_HBc_P-D of FT:mat_peptide MG491127_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan5HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491134_HBc_P-D Product feature CHAIN MG491134_HBc_P-D of FT:mat_peptide MG491134_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan12HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLASFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491136_HBc_P-D Product feature CHAIN MG491136_HBc_P-D of FT:mat_peptide MG491136_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan14HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491137_HBc_P-D Product feature CHAIN MG491137_HBc_P-D of FT:mat_peptide MG491137_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan15HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALCREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREP
>gnl|hbvpro|MG491138_HBc_P-D Product feature CHAIN MG491138_HBc_P-D of FT:mat_peptide MG491138_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan16HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALGQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491143_HBc_P-D Product feature CHAIN MG491143_HBc_P-D of FT:mat_peptide MG491143_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan21HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491144_HBc_P-D Product feature CHAIN MG491144_HBc_P-D of FT:mat_peptide MG491144_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan22HC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSPHHTALRQATLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491146_HBc_P-D Product feature CHAIN MG491146_HBc_P-D of FT:mat_peptide MG491146_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan24HC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491147_HBc_P-D Product feature CHAIN MG491147_HBc_P-D of FT:mat_peptide MG491147_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan25HC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRES
>gnl|hbvpro|MG491148_HBc_P-D Product feature CHAIN MG491148_HBc_P-D of FT:mat_peptide MG491148_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan26HC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRES
>gnl|hbvpro|MG491149_HBc_P-D Product feature CHAIN MG491149_HBc_P-D of FT:mat_peptide MG491149_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan27TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETAVIRRRGRSPRRRT
PSPRRRRSQSPRRKRSKSRES
>gnl|hbvpro|MG491152_HBc_P-D Product feature CHAIN MG491152_HBc_P-D of FT:mat_peptide MG491152_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan30TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSAHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491155_HBc_P-D Product feature CHAIN MG491155_HBc_P-D of FT:mat_peptide MG491155_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan33TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDQT
SRDLVVSYVNTNMGLKFRQLLWFHISCLMFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRSRTPRRRT
PSPRRRRSQSPRRRRSQSRDS
>gnl|hbvpro|MG491156_HBc_P-D Product feature CHAIN MG491156_HBc_P-D of FT:mat_peptide MG491156_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan34TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPDHCSPHHTALRQAILCWGELMNLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSREP
>gnl|hbvpro|MG491157_HBc_P-D Product feature CHAIN MG491157_HBc_P-D of FT:mat_peptide MG491157_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan35TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491158_HBc_P-D Product feature CHAIN MG491158_HBc_P-D of FT:mat_peptide MG491158_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan36TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVQLLSFLPADFFPSVRDLLDTASALFRDALESSEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPT
SRDLVVHYVNENMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491159_HBc_P-D Product feature CHAIN MG491159_HBc_P-D of FT:mat_peptide MG491159_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan37TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSAHHTALRQAILCWGDLITLSTWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491161_HBc_P-D Product feature CHAIN MG491161_HBc_P-D of FT:mat_peptide MG491161_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan39TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491162_HBc_P-D Product feature CHAIN MG491162_HBc_P-D of FT:mat_peptide MG491162_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan40TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPHDFFPSIRDLLDTASALYRDALESPEHCSPHHTAIRQACLCWGELMNLATWVGGNLEDPM
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSREP
>gnl|hbvpro|MG491165_HBc_P-D Product feature CHAIN MG491165_HBc_P-D of FT:mat_peptide MG491165_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan43TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491167_HBc_P-D Product feature CHAIN MG491167_HBc_P-D of FT:mat_peptide MG491167_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan45TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPADFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491168_HBc_P-D Product feature CHAIN MG491168_HBc_P-D of FT:mat_peptide MG491168_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan46TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491169_HBc_P-D Product feature CHAIN MG491169_HBc_P-D of FT:mat_peptide MG491169_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan47TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491170_HBc_P-D Product feature CHAIN MG491170_HBc_P-D of FT:mat_peptide MG491170_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan48TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPADFFTSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491172_HBc_P-D Product feature CHAIN MG491172_HBc_P-D of FT:mat_peptide MG491172_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan50TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELISFLPADFFPSVRDLLDTASALYREALESSEHCTPHHTALRQAILCWAELMSLATWVGSNLEDQP
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIRQRGRSTRRRT
PSPRRRRSQSPRRRRSPSRDS
>gnl|hbvpro|MG491173_HBc_P-D Product feature CHAIN MG491173_HBc_P-D of FT:mat_peptide MG491173_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan51TC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVQLLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491174_HBc_P-D Product feature CHAIN MG491174_HBc_P-D of FT:mat_peptide MG491174_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan53TC). Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTARALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRIRSQSRES
>gnl|hbvpro|MG491175_HBc_P-D Product feature CHAIN MG491175_HBc_P-D of FT:mat_peptide MG491175_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan54CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRES
>gnl|hbvpro|MG491177_HBc_P-D Product feature CHAIN MG491177_HBc_P-D of FT:mat_peptide MG491177_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan56CC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAFLCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491181_HBc_P-D Product feature CHAIN MG491181_HBc_P-D of FT:mat_peptide MG491181_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan60CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491182_HBc_P-D Product feature CHAIN MG491182_HBc_P-D of FT:mat_peptide MG491182_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan61CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491183_HBc_P-D Product feature CHAIN MG491183_HBc_P-D of FT:mat_peptide MG491183_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan62CC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLLNLSTWVGGNLEDQT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRPRGRAPRRRT
PSPRRRRSQSPRRKRSQSRES
>gnl|hbvpro|MG491184_HBc_P-D Product feature CHAIN MG491184_HBc_P-D of FT:mat_peptide MG491184_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan63CC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIRSRGRTPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491186_HBc_P-D Product feature CHAIN MG491186_HBc_P-D of FT:mat_peptide MG491186_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan65CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRES
>gnl|hbvpro|MG491187_HBc_P-D Product feature CHAIN MG491187_HBc_P-D of FT:mat_peptide MG491187_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan66CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491188_HBc_P-D Product feature CHAIN MG491188_HBc_P-D of FT:mat_peptide MG491188_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan67CC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLMFGRDTVIEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREP
>gnl|hbvpro|MG491190_HBc_P-D Product feature CHAIN MG491190_HBc_P-D of FT:mat_peptide MG491190_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan69CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491191_HBc_P-D Product feature CHAIN MG491191_HBc_P-D of FT:mat_peptide MG491191_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan70CC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRFPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG491192_HBc_P-D Product feature CHAIN MG491192_HBc_P-D of FT:mat_peptide MG491192_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan71CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|MG686619_HBc_P-D Product feature CHAIN MG686619_HBc_P-D of FT:mat_peptide MG686619_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 586PAK). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASPLYREALESPDHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWVRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|MH464831_HBc_P-D Product feature CHAIN MH464831_HBc_P-D of FT:mat_peptide MH464831_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA109). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
IDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPASR
DLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464832_HBc_P-D Product feature CHAIN MH464832_HBc_P-D of FT:mat_peptide MH464832_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA110). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464833_HBc_P-D Product feature CHAIN MH464833_HBc_P-D of FT:mat_peptide MH464833_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA111). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
DPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRD
LVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRRRTP
SPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464834_HBc_P-D Product feature CHAIN MH464834_HBc_P-D of FT:mat_peptide MH464834_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA112). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHSSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464836_HBc_P-D Product feature CHAIN MH464836_HBc_P-D of FT:mat_peptide MH464836_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA114). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLGVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464838_HBc_P-D Product feature CHAIN MH464838_HBc_P-D of FT:mat_peptide MH464838_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA116). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPADFFPSVHDLLDTAKALYRDALESPEHCSPHHTALRQAILCWGDLIXLSTWVGVNLDDQG
SRDRVVSYVNTNMGLKFRQLLWFHISCLMFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH464840_HBc_P-D Product feature CHAIN MH464840_HBc_P-D of FT:mat_peptide MH464840_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA118). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXXMTLATWXGVNLEDPA
SRDLVVGYVNTNMGLKFRQLXWFHISCLTFGXETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464842_HBc_P-D Product feature CHAIN MH464842_HBc_P-D of FT:mat_peptide MH464842_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA120). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
SPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRD
LXXXYXXLNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRRRTP
SPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464843_HBc_P-D Product feature CHAIN MH464843_HBc_P-D of FT:mat_peptide MH464843_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA121). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|MH464844_HBc_P-D Product feature CHAIN MH464844_HBc_P-D of FT:mat_peptide MH464844_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA122). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464845_HBc_P-D Product feature CHAIN MH464845_HBc_P-D of FT:mat_peptide MH464845_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA123). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
IDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLATWVGVNLEDPASR
DLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRRRT
PSPRXRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464847_HBc_P-D Product feature CHAIN MH464847_HBc_P-D of FT:mat_peptide MH464847_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA125). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
PYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDL
VVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRRRTPS
PRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464848_HBc_P-D Product feature CHAIN MH464848_HBc_P-D of FT:mat_peptide MH464848_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA126). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
DPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGVNLEDPASRD
LVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRRRTP
SPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464849_HBc_P-D Product feature CHAIN MH464849_HBc_P-D of FT:mat_peptide MH464849_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA127). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
DPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRD
LVVSYVNTNMGLKFRXLLVVHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRRRTP
SPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464854_HBc_P-D Product feature CHAIN MH464854_HBc_P-D of FT:mat_peptide MH464854_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA132). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724954_HBc_P-D Product feature CHAIN MH724954_HBc_P-D of FT:mat_peptide MH724954_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724955_HBc_P-D Product feature CHAIN MH724955_HBc_P-D of FT:mat_peptide MH724955_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724956_HBc_P-D Product feature CHAIN MH724956_HBc_P-D of FT:mat_peptide MH724956_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRQRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724958_HBc_P-D Product feature CHAIN MH724958_HBc_P-D of FT:mat_peptide MH724958_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724959_HBc_P-D Product feature CHAIN MH724959_HBc_P-D of FT:mat_peptide MH724959_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPLNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH724960_HBc_P-D Product feature CHAIN MH724960_HBc_P-D of FT:mat_peptide MH724960_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724961_HBc_P-D Product feature CHAIN MH724961_HBc_P-D of FT:mat_peptide MH724961_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724962_HBc_P-D Product feature CHAIN MH724962_HBc_P-D of FT:mat_peptide MH724962_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVQLLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGGNLEDQP
SRDLVVSYVNTNMGLKFRQLLWFHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|MH724963_HBc_P-D Product feature CHAIN MH724963_HBc_P-D of FT:mat_peptide MH724963_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724964_HBc_P-D Product feature CHAIN MH724964_HBc_P-D of FT:mat_peptide MH724964_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724965_HBc_P-D Product feature CHAIN MH724965_HBc_P-D of FT:mat_peptide MH724965_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-39). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH724966_HBc_P-D Product feature CHAIN MH724966_HBc_P-D of FT:mat_peptide MH724966_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH724967_HBc_P-D Product feature CHAIN MH724967_HBc_P-D of FT:mat_peptide MH724967_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPCRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724968_HBc_P-D Product feature CHAIN MH724968_HBc_P-D of FT:mat_peptide MH724968_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESREHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRFYSRESQC
>gnl|hbvpro|MH724969_HBc_P-D Product feature CHAIN MH724969_HBc_P-D of FT:mat_peptide MH724969_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724970_HBc_P-D Product feature CHAIN MH724970_HBc_P-D of FT:mat_peptide MH724970_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-57). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|MH724971_HBc_P-D Product feature CHAIN MH724971_HBc_P-D of FT:mat_peptide MH724971_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-62). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724972_HBc_P-D Product feature CHAIN MH724972_HBc_P-D of FT:mat_peptide MH724972_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-64). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724973_HBc_P-D Product feature CHAIN MH724973_HBc_P-D of FT:mat_peptide MH724973_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-65). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRGLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQTRESQC
>gnl|hbvpro|MH724974_HBc_P-D Product feature CHAIN MH724974_HBc_P-D of FT:mat_peptide MH724974_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-68). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724975_HBc_P-D Product feature CHAIN MH724975_HBc_P-D of FT:mat_peptide MH724975_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-102). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724976_HBc_P-D Product feature CHAIN MH724976_HBc_P-D of FT:mat_peptide MH724976_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-111). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLHTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724977_HBc_P-D Product feature CHAIN MH724977_HBc_P-D of FT:mat_peptide MH724977_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-119). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH724978_HBc_P-D Product feature CHAIN MH724978_HBc_P-D of FT:mat_peptide MH724978_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-124). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQQ
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|MH724979_HBc_P-D Product feature CHAIN MH724979_HBc_P-D of FT:mat_peptide MH724979_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-126). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724980_HBc_P-D Product feature CHAIN MH724980_HBc_P-D of FT:mat_peptide MH724980_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-128). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724981_HBc_P-D Product feature CHAIN MH724981_HBc_P-D of FT:mat_peptide MH724981_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-130). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724982_HBc_P-D Product feature CHAIN MH724982_HBc_P-D of FT:mat_peptide MH724982_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-134). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724983_HBc_P-D Product feature CHAIN MH724983_HBc_P-D of FT:mat_peptide MH724983_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724984_HBc_P-D Product feature CHAIN MH724984_HBc_P-D of FT:mat_peptide MH724984_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-138). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYREFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724985_HBc_P-D Product feature CHAIN MH724985_HBc_P-D of FT:mat_peptide MH724985_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-139). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724986_HBc_P-D Product feature CHAIN MH724986_HBc_P-D of FT:mat_peptide MH724986_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-140). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724987_HBc_P-D Product feature CHAIN MH724987_HBc_P-D of FT:mat_peptide MH724987_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-141). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724988_HBc_P-D Product feature CHAIN MH724988_HBc_P-D of FT:mat_peptide MH724988_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-142). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724989_HBc_P-D Product feature CHAIN MH724989_HBc_P-D of FT:mat_peptide MH724989_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-143). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPESQC
>gnl|hbvpro|MH724990_HBc_P-D Product feature CHAIN MH724990_HBc_P-D of FT:mat_peptide MH724990_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-145). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724991_HBc_P-D Product feature CHAIN MH724991_HBc_P-D of FT:mat_peptide MH724991_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-149). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724992_HBc_P-D Product feature CHAIN MH724992_HBc_P-D of FT:mat_peptide MH724992_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-153). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLSTWVGSNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724993_HBc_P-D Product feature CHAIN MH724993_HBc_P-D of FT:mat_peptide MH724993_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-158). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724994_HBc_P-D Product feature CHAIN MH724994_HBc_P-D of FT:mat_peptide MH724994_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-160). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724995_HBc_P-D Product feature CHAIN MH724995_HBc_P-D of FT:mat_peptide MH724995_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-178). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724996_HBc_P-D Product feature CHAIN MH724996_HBc_P-D of FT:mat_peptide MH724996_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-182). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH724997_HBc_P-D Product feature CHAIN MH724997_HBc_P-D of FT:mat_peptide MH724997_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-183). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724998_HBc_P-D Product feature CHAIN MH724998_HBc_P-D of FT:mat_peptide MH724998_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-186). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH724999_HBc_P-D Product feature CHAIN MH724999_HBc_P-D of FT:mat_peptide MH724999_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-187). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFVPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVARRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725001_HBc_P-D Product feature CHAIN MH725001_HBc_P-D of FT:mat_peptide MH725001_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-200). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFSPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725002_HBc_P-D Product feature CHAIN MH725002_HBc_P-D of FT:mat_peptide MH725002_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-215). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725003_HBc_P-D Product feature CHAIN MH725003_HBc_P-D of FT:mat_peptide MH725003_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-216). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725004_HBc_P-D Product feature CHAIN MH725004_HBc_P-D of FT:mat_peptide MH725004_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-220). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHIPCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725005_HBc_P-D Product feature CHAIN MH725005_HBc_P-D of FT:mat_peptide MH725005_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-224). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFSSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725006_HBc_P-D Product feature CHAIN MH725006_HBc_P-D of FT:mat_peptide MH725006_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-231). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSPSPRRRRSQSRESQC
>gnl|hbvpro|MH725007_HBc_P-D Product feature CHAIN MH725007_HBc_P-D of FT:mat_peptide MH725007_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-250). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725008_HBc_P-D Product feature CHAIN MH725008_HBc_P-D of FT:mat_peptide MH725008_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-254). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASTLYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725009_HBc_P-D Product feature CHAIN MH725009_HBc_P-D of FT:mat_peptide MH725009_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-257). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725011_HBc_P-D Product feature CHAIN MH725011_HBc_P-D of FT:mat_peptide MH725011_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-264). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725012_HBc_P-D Product feature CHAIN MH725012_HBc_P-D of FT:mat_peptide MH725012_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-267). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725013_HBc_P-D Product feature CHAIN MH725013_HBc_P-D of FT:mat_peptide MH725013_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-273). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSLGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725014_HBc_P-D Product feature CHAIN MH725014_HBc_P-D of FT:mat_peptide MH725014_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-274). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH725015_HBc_P-D Product feature CHAIN MH725015_HBc_P-D of FT:mat_peptide MH725015_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-276). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725016_HBc_P-D Product feature CHAIN MH725016_HBc_P-D of FT:mat_peptide MH725016_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-277). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725017_HBc_P-D Product feature CHAIN MH725017_HBc_P-D of FT:mat_peptide MH725017_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-288). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725018_HBc_P-D Product feature CHAIN MH725018_HBc_P-D of FT:mat_peptide MH725018_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-289). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725019_HBc_P-D Product feature CHAIN MH725019_HBc_P-D of FT:mat_peptide MH725019_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-297). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725022_HBc_P-D Product feature CHAIN MH725022_HBc_P-D of FT:mat_peptide MH725022_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sa-314). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725023_HBc_P-D Product feature CHAIN MH725023_HBc_P-D of FT:mat_peptide MH725023_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-320). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725025_HBc_P-D Product feature CHAIN MH725025_HBc_P-D of FT:mat_peptide MH725025_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-336). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725026_HBc_P-D Product feature CHAIN MH725026_HBc_P-D of FT:mat_peptide MH725026_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-346). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725027_HBc_P-D Product feature CHAIN MH725027_HBc_P-D of FT:mat_peptide MH725027_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-348). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725028_HBc_P-D Product feature CHAIN MH725028_HBc_P-D of FT:mat_peptide MH725028_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-351). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGKLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725029_HBc_P-D Product feature CHAIN MH725029_HBc_P-D of FT:mat_peptide MH725029_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-354). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725030_HBc_P-D Product feature CHAIN MH725030_HBc_P-D of FT:mat_peptide MH725030_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-357). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRTRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725031_HBc_P-D Product feature CHAIN MH725031_HBc_P-D of FT:mat_peptide MH725031_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-359). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|MH725032_HBc_P-D Product feature CHAIN MH725032_HBc_P-D of FT:mat_peptide MH725032_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-360). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725033_HBc_P-D Product feature CHAIN MH725033_HBc_P-D of FT:mat_peptide MH725033_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-365). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|MH725034_HBc_P-D Product feature CHAIN MH725034_HBc_P-D of FT:mat_peptide MH725034_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-368). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQS
>gnl|hbvpro|MH725035_HBc_P-D Product feature CHAIN MH725035_HBc_P-D of FT:mat_peptide MH725035_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-372). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725036_HBc_P-D Product feature CHAIN MH725036_HBc_P-D of FT:mat_peptide MH725036_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-373). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725037_HBc_P-D Product feature CHAIN MH725037_HBc_P-D of FT:mat_peptide MH725037_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-374). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725039_HBc_P-D Product feature CHAIN MH725039_HBc_P-D of FT:mat_peptide MH725039_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-378). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725040_HBc_P-D Product feature CHAIN MH725040_HBc_P-D of FT:mat_peptide MH725040_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-380). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725041_HBc_P-D Product feature CHAIN MH725041_HBc_P-D of FT:mat_peptide MH725041_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-386). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725044_HBc_P-D Product feature CHAIN MH725044_HBc_P-D of FT:mat_peptide MH725044_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-400). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725045_HBc_P-D Product feature CHAIN MH725045_HBc_P-D of FT:mat_peptide MH725045_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-433). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLQDPV
SRDLVVSYVNSHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725046_HBc_P-D Product feature CHAIN MH725046_HBc_P-D of FT:mat_peptide MH725046_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-436). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725047_HBc_P-D Product feature CHAIN MH725047_HBc_P-D of FT:mat_peptide MH725047_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-437). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725048_HBc_P-D Product feature CHAIN MH725048_HBc_P-D of FT:mat_peptide MH725048_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-462). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725049_HBc_P-D Product feature CHAIN MH725049_HBc_P-D of FT:mat_peptide MH725049_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-463). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725050_HBc_P-D Product feature CHAIN MH725050_HBc_P-D of FT:mat_peptide MH725050_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-465). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVSYVNSQVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725051_HBc_P-D Product feature CHAIN MH725051_HBc_P-D of FT:mat_peptide MH725051_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-467). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725052_HBc_P-D Product feature CHAIN MH725052_HBc_P-D of FT:mat_peptide MH725052_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-470). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725053_HBc_P-D Product feature CHAIN MH725053_HBc_P-D of FT:mat_peptide MH725053_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-474). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725054_HBc_P-D Product feature CHAIN MH725054_HBc_P-D of FT:mat_peptide MH725054_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-478). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPHDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNINMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|MH725055_HBc_P-D Product feature CHAIN MH725055_HBc_P-D of FT:mat_peptide MH725055_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-480). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725056_HBc_P-D Product feature CHAIN MH725056_HBc_P-D of FT:mat_peptide MH725056_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-481). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725057_HBc_P-D Product feature CHAIN MH725057_HBc_P-D of FT:mat_peptide MH725057_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-482). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725058_HBc_P-D Product feature CHAIN MH725058_HBc_P-D of FT:mat_peptide MH725058_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-485). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725059_HBc_P-D Product feature CHAIN MH725059_HBc_P-D of FT:mat_peptide MH725059_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-512). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725060_HBc_P-D Product feature CHAIN MH725060_HBc_P-D of FT:mat_peptide MH725060_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-516). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725061_HBc_P-D Product feature CHAIN MH725061_HBc_P-D of FT:mat_peptide MH725061_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-517). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725062_HBc_P-D Product feature CHAIN MH725062_HBc_P-D of FT:mat_peptide MH725062_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-518). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725063_HBc_P-D Product feature CHAIN MH725063_HBc_P-D of FT:mat_peptide MH725063_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-524). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725064_HBc_P-D Product feature CHAIN MH725064_HBc_P-D of FT:mat_peptide MH725064_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-527). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725065_HBc_P-D Product feature CHAIN MH725065_HBc_P-D of FT:mat_peptide MH725065_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-530). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725066_HBc_P-D Product feature CHAIN MH725066_HBc_P-D of FT:mat_peptide MH725066_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-535). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSLRNLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725067_HBc_P-D Product feature CHAIN MH725067_HBc_P-D of FT:mat_peptide MH725067_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-538). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSLRNLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725068_HBc_P-D Product feature CHAIN MH725068_HBc_P-D of FT:mat_peptide MH725068_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-541). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATAELLLFLPYDFFPSVRDFIDTASALYREASESPEHCSPHHTAIRQAIFSLGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725069_HBc_P-D Product feature CHAIN MH725069_HBc_P-D of FT:mat_peptide MH725069_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-544). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725070_HBc_P-D Product feature CHAIN MH725070_HBc_P-D of FT:mat_peptide MH725070_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-548). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSLGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725071_HBc_P-D Product feature CHAIN MH725071_HBc_P-D of FT:mat_peptide MH725071_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-549). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNANMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725072_HBc_P-D Product feature CHAIN MH725072_HBc_P-D of FT:mat_peptide MH725072_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-550). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725073_HBc_P-D Product feature CHAIN MH725073_HBc_P-D of FT:mat_peptide MH725073_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-552). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725074_HBc_P-D Product feature CHAIN MH725074_HBc_P-D of FT:mat_peptide MH725074_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-554). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725075_HBc_P-D Product feature CHAIN MH725075_HBc_P-D of FT:mat_peptide MH725075_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-559). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725076_HBc_P-D Product feature CHAIN MH725076_HBc_P-D of FT:mat_peptide MH725076_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-560). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGKLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725077_HBc_P-D Product feature CHAIN MH725077_HBc_P-D of FT:mat_peptide MH725077_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-561). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725078_HBc_P-D Product feature CHAIN MH725078_HBc_P-D of FT:mat_peptide MH725078_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-568). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725079_HBc_P-D Product feature CHAIN MH725079_HBc_P-D of FT:mat_peptide MH725079_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-571). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRCRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725080_HBc_P-D Product feature CHAIN MH725080_HBc_P-D of FT:mat_peptide MH725080_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-572). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725081_HBc_P-D Product feature CHAIN MH725081_HBc_P-D of FT:mat_peptide MH725081_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-573). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725082_HBc_P-D Product feature CHAIN MH725082_HBc_P-D of FT:mat_peptide MH725082_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-574). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725083_HBc_P-D Product feature CHAIN MH725083_HBc_P-D of FT:mat_peptide MH725083_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-597). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725084_HBc_P-D Product feature CHAIN MH725084_HBc_P-D of FT:mat_peptide MH725084_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-606). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725085_HBc_P-D Product feature CHAIN MH725085_HBc_P-D of FT:mat_peptide MH725085_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-622). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725086_HBc_P-D Product feature CHAIN MH725086_HBc_P-D of FT:mat_peptide MH725086_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-624). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725087_HBc_P-D Product feature CHAIN MH725087_HBc_P-D of FT:mat_peptide MH725087_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-646). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725088_HBc_P-D Product feature CHAIN MH725088_HBc_P-D of FT:mat_peptide MH725088_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-652). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH725089_HBc_P-D Product feature CHAIN MH725089_HBc_P-D of FT:mat_peptide MH725089_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-653). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725090_HBc_P-D Product feature CHAIN MH725090_HBc_P-D of FT:mat_peptide MH725090_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-683). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWLHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPTLSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725091_HBc_P-D Product feature CHAIN MH725091_HBc_P-D of FT:mat_peptide MH725091_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-685). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPFDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725092_HBc_P-D Product feature CHAIN MH725092_HBc_P-D of FT:mat_peptide MH725092_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-686). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPFDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725093_HBc_P-D Product feature CHAIN MH725093_HBc_P-D of FT:mat_peptide MH725093_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-699). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725094_HBc_P-D Product feature CHAIN MH725094_HBc_P-D of FT:mat_peptide MH725094_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-700). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|MH725095_HBc_P-D Product feature CHAIN MH725095_HBc_P-D of FT:mat_peptide MH725095_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-707). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLHFDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLTTWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725096_HBc_P-D Product feature CHAIN MH725096_HBc_P-D of FT:mat_peptide MH725096_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-708). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|MH725097_HBc_P-D Product feature CHAIN MH725097_HBc_P-D of FT:mat_peptide MH725097_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-710). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725098_HBc_P-D Product feature CHAIN MH725098_HBc_P-D of FT:mat_peptide MH725098_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-712). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725099_HBc_P-D Product feature CHAIN MH725099_HBc_P-D of FT:mat_peptide MH725099_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-714). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725100_HBc_P-D Product feature CHAIN MH725100_HBc_P-D of FT:mat_peptide MH725100_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725101_HBc_P-D Product feature CHAIN MH725101_HBc_P-D of FT:mat_peptide MH725101_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-720). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMILATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYKPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725102_HBc_P-D Product feature CHAIN MH725102_HBc_P-D of FT:mat_peptide MH725102_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-722). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNINMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725103_HBc_P-D Product feature CHAIN MH725103_HBc_P-D of FT:mat_peptide MH725103_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-725). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725104_HBc_P-D Product feature CHAIN MH725104_HBc_P-D of FT:mat_peptide MH725104_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-769). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725105_HBc_P-D Product feature CHAIN MH725105_HBc_P-D of FT:mat_peptide MH725105_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-774). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725106_HBc_P-D Product feature CHAIN MH725106_HBc_P-D of FT:mat_peptide MH725106_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-789). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725107_HBc_P-D Product feature CHAIN MH725107_HBc_P-D of FT:mat_peptide MH725107_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-804). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725108_HBc_P-D Product feature CHAIN MH725108_HBc_P-D of FT:mat_peptide MH725108_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-808). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISRLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725109_HBc_P-D Product feature CHAIN MH725109_HBc_P-D of FT:mat_peptide MH725109_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-809). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVSYVNSQVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725110_HBc_P-D Product feature CHAIN MH725110_HBc_P-D of FT:mat_peptide MH725110_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-830). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|MH725111_HBc_P-D Product feature CHAIN MH725111_HBc_P-D of FT:mat_peptide MH725111_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-845). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725112_HBc_P-D Product feature CHAIN MH725112_HBc_P-D of FT:mat_peptide MH725112_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-848). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725113_HBc_P-D Product feature CHAIN MH725113_HBc_P-D of FT:mat_peptide MH725113_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-867). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725115_HBc_P-D Product feature CHAIN MH725115_HBc_P-D of FT:mat_peptide MH725115_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-869). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725116_HBc_P-D Product feature CHAIN MH725116_HBc_P-D of FT:mat_peptide MH725116_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-942). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725117_HBc_P-D Product feature CHAIN MH725117_HBc_P-D of FT:mat_peptide MH725117_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-947). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725118_HBc_P-D Product feature CHAIN MH725118_HBc_P-D of FT:mat_peptide MH725118_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-873). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|MH725119_HBc_P-D Product feature CHAIN MH725119_HBc_P-D of FT:mat_peptide MH725119_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-956). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725120_HBc_P-D Product feature CHAIN MH725120_HBc_P-D of FT:mat_peptide MH725120_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-960). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725121_HBc_P-D Product feature CHAIN MH725121_HBc_P-D of FT:mat_peptide MH725121_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-961). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725122_HBc_P-D Product feature CHAIN MH725122_HBc_P-D of FT:mat_peptide MH725122_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-877). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725123_HBc_P-D Product feature CHAIN MH725123_HBc_P-D of FT:mat_peptide MH725123_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-982). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
KGIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725124_HBc_P-D Product feature CHAIN MH725124_HBc_P-D of FT:mat_peptide MH725124_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-977). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRKTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725125_HBc_P-D Product feature CHAIN MH725125_HBc_P-D of FT:mat_peptide MH725125_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-978). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTAIRQASFCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|MH725126_HBc_P-D Product feature CHAIN MH725126_HBc_P-D of FT:mat_peptide MH725126_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|MH725127_HBc_P-D Product feature CHAIN MH725127_HBc_P-D of FT:mat_peptide MH725127_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-980). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725128_HBc_P-D Product feature CHAIN MH725128_HBc_P-D of FT:mat_peptide MH725128_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-984). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725129_HBc_P-D Product feature CHAIN MH725129_HBc_P-D of FT:mat_peptide MH725129_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1000). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725130_HBc_P-D Product feature CHAIN MH725130_HBc_P-D of FT:mat_peptide MH725130_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1001). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725131_HBc_P-D Product feature CHAIN MH725131_HBc_P-D of FT:mat_peptide MH725131_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725132_HBc_P-D Product feature CHAIN MH725132_HBc_P-D of FT:mat_peptide MH725132_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1051). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725133_HBc_P-D Product feature CHAIN MH725133_HBc_P-D of FT:mat_peptide MH725133_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1054). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725134_HBc_P-D Product feature CHAIN MH725134_HBc_P-D of FT:mat_peptide MH725134_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1057). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQW
>gnl|hbvpro|MH725135_HBc_P-D Product feature CHAIN MH725135_HBc_P-D of FT:mat_peptide MH725135_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1084). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPLPYRPANAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH725136_HBc_P-D Product feature CHAIN MH725136_HBc_P-D of FT:mat_peptide MH725136_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYWEALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725137_HBc_P-D Product feature CHAIN MH725137_HBc_P-D of FT:mat_peptide MH725137_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1112). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725138_HBc_P-D Product feature CHAIN MH725138_HBc_P-D of FT:mat_peptide MH725138_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725139_HBc_P-D Product feature CHAIN MH725139_HBc_P-D of FT:mat_peptide MH725139_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1201). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWYHVSCLTFGRETVGEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725140_HBc_P-D Product feature CHAIN MH725140_HBc_P-D of FT:mat_peptide MH725140_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1210). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725142_HBc_P-D Product feature CHAIN MH725142_HBc_P-D of FT:mat_peptide MH725142_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1230). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYWEALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725143_HBc_P-D Product feature CHAIN MH725143_HBc_P-D of FT:mat_peptide MH725143_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1238). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725144_HBc_P-D Product feature CHAIN MH725144_HBc_P-D of FT:mat_peptide MH725144_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1266). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLNDPT
SRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725145_HBc_P-D Product feature CHAIN MH725145_HBc_P-D of FT:mat_peptide MH725145_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1281). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725146_HBc_P-D Product feature CHAIN MH725146_HBc_P-D of FT:mat_peptide MH725146_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1330). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725147_HBc_P-D Product feature CHAIN MH725147_HBc_P-D of FT:mat_peptide MH725147_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1354). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725148_HBc_P-D Product feature CHAIN MH725148_HBc_P-D of FT:mat_peptide MH725148_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1356). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
VDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725149_HBc_P-D Product feature CHAIN MH725149_HBc_P-D of FT:mat_peptide MH725149_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1362). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725150_HBc_P-D Product feature CHAIN MH725150_HBc_P-D of FT:mat_peptide MH725150_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1367). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725151_HBc_P-D Product feature CHAIN MH725151_HBc_P-D of FT:mat_peptide MH725151_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1375). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725152_HBc_P-D Product feature CHAIN MH725152_HBc_P-D of FT:mat_peptide MH725152_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1396). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725153_HBc_P-D Product feature CHAIN MH725153_HBc_P-D of FT:mat_peptide MH725153_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1590). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPEDFFPSVRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMSLATWVGGNLEDPI
SRDLVVGYVNTHKGLKFRQLLWFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725154_HBc_P-D Product feature CHAIN MH725154_HBc_P-D of FT:mat_peptide MH725154_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1616). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725155_HBc_P-D Product feature CHAIN MH725155_HBc_P-D of FT:mat_peptide MH725155_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1626). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725156_HBc_P-D Product feature CHAIN MH725156_HBc_P-D of FT:mat_peptide MH725156_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1637). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725157_HBc_P-D Product feature CHAIN MH725157_HBc_P-D of FT:mat_peptide MH725157_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1659). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725158_HBc_P-D Product feature CHAIN MH725158_HBc_P-D of FT:mat_peptide MH725158_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1677). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725159_HBc_P-D Product feature CHAIN MH725159_HBc_P-D of FT:mat_peptide MH725159_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1714). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725160_HBc_P-D Product feature CHAIN MH725160_HBc_P-D of FT:mat_peptide MH725160_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1735). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQPRESQC
>gnl|hbvpro|MH725161_HBc_P-D Product feature CHAIN MH725161_HBc_P-D of FT:mat_peptide MH725161_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1737). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|MH725162_HBc_P-D Product feature CHAIN MH725162_HBc_P-D of FT:mat_peptide MH725162_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1744). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725163_HBc_P-D Product feature CHAIN MH725163_HBc_P-D of FT:mat_peptide MH725163_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1751). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725164_HBc_P-D Product feature CHAIN MH725164_HBc_P-D of FT:mat_peptide MH725164_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1761). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGMWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725165_HBc_P-D Product feature CHAIN MH725165_HBc_P-D of FT:mat_peptide MH725165_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1778). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725166_HBc_P-D Product feature CHAIN MH725166_HBc_P-D of FT:mat_peptide MH725166_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1806). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725167_HBc_P-D Product feature CHAIN MH725167_HBc_P-D of FT:mat_peptide MH725167_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1808). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|MH725168_HBc_P-D Product feature CHAIN MH725168_HBc_P-D of FT:mat_peptide MH725168_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1050). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIPCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725169_HBc_P-D Product feature CHAIN MH725169_HBc_P-D of FT:mat_peptide MH725169_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1052). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPYHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725170_HBc_P-D Product feature CHAIN MH725170_HBc_P-D of FT:mat_peptide MH725170_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1053). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725171_HBc_P-D Product feature CHAIN MH725171_HBc_P-D of FT:mat_peptide MH725171_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1066). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPQAYRPTNAPILSMLPETAVVRSRCRPTRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725172_HBc_P-D Product feature CHAIN MH725172_HBc_P-D of FT:mat_peptide MH725172_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1075). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDLDPYKEFGGIVELLFFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLCFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|MH725173_HBc_P-D Product feature CHAIN MH725173_HBc_P-D of FT:mat_peptide MH725173_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1077). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKPRESQC
>gnl|hbvpro|MH725174_HBc_P-D Product feature CHAIN MH725174_HBc_P-D of FT:mat_peptide MH725174_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1080). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASPLYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725175_HBc_P-D Product feature CHAIN MH725175_HBc_P-D of FT:mat_peptide MH725175_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1082). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725176_HBc_P-D Product feature CHAIN MH725176_HBc_P-D of FT:mat_peptide MH725176_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1104). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725177_HBc_P-D Product feature CHAIN MH725177_HBc_P-D of FT:mat_peptide MH725177_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1177). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725178_HBc_P-D Product feature CHAIN MH725178_HBc_P-D of FT:mat_peptide MH725178_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1206). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725179_HBc_P-D Product feature CHAIN MH725179_HBc_P-D of FT:mat_peptide MH725179_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1242). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725180_HBc_P-D Product feature CHAIN MH725180_HBc_P-D of FT:mat_peptide MH725180_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1264). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725181_HBc_P-D Product feature CHAIN MH725181_HBc_P-D of FT:mat_peptide MH725181_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1265). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725182_HBc_P-D Product feature CHAIN MH725182_HBc_P-D of FT:mat_peptide MH725182_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1315). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725183_HBc_P-D Product feature CHAIN MH725183_HBc_P-D of FT:mat_peptide MH725183_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1316). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725184_HBc_P-D Product feature CHAIN MH725184_HBc_P-D of FT:mat_peptide MH725184_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1327). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725185_HBc_P-D Product feature CHAIN MH725185_HBc_P-D of FT:mat_peptide MH725185_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1328). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725186_HBc_P-D Product feature CHAIN MH725186_HBc_P-D of FT:mat_peptide MH725186_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1331). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWGGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725187_HBc_P-D Product feature CHAIN MH725187_HBc_P-D of FT:mat_peptide MH725187_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1334). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725188_HBc_P-D Product feature CHAIN MH725188_HBc_P-D of FT:mat_peptide MH725188_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1349). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725189_HBc_P-D Product feature CHAIN MH725189_HBc_P-D of FT:mat_peptide MH725189_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1389). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNDNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|MH725190_HBc_P-D Product feature CHAIN MH725190_HBc_P-D of FT:mat_peptide MH725190_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1394). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725191_HBc_P-D Product feature CHAIN MH725191_HBc_P-D of FT:mat_peptide MH725191_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1430). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725193_HBc_P-D Product feature CHAIN MH725193_HBc_P-D of FT:mat_peptide MH725193_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1456). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725194_HBc_P-D Product feature CHAIN MH725194_HBc_P-D of FT:mat_peptide MH725194_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1457). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725195_HBc_P-D Product feature CHAIN MH725195_HBc_P-D of FT:mat_peptide MH725195_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1458). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725196_HBc_P-D Product feature CHAIN MH725196_HBc_P-D of FT:mat_peptide MH725196_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1483). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|MH725197_HBc_P-D Product feature CHAIN MH725197_HBc_P-D of FT:mat_peptide MH725197_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1484). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|MH725198_HBc_P-D Product feature CHAIN MH725198_HBc_P-D of FT:mat_peptide MH725198_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1489). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725199_HBc_P-D Product feature CHAIN MH725199_HBc_P-D of FT:mat_peptide MH725199_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1491). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MELDPYKEFGATVQLLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRHVILCWGDLMNLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH725201_HBc_P-D Product feature CHAIN MH725201_HBc_P-D of FT:mat_peptide MH725201_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1417). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725202_HBc_P-D Product feature CHAIN MH725202_HBc_P-D of FT:mat_peptide MH725202_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1552). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHLSCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|MH725203_HBc_P-D Product feature CHAIN MH725203_HBc_P-D of FT:mat_peptide MH725203_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1553). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725204_HBc_P-D Product feature CHAIN MH725204_HBc_P-D of FT:mat_peptide MH725204_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1569). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725205_HBc_P-D Product feature CHAIN MH725205_HBc_P-D of FT:mat_peptide MH725205_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1620). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725206_HBc_P-D Product feature CHAIN MH725206_HBc_P-D of FT:mat_peptide MH725206_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1624). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725207_HBc_P-D Product feature CHAIN MH725207_HBc_P-D of FT:mat_peptide MH725207_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1638). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725208_HBc_P-D Product feature CHAIN MH725208_HBc_P-D of FT:mat_peptide MH725208_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1644). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPHRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725209_HBc_P-D Product feature CHAIN MH725209_HBc_P-D of FT:mat_peptide MH725209_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1646). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725210_HBc_P-D Product feature CHAIN MH725210_HBc_P-D of FT:mat_peptide MH725210_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1660). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725211_HBc_P-D Product feature CHAIN MH725211_HBc_P-D of FT:mat_peptide MH725211_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1096). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|MH932714_HBc_P-D Product feature CHAIN MH932714_HBc_P-D of FT:mat_peptide MH932714_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Hiroshima GtD CL2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK052947_HBc_P-D Product feature CHAIN MK052947_HBc_P-D of FT:mat_peptide MK052947_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADSFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMSLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLCFGRDTVVAYLVSFGVWIRTPPAYRPPNAPILSTLPEVTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052948_HBc_P-D Product feature CHAIN MK052948_HBc_P-D of FT:mat_peptide MK052948_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNNNMGLKFRQLLWFHFSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEVAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052949_HBc_P-D Product feature CHAIN MK052949_HBc_P-D of FT:mat_peptide MK052949_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNNNMGLKFRQLLWFHFSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRFQSREPQC
>gnl|hbvpro|MK052950_HBc_P-D Product feature CHAIN MK052950_HBc_P-D of FT:mat_peptide MK052950_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHFSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQPPRRRRSQSREPQC
>gnl|hbvpro|MK052951_HBc_P-D Product feature CHAIN MK052951_HBc_P-D of FT:mat_peptide MK052951_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHYSCLTFGRETVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052953_HBc_P-D Product feature CHAIN MK052953_HBc_P-D of FT:mat_peptide MK052953_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHFSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052954_HBc_P-D Product feature CHAIN MK052954_HBc_P-D of FT:mat_peptide MK052954_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKGFGAPVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNNNMGLKFRQLLWFHFSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEVAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052955_HBc_P-D Product feature CHAIN MK052955_HBc_P-D of FT:mat_peptide MK052955_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHFSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGGSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052956_HBc_P-D Product feature CHAIN MK052956_HBc_P-D of FT:mat_peptide MK052956_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHFSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052958_HBc_P-D Product feature CHAIN MK052958_HBc_P-D of FT:mat_peptide MK052958_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHFSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPDAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052959_HBc_P-D Product feature CHAIN MK052959_HBc_P-D of FT:mat_peptide MK052959_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESSEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHFSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEVAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052960_HBc_P-D Product feature CHAIN MK052960_HBc_P-D of FT:mat_peptide MK052960_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-14). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHYSCLTFGRETVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052961_HBc_P-D Product feature CHAIN MK052961_HBc_P-D of FT:mat_peptide MK052961_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-15). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNNNMGLKFRQLLWFHFSCLTFGRDMVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052963_HBc_P-D Product feature CHAIN MK052963_HBc_P-D of FT:mat_peptide MK052963_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHYSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052966_HBc_P-D Product feature CHAIN MK052966_HBc_P-D of FT:mat_peptide MK052966_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHYSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052971_HBc_P-D Product feature CHAIN MK052971_HBc_P-D of FT:mat_peptide MK052971_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHYSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052972_HBc_P-D Product feature CHAIN MK052972_HBc_P-D of FT:mat_peptide MK052972_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFFPTVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMSLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLCFGRDTVVAYLVSFGVWIRTPPAYRPPNAPILSTLPEVTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052973_HBc_P-D Product feature CHAIN MK052973_HBc_P-D of FT:mat_peptide MK052973_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-14). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGTNLEDPA
SRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEVTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052974_HBc_P-D Product feature CHAIN MK052974_HBc_P-D of FT:mat_peptide MK052974_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=182 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGANLDPVS
RDLVVSYVNTNMGLKFRQLLWFHFSCLTFERDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRGRGRSPRRRTP
SPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK052975_HBc_P-D Product feature CHAIN MK052975_HBc_P-D of FT:mat_peptide MK052975_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGTNLEDPA
SRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEVTVVRGRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|V01460_HBc_P-D Product feature CHAIN V01460_HBc_P-D of FT:mat_peptide V01460_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X02496_HBc_P-D Product feature CHAIN X02496_HBc_P-D of FT:mat_peptide X02496_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDNASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X59795_HBc_P-D Product feature CHAIN X59795_HBc_P-D of FT:mat_peptide X59795_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Patient MG; HBV/S). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASMELLSFLPSDFYPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X65257_HBc_P-D Product feature CHAIN X65257_HBc_P-D of FT:mat_peptide X65257_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient C; HBsAg positiv;HBV subtype ayw). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLIFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X65258_HBc_P-D Product feature CHAIN X65258_HBc_P-D of FT:mat_peptide X65258_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient CI; HBV subtype ayw). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVAFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X72702_HBc_P-D Product feature CHAIN X72702_HBc_P-D of FT:mat_peptide X72702_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient C1005). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X80924_HBc_P-D Product feature CHAIN X80924_HBc_P-D of FT:mat_peptide X80924_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETCVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X80926_HBc_P-D Product feature CHAIN X80926_HBc_P-D of FT:mat_peptide X80926_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVIRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X80927_HBc_P-D Product feature CHAIN X80927_HBc_P-D of FT:mat_peptide X80927_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 2). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPHDFFPSLRDLLDTASALYRDALESPEHXSPHHTALRQAILCWGDLMNLATWVGVNLQDPA
SRELVVNYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X80928_HBc_P-D Product feature CHAIN X80928_HBc_P-D of FT:mat_peptide X80928_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 1). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPHDFFPSLRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLQDPA
SRELVVNYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85254_HBc_P-D Product feature CHAIN X85254_HBc_P-D of FT:mat_peptide X85254_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRCRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85255_HBc_P-D Product feature CHAIN X85255_HBc_P-D of FT:mat_peptide X85255_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Tarcisioc'92). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSSALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85259_HBc_P-D Product feature CHAIN X85259_HBc_P-D of FT:mat_peptide X85259_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Graziellac'92). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPQHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85260_HBc_P-D Product feature CHAIN X85260_HBc_P-D of FT:mat_peptide X85260_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Lucianoc'92). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85261_HBc_P-D Product feature CHAIN X85261_HBc_P-D of FT:mat_peptide X85261_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Salvatorec'92). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIPTPPAYRPTNAPILSTLPETCVVRQRGRSLRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|X85263_HBc_P-D Product feature CHAIN X85263_HBc_P-D of FT:mat_peptide X85263_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Amoroso'89). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAKALLRDALESPEHCSPHHTALRQEILCWGELMTLATWVGVNLQDQA
SRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85264_HBc_P-D Product feature CHAIN X85264_HBc_P-D of FT:mat_peptide X85264_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Buesca'92). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCTPHHTALRQAILCWAELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|X85268_HBc_P-D Product feature CHAIN X85268_HBc_P-D of FT:mat_peptide X85268_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Sini'90). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDISPYKEFGASVELLSFLPVDFFPSVRDLHDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDST
SRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRELVVEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85269_HBc_P-D Product feature CHAIN X85269_HBc_P-D of FT:mat_peptide X85269_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Tufariello'89). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|X85270_HBc_P-D Product feature CHAIN X85270_HBc_P-D of FT:mat_peptide X85270_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Usai'89). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCTPHHTALRQAILCWGELMSLATWVGVNLEDQA
SRDLVVRYVNDHMGIKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|X85273_HBc_P-D Product feature CHAIN X85273_HBc_P-D of FT:mat_peptide X85273_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Carboni'90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRCRRSQSRESQC
>gnl|hbvpro|X85276_HBc_P-D Product feature CHAIN X85276_HBc_P-D of FT:mat_peptide X85276_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Urtis'89). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFLSVRHLLDTAKALFQDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|X85277_HBc_P-D Product feature CHAIN X85277_HBc_P-D of FT:mat_peptide X85277_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Boi'90). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVVVNLEDQT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTHRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85278_HBc_P-D Product feature CHAIN X85278_HBc_P-D of FT:mat_peptide X85278_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Addis'89). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALSPEHCSPHHTALRQAIICWAELMTLATWVGGNLEDPTS
RDLVVGYVNSNMGLKFRQLLWFHISCTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRTPS
PRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|X85279_HBc_P-D Product feature CHAIN X85279_HBc_P-D of FT:mat_peptide X85279_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Bitti'89). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAKALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDVVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85280_HBc_P-D Product feature CHAIN X85280_HBc_P-D of FT:mat_peptide X85280_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Porcu'91). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVNYVNTTAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|X85294_HBc_P-D Product feature CHAIN X85294_HBc_P-D of FT:mat_peptide X85294_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Chighine'82). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85295_HBc_P-D Product feature CHAIN X85295_HBc_P-D of FT:mat_peptide X85295_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Chighine-1'85). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85297_HBc_P-D Product feature CHAIN X85297_HBc_P-D of FT:mat_peptide X85297_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Dettori'85). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85298_HBc_P-D Product feature CHAIN X85298_HBc_P-D of FT:mat_peptide X85298_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Dettori-1'86). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHAILCWGDLRTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85299_HBc_P-D Product feature CHAIN X85299_HBc_P-D of FT:mat_peptide X85299_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Dettori-2'87). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHVFLCWGDLMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85301_HBc_P-D Product feature CHAIN X85301_HBc_P-D of FT:mat_peptide X85301_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Sanna-2'90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPV
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85302_HBc_P-D Product feature CHAIN X85302_HBc_P-D of FT:mat_peptide X85302_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Ferreli'84). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREAFECSEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85303_HBc_P-D Product feature CHAIN X85303_HBc_P-D of FT:mat_peptide X85303_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Ferreli-1'85). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85304_HBc_P-D Product feature CHAIN X85304_HBc_P-D of FT:mat_peptide X85304_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Ferreli-2'86). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPV
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85308_HBc_P-D Product feature CHAIN X85308_HBc_P-D of FT:mat_peptide X85308_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Mannoni'85). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X85318_HBc_P-D Product feature CHAIN X85318_HBc_P-D of FT:mat_peptide X85318_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Galistru-2'87). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPRHCSPHHTALRQAILCWGELMTSASWVGVNLEDPA
SRDLVVSYVNTNMGLKPRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X97848_HBc_P-D Product feature CHAIN X97848_HBc_P-D of FT:mat_peptide X97848_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLQDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSLESQC
>gnl|hbvpro|X97849_HBc_P-D Product feature CHAIN X97849_HBc_P-D of FT:mat_peptide X97849_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPHDFFPSLRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLQDPA
SRELVVNYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|Y07587_HBc_P-D Product feature CHAIN Y07587_HBc_P-D of FT:mat_peptide Y07587_HBc_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|Z35716_HBc_P-D Product feature CHAIN Z35716_HBc_P-D of FT:mat_peptide Z35716_HBc_P-D of [Viruses] Hepatitis B Virus genotype D (isolate hb321). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
© 1998-2019