HBVdb

Dataset for protein HBx of genotype D

[Download (right click)] [Alignment] [Repertoires]

1538 sequence(s)

>gnl|hbvpro|AB048701_HBx_P-D Product feature CHAIN AB048701_HBx_P-D of FT:mat_peptide AB048701_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB078031_HBx_P-D Product feature CHAIN AB078031_HBx_P-D of FT:mat_peptide AB078031_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FH1-YS). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB078032_HBx_P-D Product feature CHAIN AB078032_HBx_P-D of FT:mat_peptide AB078032_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AH1-SY). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB078033_HBx_P-D Product feature CHAIN AB078033_HBx_P-D of FT:mat_peptide AB078033_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IS1-OY). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB090268_HBx_P-D Product feature CHAIN AB090268_HBx_P-D of FT:mat_peptide AB090268_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB090269_HBx_P-D Product feature CHAIN AB090269_HBx_P-D of FT:mat_peptide AB090269_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGNLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEVYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB090270_HBx_P-D Product feature CHAIN AB090270_HBx_P-D of FT:mat_peptide AB090270_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB104709_HBx_P-D Product feature CHAIN AB104709_HBx_P-D of FT:mat_peptide AB104709_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB104710_HBx_P-D Product feature CHAIN AB104710_HBx_P-D of FT:mat_peptide AB104710_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB104711_HBx_P-D Product feature CHAIN AB104711_HBx_P-D of FT:mat_peptide AB104711_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB104712_HBx_P-D Product feature CHAIN AB104712_HBx_P-D of FT:mat_peptide AB104712_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHPVLHKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB109475_HBx_P-D Product feature CHAIN AB109475_HBx_P-D of FT:mat_peptide AB109475_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB109476_HBx_P-D Product feature CHAIN AB109476_HBx_P-D of FT:mat_peptide AB109476_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB109477_HBx_P-D Product feature CHAIN AB109477_HBx_P-D of FT:mat_peptide AB109477_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB109478_HBx_P-D Product feature CHAIN AB109478_HBx_P-D of FT:mat_peptide AB109478_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPTPCTFFTSA
>gnl|hbvpro|AB109479_HBx_P-D Product feature CHAIN AB109479_HBx_P-D of FT:mat_peptide AB109479_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB110075_HBx_P-D Product feature CHAIN AB110075_HBx_P-D of FT:mat_peptide AB110075_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB116266_HBx_P-D Product feature CHAIN AB116266_HBx_P-D of FT:mat_peptide AB116266_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB119251_HBx_P-D Product feature CHAIN AB119251_HBx_P-D of FT:mat_peptide AB119251_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB119252_HBx_P-D Product feature CHAIN AB119252_HBx_P-D of FT:mat_peptide AB119252_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|AB119253_HBx_P-D Product feature CHAIN AB119253_HBx_P-D of FT:mat_peptide AB119253_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHSLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB119254_HBx_P-D Product feature CHAIN AB119254_HBx_P-D of FT:mat_peptide AB119254_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB119255_HBx_P-D Product feature CHAIN AB119255_HBx_P-D of FT:mat_peptide AB119255_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB119256_HBx_P-D Product feature CHAIN AB119256_HBx_P-D of FT:mat_peptide AB119256_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTPSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB120308_HBx_P-D Product feature CHAIN AB120308_HBx_P-D of FT:mat_peptide AB120308_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB126581_HBx_P-D Product feature CHAIN AB126581_HBx_P-D of FT:mat_peptide AB126581_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU301). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFGLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB188241_HBx_P-D Product feature CHAIN AB188241_HBx_P-D of FT:mat_peptide AB188241_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB188242_HBx_P-D Product feature CHAIN AB188242_HBx_P-D of FT:mat_peptide AB188242_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB188244_HBx_P-D Product feature CHAIN AB188244_HBx_P-D of FT:mat_peptide AB188244_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZ24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPFGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB205126_HBx_P-D Product feature CHAIN AB205126_HBx_P-D of FT:mat_peptide AB205126_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-IF714-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB205127_HBx_P-D Product feature CHAIN AB205127_HBx_P-D of FT:mat_peptide AB205127_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU313-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB205128_HBx_P-D Product feature CHAIN AB205128_HBx_P-D of FT:mat_peptide AB205128_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU316-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB210820_HBx_P-D Product feature CHAIN AB210820_HBx_P-D of FT:mat_peptide AB210820_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|AB210821_HBx_P-D Product feature CHAIN AB210821_HBx_P-D of FT:mat_peptide AB210821_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB210822_HBx_P-D Product feature CHAIN AB210822_HBx_P-D of FT:mat_peptide AB210822_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB222709_HBx_P-D Product feature CHAIN AB222709_HBx_P-D of FT:mat_peptide AB222709_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB222710_HBx_P-D Product feature CHAIN AB222710_HBx_P-D of FT:mat_peptide AB222710_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6M). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB222711_HBx_P-D Product feature CHAIN AB222711_HBx_P-D of FT:mat_peptide AB222711_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNV24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB222712_HBx_P-D Product feature CHAIN AB222712_HBx_P-D of FT:mat_peptide AB222712_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB222713_HBx_P-D Product feature CHAIN AB222713_HBx_P-D of FT:mat_peptide AB222713_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB246347_HBx_P-D Product feature CHAIN AB246347_HBx_P-D of FT:mat_peptide AB246347_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAFFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB246348_HBx_P-D Product feature CHAIN AB246348_HBx_P-D of FT:mat_peptide AB246348_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB267090_HBx_P-D Product feature CHAIN AB267090_HBx_P-D of FT:mat_peptide AB267090_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ehime 22-HS). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270537_HBx_P-D Product feature CHAIN AB270537_HBx_P-D of FT:mat_peptide AB270537_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL22F). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPAWDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270539_HBx_P-D Product feature CHAIN AB270539_HBx_P-D of FT:mat_peptide AB270539_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL200F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270540_HBx_P-D Product feature CHAIN AB270540_HBx_P-D of FT:mat_peptide AB270540_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL241F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270541_HBx_P-D Product feature CHAIN AB270541_HBx_P-D of FT:mat_peptide AB270541_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL47F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270542_HBx_P-D Product feature CHAIN AB270542_HBx_P-D of FT:mat_peptide AB270542_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL12F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRLE
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEESRLQLFVLGGCRHKLVCAPAPGNFFTSA
>gnl|hbvpro|AB270543_HBx_P-D Product feature CHAIN AB270543_HBx_P-D of FT:mat_peptide AB270543_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL209F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLXVFLLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270546_HBx_P-D Product feature CHAIN AB270546_HBx_P-D of FT:mat_peptide AB270546_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL88F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270547_HBx_P-D Product feature CHAIN AB270547_HBx_P-D of FT:mat_peptide AB270547_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL295F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270548_HBx_P-D Product feature CHAIN AB270548_HBx_P-D of FT:mat_peptide AB270548_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL207F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFXLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270549_HBx_P-D Product feature CHAIN AB270549_HBx_P-D of FT:mat_peptide AB270549_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL79F). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB270550_HBx_P-D Product feature CHAIN AB270550_HBx_P-D of FT:mat_peptide AB270550_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL247F). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB330367_HBx_P-D Product feature CHAIN AB330367_HBx_P-D of FT:mat_peptide AB330367_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ14HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB330369_HBx_P-D Product feature CHAIN AB330369_HBx_P-D of FT:mat_peptide AB330369_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ5HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB330370_HBx_P-D Product feature CHAIN AB330370_HBx_P-D of FT:mat_peptide AB330370_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ6HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB471856_HBx_P-D Product feature CHAIN AB471856_HBx_P-D of FT:mat_peptide AB471856_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB471857_HBx_P-D Product feature CHAIN AB471857_HBx_P-D of FT:mat_peptide AB471857_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB493846_HBx_P-D Product feature CHAIN AB493846_HBx_P-D of FT:mat_peptide AB493846_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17UC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=153 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB555496_HBx_P-D Product feature CHAIN AB555496_HBx_P-D of FT:mat_peptide AB555496_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPHPFAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB555497_HBx_P-D Product feature CHAIN AB555497_HBx_P-D of FT:mat_peptide AB555497_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPPPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB555500_HBx_P-D Product feature CHAIN AB555500_HBx_P-D of FT:mat_peptide AB555500_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPPPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB555501_HBx_P-D Product feature CHAIN AB555501_HBx_P-D of FT:mat_peptide AB555501_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB583680_HBx_P-D Product feature CHAIN AB583680_HBx_P-D of FT:mat_peptide AB583680_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pkst7912). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674404_HBx_P-D Product feature CHAIN AB674404_HBx_P-D of FT:mat_peptide AB674404_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE39). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674405_HBx_P-D Product feature CHAIN AB674405_HBx_P-D of FT:mat_peptide AB674405_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraHCCA12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674406_HBx_P-D Product feature CHAIN AB674406_HBx_P-D of FT:mat_peptide AB674406_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674407_HBx_P-D Product feature CHAIN AB674407_HBx_P-D of FT:mat_peptide AB674407_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674408_HBx_P-D Product feature CHAIN AB674408_HBx_P-D of FT:mat_peptide AB674408_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|AB674409_HBx_P-D Product feature CHAIN AB674409_HBx_P-D of FT:mat_peptide AB674409_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD40). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKEWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674410_HBx_P-D Product feature CHAIN AB674410_HBx_P-D of FT:mat_peptide AB674410_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD27). Partial genome (Contains: HBc, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674411_HBx_P-D Product feature CHAIN AB674411_HBx_P-D of FT:mat_peptide AB674411_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674413_HBx_P-D Product feature CHAIN AB674413_HBx_P-D of FT:mat_peptide AB674413_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB27). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674414_HBx_P-D Product feature CHAIN AB674414_HBx_P-D of FT:mat_peptide AB674414_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE33). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674415_HBx_P-D Product feature CHAIN AB674415_HBx_P-D of FT:mat_peptide AB674415_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC24). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTMNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674416_HBx_P-D Product feature CHAIN AB674416_HBx_P-D of FT:mat_peptide AB674416_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPDPCNFFTSA
>gnl|hbvpro|AB674417_HBx_P-D Product feature CHAIN AB674417_HBx_P-D of FT:mat_peptide AB674417_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraLCE1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674418_HBx_P-D Product feature CHAIN AB674418_HBx_P-D of FT:mat_peptide AB674418_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC7). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674419_HBx_P-D Product feature CHAIN AB674419_HBx_P-D of FT:mat_peptide AB674419_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVEAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|AB674420_HBx_P-D Product feature CHAIN AB674420_HBx_P-D of FT:mat_peptide AB674420_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunLCD2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLRSLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674422_HBx_P-D Product feature CHAIN AB674422_HBx_P-D of FT:mat_peptide AB674422_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674423_HBx_P-D Product feature CHAIN AB674423_HBx_P-D of FT:mat_peptide AB674423_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674424_HBx_P-D Product feature CHAIN AB674424_HBx_P-D of FT:mat_peptide AB674424_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVSAHHCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|AB674425_HBx_P-D Product feature CHAIN AB674425_HBx_P-D of FT:mat_peptide AB674425_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLHKRTLGLSVMSTTDLEQYFKDCLFKDWEELGEESRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|AB674426_HBx_P-D Product feature CHAIN AB674426_HBx_P-D of FT:mat_peptide AB674426_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD50). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGTLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674427_HBx_P-D Product feature CHAIN AB674427_HBx_P-D of FT:mat_peptide AB674427_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674428_HBx_P-D Product feature CHAIN AB674428_HBx_P-D of FT:mat_peptide AB674428_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674429_HBx_P-D Product feature CHAIN AB674429_HBx_P-D of FT:mat_peptide AB674429_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD89). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSXMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674430_HBx_P-D Product feature CHAIN AB674430_HBx_P-D of FT:mat_peptide AB674430_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC2). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AB674431_HBx_P-D Product feature CHAIN AB674431_HBx_P-D of FT:mat_peptide AB674431_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKEWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF043593_HBx_P-D Product feature CHAIN AF043593_HBx_P-D of FT:mat_peptide AF043593_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6/89). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF043594_HBx_P-D Product feature CHAIN AF043594_HBx_P-D of FT:mat_peptide AF043594_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1/91). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF121239_HBx_P-D Product feature CHAIN AF121239_HBx_P-D of FT:mat_peptide AF121239_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1303). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF121240_HBx_C-D Product feature CHAIN AF121240_HBx_C-D of FT:mat_peptide AF121240_HBx_C-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/11066). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF121241_HBx_P-D Product feature CHAIN AF121241_HBx_P-D of FT:mat_peptide AF121241_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1758). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF121242_HBx_P-D Product feature CHAIN AF121242_HBx_P-D of FT:mat_peptide AF121242_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1218). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF151735_HBx_P-D Product feature CHAIN AF151735_HBx_P-D of FT:mat_peptide AF151735_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AF280817_HBx_P-D Product feature CHAIN AF280817_HBx_P-D of FT:mat_peptide AF280817_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-D1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ131956_HBx_P-D Product feature CHAIN AJ131956_HBx_P-D of FT:mat_peptide AJ131956_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ344116_HBx_P-D Product feature CHAIN AJ344116_HBx_P-D of FT:mat_peptide AJ344116_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBsAg negative patient GX27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGTISSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKEWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627215_HBx_P-D Product feature CHAIN AJ627215_HBx_P-D of FT:mat_peptide AJ627215_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 06115). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSIMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627216_HBx_P-D Product feature CHAIN AJ627216_HBx_P-D of FT:mat_peptide AJ627216_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17707). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSIMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627218_HBx_P-D Product feature CHAIN AJ627218_HBx_P-D of FT:mat_peptide AJ627218_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 21116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSIMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627219_HBx_P-D Product feature CHAIN AJ627219_HBx_P-D of FT:mat_peptide AJ627219_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 24039). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627220_HBx_P-D Product feature CHAIN AJ627220_HBx_P-D of FT:mat_peptide AJ627220_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 29234). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPTAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627222_HBx_P-D Product feature CHAIN AJ627222_HBx_P-D of FT:mat_peptide AJ627222_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 31228). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVXTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFNDWEELGEESRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627223_HBx_P-D Product feature CHAIN AJ627223_HBx_P-D of FT:mat_peptide AJ627223_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33720). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGSLGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AJ627224_HBx_P-D Product feature CHAIN AJ627224_HBx_P-D of FT:mat_peptide AJ627224_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33852). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLTTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AM422939_HBx_P-D Product feature CHAIN AM422939_HBx_P-D of FT:mat_peptide AM422939_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate X28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY090452_HBx_P-D Product feature CHAIN AY090452_HBx_P-D of FT:mat_peptide AY090452_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRELPVCAFSSAGPCALRFTSARHME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY090453_HBx_P-D Product feature CHAIN AY090453_HBx_P-D of FT:mat_peptide AY090453_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161150_HBx_P-D Product feature CHAIN AY161150_HBx_P-D of FT:mat_peptide AY161150_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161151_HBx_P-D Product feature CHAIN AY161151_HBx_P-D of FT:mat_peptide AY161151_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161152_HBx_P-D Product feature CHAIN AY161152_HBx_P-D of FT:mat_peptide AY161152_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161153_HBx_P-D Product feature CHAIN AY161153_HBx_P-D of FT:mat_peptide AY161153_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161154_HBx_P-D Product feature CHAIN AY161154_HBx_P-D of FT:mat_peptide AY161154_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161155_HBx_P-D Product feature CHAIN AY161155_HBx_P-D of FT:mat_peptide AY161155_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161156_HBx_P-D Product feature CHAIN AY161156_HBx_P-D of FT:mat_peptide AY161156_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161157_HBx_P-D Product feature CHAIN AY161157_HBx_P-D of FT:mat_peptide AY161157_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161158_HBx_P-D Product feature CHAIN AY161158_HBx_P-D of FT:mat_peptide AY161158_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDPEACFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161159_HBx_P-D Product feature CHAIN AY161159_HBx_P-D of FT:mat_peptide AY161159_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY161160_HBx_P-D Product feature CHAIN AY161160_HBx_P-D of FT:mat_peptide AY161160_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKGCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233291_HBx_P-D Product feature CHAIN AY233291_HBx_P-D of FT:mat_peptide AY233291_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 179). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233292_HBx_P-D Product feature CHAIN AY233292_HBx_P-D of FT:mat_peptide AY233292_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 184). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALCFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233294_HBx_P-D Product feature CHAIN AY233294_HBx_P-D of FT:mat_peptide AY233294_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 305). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY233296_HBx_P-D Product feature CHAIN AY233296_HBx_P-D of FT:mat_peptide AY233296_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 185). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY236160_HBx_P-D Product feature CHAIN AY236160_HBx_P-D of FT:mat_peptide AY236160_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1A). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARPCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY236162_HBx_P-D Product feature CHAIN AY236162_HBx_P-D of FT:mat_peptide AY236162_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 23A). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEDLGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY236164_HBx_P-D Product feature CHAIN AY236164_HBx_P-D of FT:mat_peptide AY236164_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 30). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLSCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY373431_HBx_P-D Product feature CHAIN AY373431_HBx_P-D of FT:mat_peptide AY373431_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY661792_HBx_P-D Product feature CHAIN AY661792_HBx_P-D of FT:mat_peptide AY661792_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ayw). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY661793_HBx_P-D Product feature CHAIN AY661793_HBx_P-D of FT:mat_peptide AY661793_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY721605_HBx_P-D Product feature CHAIN AY721605_HBx_P-D of FT:mat_peptide AY721605_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AK1.1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY721606_HBx_P-D Product feature CHAIN AY721606_HBx_P-D of FT:mat_peptide AY721606_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AT1.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY721607_HBx_P-D Product feature CHAIN AY721607_HBx_P-D of FT:mat_peptide AY721607_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HIY1.3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY721608_HBx_P-D Product feature CHAIN AY721608_HBx_P-D of FT:mat_peptide AY721608_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IB1.4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEESRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY721609_HBx_P-D Product feature CHAIN AY721609_HBx_P-D of FT:mat_peptide AY721609_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AA1.5). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY721610_HBx_P-D Product feature CHAIN AY721610_HBx_P-D of FT:mat_peptide AY721610_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FK1.6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARGME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLKVFVIGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY721611_HBx_P-D Product feature CHAIN AY721611_HBx_P-D of FT:mat_peptide AY721611_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SK1.7). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY721612_HBx_P-D Product feature CHAIN AY721612_HBx_P-D of FT:mat_peptide AY721612_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BL1.8). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVKAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY741794_HBx_P-D Product feature CHAIN AY741794_HBx_P-D of FT:mat_peptide AY741794_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY741795_HBx_P-D Product feature CHAIN AY741795_HBx_P-D of FT:mat_peptide AY741795_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-Hi). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY741796_HBx_P-D Product feature CHAIN AY741796_HBx_P-D of FT:mat_peptide AY741796_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY741797_HBx_P-D Product feature CHAIN AY741797_HBx_P-D of FT:mat_peptide AY741797_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDPEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY741798_HBx_P-D Product feature CHAIN AY741798_HBx_P-D of FT:mat_peptide AY741798_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P4). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY796030_HBx_P-D Product feature CHAIN AY796030_HBx_P-D of FT:mat_peptide AY796030_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FC1.9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY796031_HBx_P-D Product feature CHAIN AY796031_HBx_P-D of FT:mat_peptide AY796031_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RA1.10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGIFSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHPFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY796032_HBx_P-D Product feature CHAIN AY796032_HBx_P-D of FT:mat_peptide AY796032_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NA1.11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQPFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|AY945307_HBx_P-D Product feature CHAIN AY945307_HBx_P-D of FT:mat_peptide AY945307_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ111986_HBx_P-D Product feature CHAIN DQ111986_HBx_P-D of FT:mat_peptide DQ111986_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MBT181). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|DQ304547_HBx_P-D Product feature CHAIN DQ304547_HBx_P-D of FT:mat_peptide DQ304547_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEDLGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ304548_HBx_P-D Product feature CHAIN DQ304548_HBx_P-D of FT:mat_peptide DQ304548_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEDLGEENRLMIYVLGGCRHKLVCAPAPCNFFTAA
>gnl|hbvpro|DQ304549_HBx_P-D Product feature CHAIN DQ304549_HBx_P-D of FT:mat_peptide DQ304549_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEDLGEENRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ304550_HBx_P-D Product feature CHAIN DQ304550_HBx_P-D of FT:mat_peptide DQ304550_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEDLGEENRLMIYVLGGCRHKLVCAPAPCNFFISAE
>gnl|hbvpro|DQ304551_HBx_P-D Product feature CHAIN DQ304551_HBx_P-D of FT:mat_peptide DQ304551_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEDLGEENRLMIYVLGGCRHKLVCAPAPCNFFISAE
>gnl|hbvpro|DQ315776_HBx_P-D Product feature CHAIN DQ315776_HBx_P-D of FT:mat_peptide DQ315776_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI00615). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ315778_HBx_P-D Product feature CHAIN DQ315778_HBx_P-D of FT:mat_peptide DQ315778_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI0388). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ329356_HBx_P-D Product feature CHAIN DQ329356_HBx_P-D of FT:mat_peptide DQ329356_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPAAVPTDHGAHLSLRGLPVCAFSSAGPWALRFTSARPME
TTVNAHQILPKVLHKRTLGLSAMSTTDLRAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ329357_HBx_P-D Product feature CHAIN DQ329357_HBx_P-D of FT:mat_peptide DQ329357_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPAAVPTDHGAHLSLRGLPVCAFSSAGPWALRFTSARPME
TTVNAHQILPKVLHKRTLGLSAMSTTDLRAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336674_HBx_P-D Product feature CHAIN DQ336674_HBx_P-D of FT:mat_peptide DQ336674_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336675_HBx_P-D Product feature CHAIN DQ336675_HBx_P-D of FT:mat_peptide DQ336675_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336676_HBx_P-D Product feature CHAIN DQ336676_HBx_P-D of FT:mat_peptide DQ336676_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336677_HBx_P-D Product feature CHAIN DQ336677_HBx_P-D of FT:mat_peptide DQ336677_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336678_HBx_P-D Product feature CHAIN DQ336678_HBx_P-D of FT:mat_peptide DQ336678_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336679_HBx_P-D Product feature CHAIN DQ336679_HBx_P-D of FT:mat_peptide DQ336679_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336680_HBx_P-D Product feature CHAIN DQ336680_HBx_P-D of FT:mat_peptide DQ336680_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336681_HBx_P-D Product feature CHAIN DQ336681_HBx_P-D of FT:mat_peptide DQ336681_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336682_HBx_P-D Product feature CHAIN DQ336682_HBx_P-D of FT:mat_peptide DQ336682_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLPVMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336683_HBx_P-D Product feature CHAIN DQ336683_HBx_P-D of FT:mat_peptide DQ336683_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336684_HBx_P-D Product feature CHAIN DQ336684_HBx_P-D of FT:mat_peptide DQ336684_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336685_HBx_P-D Product feature CHAIN DQ336685_HBx_P-D of FT:mat_peptide DQ336685_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336686_HBx_P-D Product feature CHAIN DQ336686_HBx_P-D of FT:mat_peptide DQ336686_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKGFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336687_HBx_P-D Product feature CHAIN DQ336687_HBx_P-D of FT:mat_peptide DQ336687_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKGFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336688_HBx_P-D Product feature CHAIN DQ336688_HBx_P-D of FT:mat_peptide DQ336688_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKGFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336689_HBx_P-D Product feature CHAIN DQ336689_HBx_P-D of FT:mat_peptide DQ336689_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKGFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336690_HBx_P-D Product feature CHAIN DQ336690_HBx_P-D of FT:mat_peptide DQ336690_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEGLRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ336692_HBx_P-D Product feature CHAIN DQ336692_HBx_P-D of FT:mat_peptide DQ336692_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKGFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ399006_HBx_P-D Product feature CHAIN DQ399006_HBx_P-D of FT:mat_peptide DQ399006_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate G1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVVAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464168_HBx_P-D Product feature CHAIN DQ464168_HBx_P-D of FT:mat_peptide DQ464168_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGPHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464169_HBx_P-D Product feature CHAIN DQ464169_HBx_P-D of FT:mat_peptide DQ464169_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGPHLSLRGLPVCAFSSAGPCALRFTSGRRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLRAYFKDCLFKDWEELGKEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464170_HBx_P-D Product feature CHAIN DQ464170_HBx_P-D of FT:mat_peptide DQ464170_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464172_HBx_P-D Product feature CHAIN DQ464172_HBx_P-D of FT:mat_peptide DQ464172_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464173_HBx_P-D Product feature CHAIN DQ464173_HBx_P-D of FT:mat_peptide DQ464173_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464174_HBx_P-D Product feature CHAIN DQ464174_HBx_P-D of FT:mat_peptide DQ464174_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTFA
>gnl|hbvpro|DQ464175_HBx_P-D Product feature CHAIN DQ464175_HBx_P-D of FT:mat_peptide DQ464175_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPRNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKGLHKRTIGLFAMSTTDFEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464178_HBx_P-D Product feature CHAIN DQ464178_HBx_P-D of FT:mat_peptide DQ464178_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSTSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLFAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCXFFTSA
>gnl|hbvpro|DQ464181_HBx_P-D Product feature CHAIN DQ464181_HBx_P-D of FT:mat_peptide DQ464181_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S3). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKEWEELGEECRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ464182_HBx_P-D Product feature CHAIN DQ464182_HBx_P-D of FT:mat_peptide DQ464182_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ486021_HBx_P-D Product feature CHAIN DQ486021_HBx_P-D of FT:mat_peptide DQ486021_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ486022_HBx_P-D Product feature CHAIN DQ486022_HBx_P-D of FT:mat_peptide DQ486022_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLSCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTIGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ486023_HBx_P-D Product feature CHAIN DQ486023_HBx_P-D of FT:mat_peptide DQ486023_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLPSPSPSAVSPNHGANLSLRGLPVCAFSSAGSCAALFTSARRME
TTVNAHQISPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|DQ486025_HBx_P-D Product feature CHAIN DQ486025_HBx_P-D of FT:mat_peptide DQ486025_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF103275_HBx_P-D Product feature CHAIN EF103275_HBx_P-D of FT:mat_peptide EF103275_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF103276_HBx_P-D Product feature CHAIN EF103276_HBx_P-D of FT:mat_peptide EF103276_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYSKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF103277_HBx_P-D Product feature CHAIN EF103277_HBx_P-D of FT:mat_peptide EF103277_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVKAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF103279_HBx_P-D Product feature CHAIN EF103279_HBx_P-D of FT:mat_peptide EF103279_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran99). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAGRLCCQRDLARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TPVNAHQFLLKVLHKRTLGLSAMSTTDLEAYFKDCWFYDWEEWGEEIRLQEFVLEGCRHKLVCAPAPCNFLKSA
>gnl|hbvpro|EF103280_HBx_P-D Product feature CHAIN EF103280_HBx_P-D of FT:mat_peptide EF103280_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran100). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF594771_HBx_P-D Product feature CHAIN EF594771_HBx_P-D of FT:mat_peptide EF594771_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0515). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF594772_HBx_P-D Product feature CHAIN EF594772_HBx_P-D of FT:mat_peptide EF594772_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0526). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF594773_HBx_P-D Product feature CHAIN EF594773_HBx_P-D of FT:mat_peptide EF594773_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 05120). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF594774_HBx_P-D Product feature CHAIN EF594774_HBx_P-D of FT:mat_peptide EF594774_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0522). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EF594775_HBx_P-D Product feature CHAIN EF594775_HBx_P-D of FT:mat_peptide EF594775_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 0347). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|EF594776_HBx_P-D Product feature CHAIN EF594776_HBx_P-D of FT:mat_peptide EF594776_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 036). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLDKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU155893_HBx_P-D Product feature CHAIN EU155893_HBx_P-D of FT:mat_peptide EU155893_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSXTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|EU414135_HBx_P-D Product feature CHAIN EU414135_HBx_P-D of FT:mat_peptide EU414135_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDXLFKDWEELGEEIRLKXFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU414136_HBx_P-D Product feature CHAIN EU414136_HBx_P-D of FT:mat_peptide EU414136_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU414138_HBx_P-D Product feature CHAIN EU414138_HBx_P-D of FT:mat_peptide EU414138_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU414139_HBx_P-D Product feature CHAIN EU414139_HBx_P-D of FT:mat_peptide EU414139_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU414140_HBx_P-D Product feature CHAIN EU414140_HBx_P-D of FT:mat_peptide EU414140_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDXEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|EU414141_HBx_P-D Product feature CHAIN EU414141_HBx_P-D of FT:mat_peptide EU414141_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPYPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLXXFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU414142_HBx_P-D Product feature CHAIN EU414142_HBx_P-D of FT:mat_peptide EU414142_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU414143_HBx_P-D Product feature CHAIN EU414143_HBx_P-D of FT:mat_peptide EU414143_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594382_HBx_P-D Product feature CHAIN EU594382_HBx_P-D of FT:mat_peptide EU594382_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594396_HBx_P-D Product feature CHAIN EU594396_HBx_P-D of FT:mat_peptide EU594396_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSMMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594397_HBx_P-D Product feature CHAIN EU594397_HBx_P-D of FT:mat_peptide EU594397_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594398_HBx_P-D Product feature CHAIN EU594398_HBx_P-D of FT:mat_peptide EU594398_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594399_HBx_P-D Product feature CHAIN EU594399_HBx_P-D of FT:mat_peptide EU594399_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594400_HBx_P-D Product feature CHAIN EU594400_HBx_P-D of FT:mat_peptide EU594400_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594401_HBx_P-D Product feature CHAIN EU594401_HBx_P-D of FT:mat_peptide EU594401_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594402_HBx_P-D Product feature CHAIN EU594402_HBx_P-D of FT:mat_peptide EU594402_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594403_HBx_P-D Product feature CHAIN EU594403_HBx_P-D of FT:mat_peptide EU594403_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594404_HBx_P-D Product feature CHAIN EU594404_HBx_P-D of FT:mat_peptide EU594404_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594405_HBx_P-D Product feature CHAIN EU594405_HBx_P-D of FT:mat_peptide EU594405_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594407_HBx_P-D Product feature CHAIN EU594407_HBx_P-D of FT:mat_peptide EU594407_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594408_HBx_P-D Product feature CHAIN EU594408_HBx_P-D of FT:mat_peptide EU594408_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594409_HBx_P-D Product feature CHAIN EU594409_HBx_P-D of FT:mat_peptide EU594409_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594410_HBx_P-D Product feature CHAIN EU594410_HBx_P-D of FT:mat_peptide EU594410_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594411_HBx_P-D Product feature CHAIN EU594411_HBx_P-D of FT:mat_peptide EU594411_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|EU594412_HBx_P-D Product feature CHAIN EU594412_HBx_P-D of FT:mat_peptide EU594412_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|EU594415_HBx_P-D Product feature CHAIN EU594415_HBx_P-D of FT:mat_peptide EU594415_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594416_HBx_P-D Product feature CHAIN EU594416_HBx_P-D of FT:mat_peptide EU594416_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594421_HBx_P-D Product feature CHAIN EU594421_HBx_P-D of FT:mat_peptide EU594421_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594422_HBx_P-D Product feature CHAIN EU594422_HBx_P-D of FT:mat_peptide EU594422_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594423_HBx_P-D Product feature CHAIN EU594423_HBx_P-D of FT:mat_peptide EU594423_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594424_HBx_P-D Product feature CHAIN EU594424_HBx_P-D of FT:mat_peptide EU594424_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594425_HBx_P-D Product feature CHAIN EU594425_HBx_P-D of FT:mat_peptide EU594425_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594426_HBx_P-D Product feature CHAIN EU594426_HBx_P-D of FT:mat_peptide EU594426_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594427_HBx_P-D Product feature CHAIN EU594427_HBx_P-D of FT:mat_peptide EU594427_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594428_HBx_P-D Product feature CHAIN EU594428_HBx_P-D of FT:mat_peptide EU594428_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594430_HBx_P-D Product feature CHAIN EU594430_HBx_P-D of FT:mat_peptide EU594430_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594431_HBx_P-D Product feature CHAIN EU594431_HBx_P-D of FT:mat_peptide EU594431_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594432_HBx_P-D Product feature CHAIN EU594432_HBx_P-D of FT:mat_peptide EU594432_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594433_HBx_P-D Product feature CHAIN EU594433_HBx_P-D of FT:mat_peptide EU594433_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU594434_HBx_P-D Product feature CHAIN EU594434_HBx_P-D of FT:mat_peptide EU594434_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKMVCAPAPCNFFTSA
>gnl|hbvpro|EU787436_HBx_P-D Product feature CHAIN EU787436_HBx_P-D of FT:mat_peptide EU787436_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787437_HBx_P-D Product feature CHAIN EU787437_HBx_P-D of FT:mat_peptide EU787437_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSTVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787438_HBx_P-D Product feature CHAIN EU787438_HBx_P-D of FT:mat_peptide EU787438_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787439_HBx_P-D Product feature CHAIN EU787439_HBx_P-D of FT:mat_peptide EU787439_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 89). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787440_HBx_P-D Product feature CHAIN EU787440_HBx_P-D of FT:mat_peptide EU787440_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787441_HBx_P-D Product feature CHAIN EU787441_HBx_P-D of FT:mat_peptide EU787441_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787442_HBx_P-D Product feature CHAIN EU787442_HBx_P-D of FT:mat_peptide EU787442_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787443_HBx_P-D Product feature CHAIN EU787443_HBx_P-D of FT:mat_peptide EU787443_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate w40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787445_HBx_P-D Product feature CHAIN EU787445_HBx_P-D of FT:mat_peptide EU787445_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W51). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787446_HBx_P-D Product feature CHAIN EU787446_HBx_P-D of FT:mat_peptide EU787446_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU787447_HBx_P-D Product feature CHAIN EU787447_HBx_P-D of FT:mat_peptide EU787447_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGDCKHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU921418_HBx_P-D Product feature CHAIN EU921418_HBx_P-D of FT:mat_peptide EU921418_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.165.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=153 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU921419_HBx_P-D Product feature CHAIN EU921419_HBx_P-D of FT:mat_peptide EU921419_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.252.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=153 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU939680_HBx_P-D Product feature CHAIN EU939680_HBx_P-D of FT:mat_peptide EU939680_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C186). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|EU939681_HBx_P-D Product feature CHAIN EU939681_HBx_P-D of FT:mat_peptide EU939681_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349205_HBx_P-D Product feature CHAIN FJ349205_HBx_P-D of FT:mat_peptide FJ349205_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349206_HBx_P-D Product feature CHAIN FJ349206_HBx_P-D of FT:mat_peptide FJ349206_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349208_HBx_P-D Product feature CHAIN FJ349208_HBx_P-D of FT:mat_peptide FJ349208_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349209_HBx_P-D Product feature CHAIN FJ349209_HBx_P-D of FT:mat_peptide FJ349209_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349211_HBx_P-D Product feature CHAIN FJ349211_HBx_P-D of FT:mat_peptide FJ349211_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H34). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349213_HBx_P-D Product feature CHAIN FJ349213_HBx_P-D of FT:mat_peptide FJ349213_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H59). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSTGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349214_HBx_P-D Product feature CHAIN FJ349214_HBx_P-D of FT:mat_peptide FJ349214_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H61). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349215_HBx_P-D Product feature CHAIN FJ349215_HBx_P-D of FT:mat_peptide FJ349215_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLKAFVLGGCMDKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349216_HBx_P-D Product feature CHAIN FJ349216_HBx_P-D of FT:mat_peptide FJ349216_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349217_HBx_P-D Product feature CHAIN FJ349217_HBx_P-D of FT:mat_peptide FJ349217_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H129). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349218_HBx_P-D Product feature CHAIN FJ349218_HBx_P-D of FT:mat_peptide FJ349218_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H135). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349219_HBx_P-D Product feature CHAIN FJ349219_HBx_P-D of FT:mat_peptide FJ349219_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H138). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349220_HBx_P-D Product feature CHAIN FJ349220_HBx_P-D of FT:mat_peptide FJ349220_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H144). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349228_HBx_P-D Product feature CHAIN FJ349228_HBx_P-D of FT:mat_peptide FJ349228_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349229_HBx_P-D Product feature CHAIN FJ349229_HBx_P-D of FT:mat_peptide FJ349229_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349230_HBx_P-D Product feature CHAIN FJ349230_HBx_P-D of FT:mat_peptide FJ349230_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349231_HBx_P-D Product feature CHAIN FJ349231_HBx_P-D of FT:mat_peptide FJ349231_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLXVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349232_HBx_P-D Product feature CHAIN FJ349232_HBx_P-D of FT:mat_peptide FJ349232_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349233_HBx_P-D Product feature CHAIN FJ349233_HBx_P-D of FT:mat_peptide FJ349233_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349234_HBx_P-D Product feature CHAIN FJ349234_HBx_P-D of FT:mat_peptide FJ349234_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ349235_HBx_P-D Product feature CHAIN FJ349235_HBx_P-D of FT:mat_peptide FJ349235_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ386590_HBx_P-D Product feature CHAIN FJ386590_HBx_P-D of FT:mat_peptide FJ386590_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1841). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ562309_HBx_P-D Product feature CHAIN FJ562309_HBx_P-D of FT:mat_peptide FJ562309_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I200). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLXCAPAPCNFFTSA
>gnl|hbvpro|FJ562338_HBx_P-D Product feature CHAIN FJ562338_HBx_P-D of FT:mat_peptide FJ562338_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I192). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFEGSLGTLSSPSPSAVPTDHGAYLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ692506_HBx_P-D Product feature CHAIN FJ692506_HBx_P-D of FT:mat_peptide FJ692506_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50157). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ692507_HBx_P-D Product feature CHAIN FJ692507_HBx_P-D of FT:mat_peptide FJ692507_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50158). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ692532_HBx_P-D Product feature CHAIN FJ692532_HBx_P-D of FT:mat_peptide FJ692532_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50053). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ692533_HBx_P-D Product feature CHAIN FJ692533_HBx_P-D of FT:mat_peptide FJ692533_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50064). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ876242_HBx_P-D Product feature CHAIN FJ876242_HBx_P-D of FT:mat_peptide FJ876242_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LCNX48). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEDDRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ876253_HBx_P-D Product feature CHAIN FJ876253_HBx_P-D of FT:mat_peptide FJ876253_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNX26). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ876254_HBx_P-D Product feature CHAIN FJ876254_HBx_P-D of FT:mat_peptide FJ876254_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNX45). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEDDRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ876256_HBx_P-D Product feature CHAIN FJ876256_HBx_P-D of FT:mat_peptide FJ876256_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNX82). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEDDRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ876257_HBx_P-D Product feature CHAIN FJ876257_HBx_P-D of FT:mat_peptide FJ876257_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNX93). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEESRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ899792_HBx_P-D Product feature CHAIN FJ899792_HBx_P-D of FT:mat_peptide FJ899792_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904395_HBx_P-D Product feature CHAIN FJ904395_HBx_P-D of FT:mat_peptide FJ904395_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A10a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|FJ904399_HBx_P-D Product feature CHAIN FJ904399_HBx_P-D of FT:mat_peptide FJ904399_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904402_HBx_P-D Product feature CHAIN FJ904402_HBx_P-D of FT:mat_peptide FJ904402_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|FJ904410_HBx_P-D Product feature CHAIN FJ904410_HBx_P-D of FT:mat_peptide FJ904410_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A54b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|FJ904412_HBx_P-D Product feature CHAIN FJ904412_HBx_P-D of FT:mat_peptide FJ904412_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904415_HBx_P-D Product feature CHAIN FJ904415_HBx_P-D of FT:mat_peptide FJ904415_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A63). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904418_HBx_P-D Product feature CHAIN FJ904418_HBx_P-D of FT:mat_peptide FJ904418_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A69a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLAVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904419_HBx_P-D Product feature CHAIN FJ904419_HBx_P-D of FT:mat_peptide FJ904419_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A70). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904420_HBx_P-D Product feature CHAIN FJ904420_HBx_P-D of FT:mat_peptide FJ904420_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904421_HBx_P-D Product feature CHAIN FJ904421_HBx_P-D of FT:mat_peptide FJ904421_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904422_HBx_P-D Product feature CHAIN FJ904422_HBx_P-D of FT:mat_peptide FJ904422_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQXLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904424_HBx_P-D Product feature CHAIN FJ904424_HBx_P-D of FT:mat_peptide FJ904424_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A79a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904426_HBx_P-D Product feature CHAIN FJ904426_HBx_P-D of FT:mat_peptide FJ904426_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKIFVLGGCRHKLVCAPAPCTFFTSA
>gnl|hbvpro|FJ904427_HBx_P-D Product feature CHAIN FJ904427_HBx_P-D of FT:mat_peptide FJ904427_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTNDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904429_HBx_P-D Product feature CHAIN FJ904429_HBx_P-D of FT:mat_peptide FJ904429_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCXXFTSA
>gnl|hbvpro|FJ904431_HBx_P-D Product feature CHAIN FJ904431_HBx_P-D of FT:mat_peptide FJ904431_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B12). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904432_HBx_P-D Product feature CHAIN FJ904432_HBx_P-D of FT:mat_peptide FJ904432_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPRNFFTSA
>gnl|hbvpro|FJ904433_HBx_C-D Product feature CHAIN FJ904433_HBx_C-D of FT:mat_peptide FJ904433_HBx_C-D of [Viruses] Hepatitis B Virus genotype D (isolate B15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGGLSSPSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPYNFFTSA
>gnl|hbvpro|FJ904435_HBx_P-D Product feature CHAIN FJ904435_HBx_P-D of FT:mat_peptide FJ904435_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904438_HBx_P-D Product feature CHAIN FJ904438_HBx_P-D of FT:mat_peptide FJ904438_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904439_HBx_P-D Product feature CHAIN FJ904439_HBx_P-D of FT:mat_peptide FJ904439_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPLGAESCGRPFSGPLGDLSSSSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904443_HBx_P-D Product feature CHAIN FJ904443_HBx_P-D of FT:mat_peptide FJ904443_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTSDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|FJ904445_HBx_P-D Product feature CHAIN FJ904445_HBx_P-D of FT:mat_peptide FJ904445_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRVE
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPXNFFTSA
>gnl|hbvpro|FJ904446_HBx_P-D Product feature CHAIN FJ904446_HBx_P-D of FT:mat_peptide FJ904446_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B64a). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ167301_HBx_P-D Product feature CHAIN GQ167301_HBx_P-D of FT:mat_peptide GQ167301_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM452). Complete genome. [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ167302_HBx_P-D Product feature CHAIN GQ167302_HBx_P-D of FT:mat_peptide GQ167302_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4521). Complete genome. [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMISVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183448_HBx_P-D Product feature CHAIN GQ183448_HBx_P-D of FT:mat_peptide GQ183448_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4629). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183449_HBx_P-D Product feature CHAIN GQ183449_HBx_P-D of FT:mat_peptide GQ183449_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4591). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183450_HBx_P-D Product feature CHAIN GQ183450_HBx_P-D of FT:mat_peptide GQ183450_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4589). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183451_HBx_P-D Product feature CHAIN GQ183451_HBx_P-D of FT:mat_peptide GQ183451_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4588). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183452_HBx_P-D Product feature CHAIN GQ183452_HBx_P-D of FT:mat_peptide GQ183452_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4590). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183453_HBx_P-D Product feature CHAIN GQ183453_HBx_P-D of FT:mat_peptide GQ183453_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4574). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183454_HBx_P-D Product feature CHAIN GQ183454_HBx_P-D of FT:mat_peptide GQ183454_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4582). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183455_HBx_P-D Product feature CHAIN GQ183455_HBx_P-D of FT:mat_peptide GQ183455_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4573). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183456_HBx_P-D Product feature CHAIN GQ183456_HBx_P-D of FT:mat_peptide GQ183456_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4572). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183457_HBx_P-D Product feature CHAIN GQ183457_HBx_P-D of FT:mat_peptide GQ183457_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4583). Complete genome. [Hepadnaviridae] (length=154 residues).
MADRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183458_HBx_P-D Product feature CHAIN GQ183458_HBx_P-D of FT:mat_peptide GQ183458_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4587). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183459_HBx_P-D Product feature CHAIN GQ183459_HBx_P-D of FT:mat_peptide GQ183459_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4585). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183460_HBx_P-D Product feature CHAIN GQ183460_HBx_P-D of FT:mat_peptide GQ183460_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4584). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVGAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183461_HBx_P-D Product feature CHAIN GQ183461_HBx_P-D of FT:mat_peptide GQ183461_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4586). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183462_HBx_P-D Product feature CHAIN GQ183462_HBx_P-D of FT:mat_peptide GQ183462_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4567). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183463_HBx_P-D Product feature CHAIN GQ183463_HBx_P-D of FT:mat_peptide GQ183463_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4613). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEEWGSETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183464_HBx_P-D Product feature CHAIN GQ183464_HBx_P-D of FT:mat_peptide GQ183464_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4703). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183465_HBx_P-D Product feature CHAIN GQ183465_HBx_P-D of FT:mat_peptide GQ183465_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4614). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183466_HBx_P-D Product feature CHAIN GQ183466_HBx_P-D of FT:mat_peptide GQ183466_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4577). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183467_HBx_P-D Product feature CHAIN GQ183467_HBx_P-D of FT:mat_peptide GQ183467_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4705). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183468_HBx_P-D Product feature CHAIN GQ183468_HBx_P-D of FT:mat_peptide GQ183468_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4632). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183469_HBx_P-D Product feature CHAIN GQ183469_HBx_P-D of FT:mat_peptide GQ183469_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4602). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183470_HBx_P-D Product feature CHAIN GQ183470_HBx_P-D of FT:mat_peptide GQ183470_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4639). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183471_HBx_P-D Product feature CHAIN GQ183471_HBx_P-D of FT:mat_peptide GQ183471_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4610). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVSGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183472_HBx_P-D Product feature CHAIN GQ183472_HBx_P-D of FT:mat_peptide GQ183472_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4691). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183473_HBx_P-D Product feature CHAIN GQ183473_HBx_P-D of FT:mat_peptide GQ183473_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4601). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183474_HBx_P-D Product feature CHAIN GQ183474_HBx_P-D of FT:mat_peptide GQ183474_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4594). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183475_HBx_P-D Product feature CHAIN GQ183475_HBx_P-D of FT:mat_peptide GQ183475_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4575). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183476_HBx_P-D Product feature CHAIN GQ183476_HBx_P-D of FT:mat_peptide GQ183476_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4603). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGQPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183478_HBx_P-D Product feature CHAIN GQ183478_HBx_P-D of FT:mat_peptide GQ183478_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4605). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183479_HBx_P-D Product feature CHAIN GQ183479_HBx_P-D of FT:mat_peptide GQ183479_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4607). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183480_HBx_P-D Product feature CHAIN GQ183480_HBx_P-D of FT:mat_peptide GQ183480_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4609). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183481_HBx_P-D Product feature CHAIN GQ183481_HBx_P-D of FT:mat_peptide GQ183481_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4569). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183482_HBx_P-D Product feature CHAIN GQ183482_HBx_P-D of FT:mat_peptide GQ183482_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4570). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183483_HBx_P-D Product feature CHAIN GQ183483_HBx_P-D of FT:mat_peptide GQ183483_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4566). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183484_HBx_P-D Product feature CHAIN GQ183484_HBx_P-D of FT:mat_peptide GQ183484_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4598). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ183485_HBx_P-D Product feature CHAIN GQ183485_HBx_P-D of FT:mat_peptide GQ183485_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4599). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ184322_HBx_P-D Product feature CHAIN GQ184322_HBx_P-D of FT:mat_peptide GQ184322_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4522). Complete genome. [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRRLPVCAFSSAGPCALRFTSARRMG
METTVNAHQFLPKVLYQRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ205380_HBx_P-D Product feature CHAIN GQ205380_HBx_P-D of FT:mat_peptide GQ205380_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1245). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ205382_HBx_P-D Product feature CHAIN GQ205382_HBx_P-D of FT:mat_peptide GQ205382_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1360d). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKILHKRTLGLSAMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ205384_HBx_P-D Product feature CHAIN GQ205384_HBx_P-D of FT:mat_peptide GQ205384_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1434d). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFASARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ205385_HBx_P-D Product feature CHAIN GQ205385_HBx_P-D of FT:mat_peptide GQ205385_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1469). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|GQ205388_HBx_P-D Product feature CHAIN GQ205388_HBx_P-D of FT:mat_peptide GQ205388_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1562). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSAMSTTDLEPYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ205389_HBx_P-D Product feature CHAIN GQ205389_HBx_P-D of FT:mat_peptide GQ205389_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1667). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ377589_HBx_P-D Product feature CHAIN GQ377589_HBx_P-D of FT:mat_peptide GQ377589_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate J145). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477452_HBx_P-D Product feature CHAIN GQ477452_HBx_P-D of FT:mat_peptide GQ477452_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477453_HBx_P-D Product feature CHAIN GQ477453_HBx_P-D of FT:mat_peptide GQ477453_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477454_HBx_P-D Product feature CHAIN GQ477454_HBx_P-D of FT:mat_peptide GQ477454_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P68). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477455_HBx_P-D Product feature CHAIN GQ477455_HBx_P-D of FT:mat_peptide GQ477455_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P73). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLLKDWEESGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477456_HBx_P-D Product feature CHAIN GQ477456_HBx_P-D of FT:mat_peptide GQ477456_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477457_HBx_P-D Product feature CHAIN GQ477457_HBx_P-D of FT:mat_peptide GQ477457_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P118). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477458_HBx_P-D Product feature CHAIN GQ477458_HBx_P-D of FT:mat_peptide GQ477458_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P126). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ477459_HBx_P-D Product feature CHAIN GQ477459_HBx_P-D of FT:mat_peptide GQ477459_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ922000_HBx_P-D Product feature CHAIN GQ922000_HBx_P-D of FT:mat_peptide GQ922000_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3552). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDRQVLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEESGEEMRLKVFVLGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|GQ922001_HBx_P-D Product feature CHAIN GQ922001_HBx_P-D of FT:mat_peptide GQ922001_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3654). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDRQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ922002_HBx_P-D Product feature CHAIN GQ922002_HBx_P-D of FT:mat_peptide GQ922002_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3624). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDRQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCPPAPCNFFTFA
>gnl|hbvpro|GQ922003_HBx_P-D Product feature CHAIN GQ922003_HBx_P-D of FT:mat_peptide GQ922003_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3225). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDXLCLRPLSAESRGRPXSGPLGPLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSACRME
TTVSAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKEWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ922004_HBx_P-D Product feature CHAIN GQ922004_HBx_P-D of FT:mat_peptide GQ922004_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3284). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPISXPLGSLSSSSLPAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSACRME
TTVSAHHSLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCPPPPCNFFTSA
>gnl|hbvpro|GQ922005_HBx_P-D Product feature CHAIN GQ922005_HBx_P-D of FT:mat_peptide GQ922005_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B2894). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPLGPLSSSSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSACRME
TTVRAHRSLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIKLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GQ924652_HBx_P-D Product feature CHAIN GQ924652_HBx_P-D of FT:mat_peptide GQ924652_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M89). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU357846_HBx_P-D Product feature CHAIN GU357846_HBx_P-D of FT:mat_peptide GU357846_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456635_HBx_P-D Product feature CHAIN GU456635_HBx_P-D of FT:mat_peptide GU456635_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|GU456636_HBx_P-D Product feature CHAIN GU456636_HBx_P-D of FT:mat_peptide GU456636_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNTHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNIFTSA
>gnl|hbvpro|GU456637_HBx_P-D Product feature CHAIN GU456637_HBx_P-D of FT:mat_peptide GU456637_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLASPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLTVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456638_HBx_P-D Product feature CHAIN GU456638_HBx_P-D of FT:mat_peptide GU456638_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARHME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456639_HBx_P-D Product feature CHAIN GU456639_HBx_P-D of FT:mat_peptide GU456639_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T129). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|GU456640_HBx_P-D Product feature CHAIN GU456640_HBx_P-D of FT:mat_peptide GU456640_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKMFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456641_HBx_P-D Product feature CHAIN GU456641_HBx_P-D of FT:mat_peptide GU456641_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456642_HBx_P-D Product feature CHAIN GU456642_HBx_P-D of FT:mat_peptide GU456642_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T70). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSTVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|GU456643_HBx_P-D Product feature CHAIN GU456643_HBx_P-D of FT:mat_peptide GU456643_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456644_HBx_P-D Product feature CHAIN GU456644_HBx_P-D of FT:mat_peptide GU456644_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T58). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHERTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|GU456645_HBx_P-D Product feature CHAIN GU456645_HBx_P-D of FT:mat_peptide GU456645_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPTPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456646_HBx_P-D Product feature CHAIN GU456646_HBx_P-D of FT:mat_peptide GU456646_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T77). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456647_HBx_P-D Product feature CHAIN GU456647_HBx_P-D of FT:mat_peptide GU456647_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T130). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|GU456648_HBx_P-D Product feature CHAIN GU456648_HBx_P-D of FT:mat_peptide GU456648_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456649_HBx_P-D Product feature CHAIN GU456649_HBx_P-D of FT:mat_peptide GU456649_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456650_HBx_P-D Product feature CHAIN GU456650_HBx_P-D of FT:mat_peptide GU456650_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPASSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456651_HBx_P-D Product feature CHAIN GU456651_HBx_P-D of FT:mat_peptide GU456651_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTISSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRCLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|GU456652_HBx_P-D Product feature CHAIN GU456652_HBx_P-D of FT:mat_peptide GU456652_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456653_HBx_P-D Product feature CHAIN GU456653_HBx_P-D of FT:mat_peptide GU456653_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T59). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456654_HBx_P-D Product feature CHAIN GU456654_HBx_P-D of FT:mat_peptide GU456654_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456655_HBx_P-D Product feature CHAIN GU456655_HBx_P-D of FT:mat_peptide GU456655_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T95). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456656_HBx_P-D Product feature CHAIN GU456656_HBx_P-D of FT:mat_peptide GU456656_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456657_HBx_P-D Product feature CHAIN GU456657_HBx_P-D of FT:mat_peptide GU456657_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456658_HBx_P-D Product feature CHAIN GU456658_HBx_P-D of FT:mat_peptide GU456658_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456659_HBx_P-D Product feature CHAIN GU456659_HBx_P-D of FT:mat_peptide GU456659_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456660_HBx_P-D Product feature CHAIN GU456660_HBx_P-D of FT:mat_peptide GU456660_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456661_HBx_P-D Product feature CHAIN GU456661_HBx_P-D of FT:mat_peptide GU456661_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T99). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456662_HBx_P-D Product feature CHAIN GU456662_HBx_P-D of FT:mat_peptide GU456662_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T23). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456663_HBx_P-D Product feature CHAIN GU456663_HBx_P-D of FT:mat_peptide GU456663_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456664_HBx_P-D Product feature CHAIN GU456664_HBx_P-D of FT:mat_peptide GU456664_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456665_HBx_P-D Product feature CHAIN GU456665_HBx_P-D of FT:mat_peptide GU456665_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCTFSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVVGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456666_HBx_P-D Product feature CHAIN GU456666_HBx_P-D of FT:mat_peptide GU456666_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456667_HBx_P-D Product feature CHAIN GU456667_HBx_P-D of FT:mat_peptide GU456667_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T120). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456668_HBx_P-D Product feature CHAIN GU456668_HBx_P-D of FT:mat_peptide GU456668_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPTPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456669_HBx_P-D Product feature CHAIN GU456669_HBx_P-D of FT:mat_peptide GU456669_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T94). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSASPSAISTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456670_HBx_P-D Product feature CHAIN GU456670_HBx_P-D of FT:mat_peptide GU456670_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLTLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456671_HBx_P-D Product feature CHAIN GU456671_HBx_P-D of FT:mat_peptide GU456671_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T56). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456672_HBx_P-D Product feature CHAIN GU456672_HBx_P-D of FT:mat_peptide GU456672_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T73). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456673_HBx_P-D Product feature CHAIN GU456673_HBx_P-D of FT:mat_peptide GU456673_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456674_HBx_P-D Product feature CHAIN GU456674_HBx_P-D of FT:mat_peptide GU456674_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSTPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNIFTSA
>gnl|hbvpro|GU456675_HBx_P-D Product feature CHAIN GU456675_HBx_P-D of FT:mat_peptide GU456675_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456676_HBx_P-D Product feature CHAIN GU456676_HBx_P-D of FT:mat_peptide GU456676_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T98). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMPTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456677_HBx_P-D Product feature CHAIN GU456677_HBx_P-D of FT:mat_peptide GU456677_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSPAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|GU456678_HBx_P-D Product feature CHAIN GU456678_HBx_P-D of FT:mat_peptide GU456678_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKDWXELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456679_HBx_P-D Product feature CHAIN GU456679_HBx_P-D of FT:mat_peptide GU456679_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T63). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPFDFFTSA
>gnl|hbvpro|GU456680_HBx_P-D Product feature CHAIN GU456680_HBx_P-D of FT:mat_peptide GU456680_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T88). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456681_HBx_P-D Product feature CHAIN GU456681_HBx_P-D of FT:mat_peptide GU456681_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456682_HBx_P-D Product feature CHAIN GU456682_HBx_P-D of FT:mat_peptide GU456682_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTATVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|GU456683_HBx_P-D Product feature CHAIN GU456683_HBx_P-D of FT:mat_peptide GU456683_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|GU456684_HBx_P-D Product feature CHAIN GU456684_HBx_P-D of FT:mat_peptide GU456684_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEARLLIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|HM750151_HBx_P-D Product feature CHAIN HM750151_HBx_P-D of FT:mat_peptide HM750151_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSD-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HM750152_HBx_P-D Product feature CHAIN HM750152_HBx_P-D of FT:mat_peptide HM750152_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate QHN-99). Complete genome. [Hepadnaviridae] (length=154 residues).
MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HM750153_HBx_P-D Product feature CHAIN HM750153_HBx_P-D of FT:mat_peptide HM750153_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJW-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRYKLVCASAPCNFFTSA
>gnl|hbvpro|HM750154_HBx_P-D Product feature CHAIN HM750154_HBx_P-D of FT:mat_peptide HM750154_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XGW-23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIGLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HM750155_HBx_P-D Product feature CHAIN HM750155_HBx_P-D of FT:mat_peptide HM750155_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HM750156_HBx_P-D Product feature CHAIN HM750156_HBx_P-D of FT:mat_peptide HM750156_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFEDCLFKNWEESGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ236014_HBx_P-D Product feature CHAIN HQ236014_HBx_P-D of FT:mat_peptide HQ236014_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ236015_HBx_P-D Product feature CHAIN HQ236015_HBx_P-D of FT:mat_peptide HQ236015_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ236016_HBx_P-D Product feature CHAIN HQ236016_HBx_P-D of FT:mat_peptide HQ236016_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAIPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700439_HBx_P-D Product feature CHAIN HQ700439_HBx_P-D of FT:mat_peptide HQ700439_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AD03_1999). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700440_HBx_P-D Product feature CHAIN HQ700440_HBx_P-D of FT:mat_peptide HQ700440_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AD05_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVTAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700441_HBx_P-D Product feature CHAIN HQ700441_HBx_P-D of FT:mat_peptide HQ700441_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN10_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700442_HBx_P-D Product feature CHAIN HQ700442_HBx_P-D of FT:mat_peptide HQ700442_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700443_HBx_P-D Product feature CHAIN HQ700443_HBx_P-D of FT:mat_peptide HQ700443_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700444_HBx_P-D Product feature CHAIN HQ700444_HBx_P-D of FT:mat_peptide HQ700444_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN19_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700445_HBx_P-D Product feature CHAIN HQ700445_HBx_P-D of FT:mat_peptide HQ700445_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700446_HBx_P-D Product feature CHAIN HQ700446_HBx_P-D of FT:mat_peptide HQ700446_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVXVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700447_HBx_P-D Product feature CHAIN HQ700447_HBx_P-D of FT:mat_peptide HQ700447_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700448_HBx_P-D Product feature CHAIN HQ700448_HBx_P-D of FT:mat_peptide HQ700448_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700449_HBx_P-D Product feature CHAIN HQ700449_HBx_P-D of FT:mat_peptide HQ700449_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE06_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700450_HBx_P-D Product feature CHAIN HQ700450_HBx_P-D of FT:mat_peptide HQ700450_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE09_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700451_HBx_P-D Product feature CHAIN HQ700451_HBx_P-D of FT:mat_peptide HQ700451_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GI11_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700453_HBx_P-D Product feature CHAIN HQ700453_HBx_P-D of FT:mat_peptide HQ700453_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA35_1984). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700454_HBx_P-D Product feature CHAIN HQ700454_HBx_P-D of FT:mat_peptide HQ700454_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSPPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700455_HBx_P-D Product feature CHAIN HQ700455_HBx_P-D of FT:mat_peptide HQ700455_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSPPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700458_HBx_P-D Product feature CHAIN HQ700458_HBx_P-D of FT:mat_peptide HQ700458_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE35_1997). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700459_HBx_P-D Product feature CHAIN HQ700459_HBx_P-D of FT:mat_peptide HQ700459_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE55_1993). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700463_HBx_P-D Product feature CHAIN HQ700463_HBx_P-D of FT:mat_peptide HQ700463_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HI43_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700464_HBx_P-D Product feature CHAIN HQ700464_HBx_P-D of FT:mat_peptide HQ700464_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_KA40_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700466_HBx_P-D Product feature CHAIN HQ700466_HBx_P-D of FT:mat_peptide HQ700466_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|HQ700467_HBx_P-D Product feature CHAIN HQ700467_HBx_P-D of FT:mat_peptide HQ700467_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1999). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|HQ700468_HBx_P-D Product feature CHAIN HQ700468_HBx_P-D of FT:mat_peptide HQ700468_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI27_1984). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700469_HBx_P-D Product feature CHAIN HQ700469_HBx_P-D of FT:mat_peptide HQ700469_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700470_HBx_P-D Product feature CHAIN HQ700470_HBx_P-D of FT:mat_peptide HQ700470_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700471_HBx_P-D Product feature CHAIN HQ700471_HBx_P-D of FT:mat_peptide HQ700471_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO70_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700472_HBx_P-D Product feature CHAIN HQ700472_HBx_P-D of FT:mat_peptide HQ700472_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO77_1997). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700473_HBx_P-D Product feature CHAIN HQ700473_HBx_P-D of FT:mat_peptide HQ700473_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEEXGEEIRLXVFVLGGCRHKLVCAPAPCTFFTSA
>gnl|hbvpro|HQ700474_HBx_P-D Product feature CHAIN HQ700474_HBx_P-D of FT:mat_peptide HQ700474_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCTFFTSA
>gnl|hbvpro|HQ700477_HBx_P-D Product feature CHAIN HQ700477_HBx_P-D of FT:mat_peptide HQ700477_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1984). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFILGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|HQ700478_HBx_P-D Product feature CHAIN HQ700478_HBx_P-D of FT:mat_peptide HQ700478_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1994). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700479_HBx_P-D Product feature CHAIN HQ700479_HBx_P-D of FT:mat_peptide HQ700479_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA11_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700480_HBx_P-D Product feature CHAIN HQ700480_HBx_P-D of FT:mat_peptide HQ700480_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700481_HBx_P-D Product feature CHAIN HQ700481_HBx_P-D of FT:mat_peptide HQ700481_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700482_HBx_P-D Product feature CHAIN HQ700482_HBx_P-D of FT:mat_peptide HQ700482_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA40_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700483_HBx_P-D Product feature CHAIN HQ700483_HBx_P-D of FT:mat_peptide HQ700483_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA120_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700484_HBx_P-D Product feature CHAIN HQ700484_HBx_P-D of FT:mat_peptide HQ700484_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA229_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700487_HBx_P-D Product feature CHAIN HQ700487_HBx_P-D of FT:mat_peptide HQ700487_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TU25_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700488_HBx_P-D Product feature CHAIN HQ700488_HBx_P-D of FT:mat_peptide HQ700488_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1984). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700489_HBx_P-D Product feature CHAIN HQ700489_HBx_P-D of FT:mat_peptide HQ700489_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1999). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700510_HBx_P-D Product feature CHAIN HQ700510_HBx_P-D of FT:mat_peptide HQ700510_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_128225_2003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700511_HBx_P-D Product feature CHAIN HQ700511_HBx_P-D of FT:mat_peptide HQ700511_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_164317_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700512_HBx_P-D Product feature CHAIN HQ700512_HBx_P-D of FT:mat_peptide HQ700512_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_182089_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700513_HBx_P-D Product feature CHAIN HQ700513_HBx_P-D of FT:mat_peptide HQ700513_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_16600_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ700514_HBx_P-D Product feature CHAIN HQ700514_HBx_P-D of FT:mat_peptide HQ700514_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_1664337_2001). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTYA
>gnl|hbvpro|HQ700553_HBx_P-D Product feature CHAIN HQ700553_HBx_P-D of FT:mat_peptide HQ700553_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1999). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ833465_HBx_P-D Product feature CHAIN HQ833465_HBx_P-D of FT:mat_peptide HQ833465_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ833466_HBx_P-D Product feature CHAIN HQ833466_HBx_P-D of FT:mat_peptide HQ833466_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB26). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEXRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ833467_HBx_P-D Product feature CHAIN HQ833467_HBx_P-D of FT:mat_peptide HQ833467_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSXMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ833468_HBx_P-D Product feature CHAIN HQ833468_HBx_P-D of FT:mat_peptide HQ833468_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ833469_HBx_P-D Product feature CHAIN HQ833469_HBx_P-D of FT:mat_peptide HQ833469_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ833470_HBx_P-D Product feature CHAIN HQ833470_HBx_P-D of FT:mat_peptide HQ833470_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|HQ833471_HBx_P-D Product feature CHAIN HQ833471_HBx_P-D of FT:mat_peptide HQ833471_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB97). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSPISTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754588_HBx_P-D Product feature CHAIN JF754588_HBx_P-D of FT:mat_peptide JF754588_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK61). Complete genome. [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRMG
METTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEXRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754590_HBx_P-D Product feature CHAIN JF754590_HBx_P-D of FT:mat_peptide JF754590_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754591_HBx_P-D Product feature CHAIN JF754591_HBx_P-D of FT:mat_peptide JF754591_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754592_HBx_P-D Product feature CHAIN JF754592_HBx_P-D of FT:mat_peptide JF754592_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK64). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754593_HBx_P-D Product feature CHAIN JF754593_HBx_P-D of FT:mat_peptide JF754593_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK170). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754594_HBx_P-D Product feature CHAIN JF754594_HBx_P-D of FT:mat_peptide JF754594_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEDSRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754595_HBx_P-D Product feature CHAIN JF754595_HBx_P-D of FT:mat_peptide JF754595_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK164). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754596_HBx_P-D Product feature CHAIN JF754596_HBx_P-D of FT:mat_peptide JF754596_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754597_HBx_P-D Product feature CHAIN JF754597_HBx_P-D of FT:mat_peptide JF754597_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754598_HBx_P-D Product feature CHAIN JF754598_HBx_P-D of FT:mat_peptide JF754598_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK104). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754599_HBx_P-D Product feature CHAIN JF754599_HBx_P-D of FT:mat_peptide JF754599_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK173). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754600_HBx_P-D Product feature CHAIN JF754600_HBx_P-D of FT:mat_peptide JF754600_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK91). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754601_HBx_P-D Product feature CHAIN JF754601_HBx_P-D of FT:mat_peptide JF754601_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK88). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754602_HBx_P-D Product feature CHAIN JF754602_HBx_P-D of FT:mat_peptide JF754602_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754603_HBx_P-D Product feature CHAIN JF754603_HBx_P-D of FT:mat_peptide JF754603_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754604_HBx_P-D Product feature CHAIN JF754604_HBx_P-D of FT:mat_peptide JF754604_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTFSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754605_HBx_P-D Product feature CHAIN JF754605_HBx_P-D of FT:mat_peptide JF754605_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK77). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|JF754606_HBx_P-D Product feature CHAIN JF754606_HBx_P-D of FT:mat_peptide JF754606_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK73). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSTSAVSTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754607_HBx_P-D Product feature CHAIN JF754607_HBx_P-D of FT:mat_peptide JF754607_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPAPYNFFTSA
>gnl|hbvpro|JF754608_HBx_P-D Product feature CHAIN JF754608_HBx_P-D of FT:mat_peptide JF754608_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK63). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHPFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754609_HBx_P-D Product feature CHAIN JF754609_HBx_P-D of FT:mat_peptide JF754609_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK45). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754610_HBx_P-D Product feature CHAIN JF754610_HBx_P-D of FT:mat_peptide JF754610_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK157). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHPFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754611_HBx_P-D Product feature CHAIN JF754611_HBx_P-D of FT:mat_peptide JF754611_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK152). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|JF754612_HBx_P-D Product feature CHAIN JF754612_HBx_P-D of FT:mat_peptide JF754612_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK148). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754614_HBx_P-D Product feature CHAIN JF754614_HBx_P-D of FT:mat_peptide JF754614_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|JF754615_HBx_P-D Product feature CHAIN JF754615_HBx_P-D of FT:mat_peptide JF754615_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK141). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLPVMSTTDLEAYFKDCLFKEWEELGEELRLMIFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|JF754617_HBx_P-D Product feature CHAIN JF754617_HBx_P-D of FT:mat_peptide JF754617_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK131). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754618_HBx_P-D Product feature CHAIN JF754618_HBx_P-D of FT:mat_peptide JF754618_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK129). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754619_HBx_P-D Product feature CHAIN JF754619_HBx_P-D of FT:mat_peptide JF754619_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK62). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPEPCDFFTSA
>gnl|hbvpro|JF754621_HBx_P-D Product feature CHAIN JF754621_HBx_P-D of FT:mat_peptide JF754621_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK161). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLQIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754622_HBx_P-D Product feature CHAIN JF754622_HBx_P-D of FT:mat_peptide JF754622_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK16). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754623_HBx_P-D Product feature CHAIN JF754623_HBx_P-D of FT:mat_peptide JF754623_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK171). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754624_HBx_P-D Product feature CHAIN JF754624_HBx_P-D of FT:mat_peptide JF754624_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754625_HBx_P-D Product feature CHAIN JF754625_HBx_P-D of FT:mat_peptide JF754625_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK25). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGTESRGRSFSGSLGTFSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRVTSARRLE
TTVNAHQFLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPGNFFTSA
>gnl|hbvpro|JF754626_HBx_P-D Product feature CHAIN JF754626_HBx_P-D of FT:mat_peptide JF754626_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754627_HBx_P-D Product feature CHAIN JF754627_HBx_P-D of FT:mat_peptide JF754627_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|JF754628_HBx_P-D Product feature CHAIN JF754628_HBx_P-D of FT:mat_peptide JF754628_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754629_HBx_P-D Product feature CHAIN JF754629_HBx_P-D of FT:mat_peptide JF754629_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK176). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPFDFFTSA
>gnl|hbvpro|JF754630_HBx_P-D Product feature CHAIN JF754630_HBx_P-D of FT:mat_peptide JF754630_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK175). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCALSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754631_HBx_P-D Product feature CHAIN JF754631_HBx_P-D of FT:mat_peptide JF754631_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK193). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754632_HBx_P-D Product feature CHAIN JF754632_HBx_P-D of FT:mat_peptide JF754632_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK186). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHGAYLSLRGLPVCAFTSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCDFFTSA
>gnl|hbvpro|JF754633_HBx_P-D Product feature CHAIN JF754633_HBx_P-D of FT:mat_peptide JF754633_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK128). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHPFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754634_HBx_P-D Product feature CHAIN JF754634_HBx_P-D of FT:mat_peptide JF754634_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSXSAVSTDHGANLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF754635_HBx_P-D Product feature CHAIN JF754635_HBx_P-D of FT:mat_peptide JF754635_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPRNFFTSA
>gnl|hbvpro|JF911682_HBx_P-D Product feature CHAIN JF911682_HBx_P-D of FT:mat_peptide JF911682_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BA81). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLLSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF911683_HBx_P-D Product feature CHAIN JF911683_HBx_P-D of FT:mat_peptide JF911683_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BA79). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARNME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKFVCAPAPCNFFTSA
>gnl|hbvpro|JF911685_HBx_P-D Product feature CHAIN JF911685_HBx_P-D of FT:mat_peptide JF911685_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BA76). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF911687_HBx_P-D Product feature CHAIN JF911687_HBx_P-D of FT:mat_peptide JF911687_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BA46). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JF911690_HBx_P-D Product feature CHAIN JF911690_HBx_P-D of FT:mat_peptide JF911690_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BA47). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPTPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040750_HBx_P-D Product feature CHAIN JN040750_HBx_P-D of FT:mat_peptide JN040750_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919078). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPFGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLPVMSTTDLEAYFKDCLFKEWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040751_HBx_P-D Product feature CHAIN JN040751_HBx_P-D of FT:mat_peptide JN040751_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919047). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCKFFTSA
>gnl|hbvpro|JN040752_HBx_P-D Product feature CHAIN JN040752_HBx_P-D of FT:mat_peptide JN040752_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919033). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040753_HBx_P-D Product feature CHAIN JN040753_HBx_P-D of FT:mat_peptide JN040753_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919064). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSHSAVSTDHGAHLSLRGLPVCAFSSAGPCALRITSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040754_HBx_P-D Product feature CHAIN JN040754_HBx_P-D of FT:mat_peptide JN040754_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919045). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040755_HBx_P-D Product feature CHAIN JN040755_HBx_P-D of FT:mat_peptide JN040755_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919086). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040756_HBx_P-D Product feature CHAIN JN040756_HBx_P-D of FT:mat_peptide JN040756_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919039). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|JN040757_HBx_P-D Product feature CHAIN JN040757_HBx_P-D of FT:mat_peptide JN040757_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919056). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040758_HBx_P-D Product feature CHAIN JN040758_HBx_P-D of FT:mat_peptide JN040758_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919037). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040759_HBx_P-D Product feature CHAIN JN040759_HBx_P-D of FT:mat_peptide JN040759_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919063). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040760_HBx_P-D Product feature CHAIN JN040760_HBx_P-D of FT:mat_peptide JN040760_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919059). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040761_HBx_P-D Product feature CHAIN JN040761_HBx_P-D of FT:mat_peptide JN040761_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919002). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040762_HBx_P-D Product feature CHAIN JN040762_HBx_P-D of FT:mat_peptide JN040762_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919007). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGPFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040765_HBx_P-D Product feature CHAIN JN040765_HBx_P-D of FT:mat_peptide JN040765_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040766_HBx_P-D Product feature CHAIN JN040766_HBx_P-D of FT:mat_peptide JN040766_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919046). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHHFLPKVLHKRTLGLSVMPTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040767_HBx_P-D Product feature CHAIN JN040767_HBx_P-D of FT:mat_peptide JN040767_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919019). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040768_HBx_P-D Product feature CHAIN JN040768_HBx_P-D of FT:mat_peptide JN040768_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919051). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040769_HBx_P-D Product feature CHAIN JN040769_HBx_P-D of FT:mat_peptide JN040769_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919015). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040770_HBx_P-D Product feature CHAIN JN040770_HBx_P-D of FT:mat_peptide JN040770_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919087). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040771_HBx_P-D Product feature CHAIN JN040771_HBx_P-D of FT:mat_peptide JN040771_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919013). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040772_HBx_P-D Product feature CHAIN JN040772_HBx_P-D of FT:mat_peptide JN040772_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919065). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040773_HBx_P-D Product feature CHAIN JN040773_HBx_P-D of FT:mat_peptide JN040773_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919084). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLELFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040774_HBx_P-D Product feature CHAIN JN040774_HBx_P-D of FT:mat_peptide JN040774_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919088). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCIFFTSA
>gnl|hbvpro|JN040775_HBx_P-D Product feature CHAIN JN040775_HBx_P-D of FT:mat_peptide JN040775_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919049). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040776_HBx_P-D Product feature CHAIN JN040776_HBx_P-D of FT:mat_peptide JN040776_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919043). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCVFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPFDFFTSA
>gnl|hbvpro|JN040777_HBx_P-D Product feature CHAIN JN040777_HBx_P-D of FT:mat_peptide JN040777_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919017). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040778_HBx_P-D Product feature CHAIN JN040778_HBx_P-D of FT:mat_peptide JN040778_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919038). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040779_HBx_P-D Product feature CHAIN JN040779_HBx_P-D of FT:mat_peptide JN040779_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919070). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVVPESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|JN040780_HBx_P-D Product feature CHAIN JN040780_HBx_P-D of FT:mat_peptide JN040780_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919072). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040781_HBx_P-D Product feature CHAIN JN040781_HBx_P-D of FT:mat_peptide JN040781_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919029). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040782_HBx_P-D Product feature CHAIN JN040782_HBx_P-D of FT:mat_peptide JN040782_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919041). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKEWEELGEENRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040783_HBx_P-D Product feature CHAIN JN040783_HBx_P-D of FT:mat_peptide JN040783_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919090). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040784_HBx_P-D Product feature CHAIN JN040784_HBx_P-D of FT:mat_peptide JN040784_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919030). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040785_HBx_P-D Product feature CHAIN JN040785_HBx_P-D of FT:mat_peptide JN040785_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919022). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040786_HBx_P-D Product feature CHAIN JN040786_HBx_P-D of FT:mat_peptide JN040786_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919035). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040787_HBx_P-D Product feature CHAIN JN040787_HBx_P-D of FT:mat_peptide JN040787_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919040). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040788_HBx_P-D Product feature CHAIN JN040788_HBx_P-D of FT:mat_peptide JN040788_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919024). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040790_HBx_P-D Product feature CHAIN JN040790_HBx_P-D of FT:mat_peptide JN040790_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919054). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040791_HBx_P-D Product feature CHAIN JN040791_HBx_P-D of FT:mat_peptide JN040791_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919082). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040792_HBx_P-D Product feature CHAIN JN040792_HBx_P-D of FT:mat_peptide JN040792_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919079). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040793_HBx_P-D Product feature CHAIN JN040793_HBx_P-D of FT:mat_peptide JN040793_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919083). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040794_HBx_P-D Product feature CHAIN JN040794_HBx_P-D of FT:mat_peptide JN040794_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919075). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTISSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040795_HBx_P-D Product feature CHAIN JN040795_HBx_P-D of FT:mat_peptide JN040795_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919003). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKFFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040796_HBx_P-D Product feature CHAIN JN040796_HBx_P-D of FT:mat_peptide JN040796_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919018). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCIFFTSA
>gnl|hbvpro|JN040797_HBx_P-D Product feature CHAIN JN040797_HBx_P-D of FT:mat_peptide JN040797_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919021). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|JN040799_HBx_P-D Product feature CHAIN JN040799_HBx_P-D of FT:mat_peptide JN040799_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919080). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040800_HBx_P-D Product feature CHAIN JN040800_HBx_P-D of FT:mat_peptide JN040800_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919012). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040801_HBx_P-D Product feature CHAIN JN040801_HBx_P-D of FT:mat_peptide JN040801_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919042). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040802_HBx_P-D Product feature CHAIN JN040802_HBx_P-D of FT:mat_peptide JN040802_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919074). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVSAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040804_HBx_P-D Product feature CHAIN JN040804_HBx_P-D of FT:mat_peptide JN040804_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919028). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040805_HBx_P-D Product feature CHAIN JN040805_HBx_P-D of FT:mat_peptide JN040805_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919058). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLTVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040806_HBx_P-D Product feature CHAIN JN040806_HBx_P-D of FT:mat_peptide JN040806_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919066). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLRCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040807_HBx_P-D Product feature CHAIN JN040807_HBx_P-D of FT:mat_peptide JN040807_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919034). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040808_HBx_P-D Product feature CHAIN JN040808_HBx_P-D of FT:mat_peptide JN040808_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTISSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040809_HBx_P-D Product feature CHAIN JN040809_HBx_P-D of FT:mat_peptide JN040809_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919014). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040810_HBx_P-D Product feature CHAIN JN040810_HBx_P-D of FT:mat_peptide JN040810_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919060). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040811_HBx_P-D Product feature CHAIN JN040811_HBx_P-D of FT:mat_peptide JN040811_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919048). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNPHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLHLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040812_HBx_P-D Product feature CHAIN JN040812_HBx_P-D of FT:mat_peptide JN040812_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919027). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040813_HBx_P-D Product feature CHAIN JN040813_HBx_P-D of FT:mat_peptide JN040813_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919025). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040814_HBx_P-D Product feature CHAIN JN040814_HBx_P-D of FT:mat_peptide JN040814_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919032). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKMFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040815_HBx_P-D Product feature CHAIN JN040815_HBx_P-D of FT:mat_peptide JN040815_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919073). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040816_HBx_P-D Product feature CHAIN JN040816_HBx_P-D of FT:mat_peptide JN040816_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919016). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040817_HBx_P-D Product feature CHAIN JN040817_HBx_P-D of FT:mat_peptide JN040817_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919020). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040818_HBx_P-D Product feature CHAIN JN040818_HBx_P-D of FT:mat_peptide JN040818_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919081). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040819_HBx_P-D Product feature CHAIN JN040819_HBx_P-D of FT:mat_peptide JN040819_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919067). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEDWGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040820_HBx_P-D Product feature CHAIN JN040820_HBx_P-D of FT:mat_peptide JN040820_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919010). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSTVSSDHGAQLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIYVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|JN040821_HBx_P-D Product feature CHAIN JN040821_HBx_P-D of FT:mat_peptide JN040821_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919085). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040822_HBx_P-D Product feature CHAIN JN040822_HBx_P-D of FT:mat_peptide JN040822_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919044). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLQAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040823_HBx_P-D Product feature CHAIN JN040823_HBx_P-D of FT:mat_peptide JN040823_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKFFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040824_HBx_P-D Product feature CHAIN JN040824_HBx_P-D of FT:mat_peptide JN040824_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919071). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEDIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040826_HBx_P-D Product feature CHAIN JN040826_HBx_P-D of FT:mat_peptide JN040826_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919055). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040828_HBx_P-D Product feature CHAIN JN040828_HBx_P-D of FT:mat_peptide JN040828_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919069). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRLE
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEFRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040829_HBx_P-D Product feature CHAIN JN040829_HBx_P-D of FT:mat_peptide JN040829_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919089). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN040830_HBx_P-D Product feature CHAIN JN040830_HBx_P-D of FT:mat_peptide JN040830_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919052). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPWNFFTSA
>gnl|hbvpro|JN257148_HBx_P-D Product feature CHAIN JN257148_HBx_P-D of FT:mat_peptide JN257148_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMF). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257149_HBx_P-D Product feature CHAIN JN257149_HBx_P-D of FT:mat_peptide JN257149_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSFN). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPXSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257150_HBx_P-D Product feature CHAIN JN257150_HBx_P-D of FT:mat_peptide JN257150_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABS). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257151_HBx_P-D Product feature CHAIN JN257151_HBx_P-D of FT:mat_peptide JN257151_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHHR). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257152_HBx_P-D Product feature CHAIN JN257152_HBx_P-D of FT:mat_peptide JN257152_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRJB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257153_HBx_P-D Product feature CHAIN JN257153_HBx_P-D of FT:mat_peptide JN257153_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPXPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVLPTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPEPCNFFTSA
>gnl|hbvpro|JN257155_HBx_P-D Product feature CHAIN JN257155_HBx_P-D of FT:mat_peptide JN257155_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJHM1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257159_HBx_P-D Product feature CHAIN JN257159_HBx_P-D of FT:mat_peptide JN257159_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMRW). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=153 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLXLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257160_HBx_P-D Product feature CHAIN JN257160_HBx_P-D of FT:mat_peptide JN257160_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHATR1). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLXKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFXSAX
>gnl|hbvpro|JN257161_HBx_P-D Product feature CHAIN JN257161_HBx_P-D of FT:mat_peptide JN257161_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHATR2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLXKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFXSAX
>gnl|hbvpro|JN257162_HBx_P-D Product feature CHAIN JN257162_HBx_P-D of FT:mat_peptide JN257162_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSDQ). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPXRNVLCLRPVGAESRGRPFSGPLGTLSSPSPXAVSTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLXXFVLGGCRHKLVCAPAPCNFFXSAX
>gnl|hbvpro|JN257163_HBx_P-D Product feature CHAIN JN257163_HBx_P-D of FT:mat_peptide JN257163_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAZI). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257165_HBx_P-D Product feature CHAIN JN257165_HBx_P-D of FT:mat_peptide JN257165_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257166_HBx_P-D Product feature CHAIN JN257166_HBx_P-D of FT:mat_peptide JN257166_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL2). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257167_HBx_P-D Product feature CHAIN JN257167_HBx_P-D of FT:mat_peptide JN257167_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHMM1). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGSLSSPXTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVTAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCDFFTSA
>gnl|hbvpro|JN257169_HBx_P-D Product feature CHAIN JN257169_HBx_P-D of FT:mat_peptide JN257169_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAFF). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257170_HBx_P-D Product feature CHAIN JN257170_HBx_P-D of FT:mat_peptide JN257170_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJWB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257171_HBx_P-D Product feature CHAIN JN257171_HBx_P-D of FT:mat_peptide JN257171_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKML). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257172_HBx_P-D Product feature CHAIN JN257172_HBx_P-D of FT:mat_peptide JN257172_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMYD1). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSXAGPCALRXTSARRME
TTVNAHQFLPKVLHKRTLGLSVXSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFXSAX
>gnl|hbvpro|JN257173_HBx_P-D Product feature CHAIN JN257173_HBx_P-D of FT:mat_peptide JN257173_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMYD2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSXAGPCALRXTSARRME
TTVNAHQFLPKVLHKRTLGLSVXSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFXSAX
>gnl|hbvpro|JN257176_HBx_P-D Product feature CHAIN JN257176_HBx_P-D of FT:mat_peptide JN257176_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ1). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPAPCNFFXSAX
>gnl|hbvpro|JN257177_HBx_P-D Product feature CHAIN JN257177_HBx_P-D of FT:mat_peptide JN257177_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ2). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPAPCNFFXSAX
>gnl|hbvpro|JN257178_HBx_P-D Product feature CHAIN JN257178_HBx_P-D of FT:mat_peptide JN257178_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHTRK). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257179_HBx_P-D Product feature CHAIN JN257179_HBx_P-D of FT:mat_peptide JN257179_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMJD1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVTAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLXVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257181_HBx_P-D Product feature CHAIN JN257181_HBx_P-D of FT:mat_peptide JN257181_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHNDA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257182_HBx_P-D Product feature CHAIN JN257182_HBx_P-D of FT:mat_peptide JN257182_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMSL). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257183_HBx_P-D Product feature CHAIN JN257183_HBx_P-D of FT:mat_peptide JN257183_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKSH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAQQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257185_HBx_P-D Product feature CHAIN JN257185_HBx_P-D of FT:mat_peptide JN257185_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHZYD). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257187_HBx_P-D Product feature CHAIN JN257187_HBx_P-D of FT:mat_peptide JN257187_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL1). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHYFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257188_HBx_P-D Product feature CHAIN JN257188_HBx_P-D of FT:mat_peptide JN257188_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHYFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257190_HBx_P-D Product feature CHAIN JN257190_HBx_P-D of FT:mat_peptide JN257190_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHYHY). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257193_HBx_P-D Product feature CHAIN JN257193_HBx_P-D of FT:mat_peptide JN257193_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVLSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257194_HBx_P-D Product feature CHAIN JN257194_HBx_P-D of FT:mat_peptide JN257194_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVLSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257195_HBx_P-D Product feature CHAIN JN257195_HBx_P-D of FT:mat_peptide JN257195_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVLPTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPEPCNFFTSA
>gnl|hbvpro|JN257196_HBx_P-D Product feature CHAIN JN257196_HBx_P-D of FT:mat_peptide JN257196_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABR1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257199_HBx_P-D Product feature CHAIN JN257199_HBx_P-D of FT:mat_peptide JN257199_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSOD2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257200_HBx_P-D Product feature CHAIN JN257200_HBx_P-D of FT:mat_peptide JN257200_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMNM). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVXAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257201_HBx_P-D Product feature CHAIN JN257201_HBx_P-D of FT:mat_peptide JN257201_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFAD). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257202_HBx_P-D Product feature CHAIN JN257202_HBx_P-D of FT:mat_peptide JN257202_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSLI). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCXRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257203_HBx_P-D Product feature CHAIN JN257203_HBx_P-D of FT:mat_peptide JN257203_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJKF). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLXAMSTTDLEAYFKDCLFKDWEELGEEIRLKXFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257205_HBx_P-D Product feature CHAIN JN257205_HBx_P-D of FT:mat_peptide JN257205_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRYD). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVISTTDLEAYFKDCLFKDWEELGEENRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257209_HBx_P-D Product feature CHAIN JN257209_HBx_P-D of FT:mat_peptide JN257209_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMR2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDTARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257211_HBx_P-D Product feature CHAIN JN257211_HBx_P-D of FT:mat_peptide JN257211_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHBRH1). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVXAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFPSAY
>gnl|hbvpro|JN257214_HBx_P-D Product feature CHAIN JN257214_HBx_P-D of FT:mat_peptide JN257214_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJDR1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN257215_HBx_P-D Product feature CHAIN JN257215_HBx_P-D of FT:mat_peptide JN257215_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJDR2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN574723_HBx_P-D Product feature CHAIN JN574723_HBx_P-D of FT:mat_peptide JN574723_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FPX4). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN574725_HBx_P-D Product feature CHAIN JN574725_HBx_P-D of FT:mat_peptide JN574725_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FPX6). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN574728_HBx_P-D Product feature CHAIN JN574728_HBx_P-D of FT:mat_peptide JN574728_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FPX9). Partial genome (Contains: HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN574729_HBx_P-D Product feature CHAIN JN574729_HBx_P-D of FT:mat_peptide JN574729_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FPX21). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642126_HBx_P-D Product feature CHAIN JN642126_HBx_P-D of FT:mat_peptide JN642126_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642128_HBx_P-D Product feature CHAIN JN642128_HBx_P-D of FT:mat_peptide JN642128_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb11). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGDESRGRPFSGPLGTLSSPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642129_HBx_P-D Product feature CHAIN JN642129_HBx_P-D of FT:mat_peptide JN642129_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|JN642130_HBx_P-D Product feature CHAIN JN642130_HBx_P-D of FT:mat_peptide JN642130_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642131_HBx_P-D Product feature CHAIN JN642131_HBx_P-D of FT:mat_peptide JN642131_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642132_HBx_P-D Product feature CHAIN JN642132_HBx_P-D of FT:mat_peptide JN642132_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642133_HBx_P-D Product feature CHAIN JN642133_HBx_P-D of FT:mat_peptide JN642133_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVTAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642134_HBx_P-D Product feature CHAIN JN642134_HBx_P-D of FT:mat_peptide JN642134_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642135_HBx_P-D Product feature CHAIN JN642135_HBx_P-D of FT:mat_peptide JN642135_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDRLFKDWEELGEELRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642136_HBx_P-D Product feature CHAIN JN642136_HBx_P-D of FT:mat_peptide JN642136_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPFNFFTSA
>gnl|hbvpro|JN642138_HBx_P-D Product feature CHAIN JN642138_HBx_P-D of FT:mat_peptide JN642138_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPFGAESRGRPVSGPLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642140_HBx_P-D Product feature CHAIN JN642140_HBx_P-D of FT:mat_peptide JN642140_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642142_HBx_P-D Product feature CHAIN JN642142_HBx_P-D of FT:mat_peptide JN642142_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARCME
TTVNAHQSLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642143_HBx_P-D Product feature CHAIN JN642143_HBx_P-D of FT:mat_peptide JN642143_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb33). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642144_HBx_P-D Product feature CHAIN JN642144_HBx_P-D of FT:mat_peptide JN642144_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642145_HBx_P-D Product feature CHAIN JN642145_HBx_P-D of FT:mat_peptide JN642145_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642146_HBx_P-D Product feature CHAIN JN642146_HBx_P-D of FT:mat_peptide JN642146_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCTFFTSA
>gnl|hbvpro|JN642147_HBx_P-D Product feature CHAIN JN642147_HBx_P-D of FT:mat_peptide JN642147_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb39). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGNLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642148_HBx_P-D Product feature CHAIN JN642148_HBx_P-D of FT:mat_peptide JN642148_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNARQFLPKVLYKRTLGLSVMSTADLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|JN642149_HBx_P-D Product feature CHAIN JN642149_HBx_P-D of FT:mat_peptide JN642149_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642150_HBx_P-D Product feature CHAIN JN642150_HBx_P-D of FT:mat_peptide JN642150_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLRLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642151_HBx_P-D Product feature CHAIN JN642151_HBx_P-D of FT:mat_peptide JN642151_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRITSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642153_HBx_P-D Product feature CHAIN JN642153_HBx_P-D of FT:mat_peptide JN642153_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642154_HBx_P-D Product feature CHAIN JN642154_HBx_P-D of FT:mat_peptide JN642154_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642155_HBx_P-D Product feature CHAIN JN642155_HBx_P-D of FT:mat_peptide JN642155_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb49). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642156_HBx_P-D Product feature CHAIN JN642156_HBx_P-D of FT:mat_peptide JN642156_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb50). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642157_HBx_P-D Product feature CHAIN JN642157_HBx_P-D of FT:mat_peptide JN642157_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLRLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642158_HBx_P-D Product feature CHAIN JN642158_HBx_P-D of FT:mat_peptide JN642158_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVLSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642159_HBx_P-D Product feature CHAIN JN642159_HBx_P-D of FT:mat_peptide JN642159_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHGAHLSLRGLPVCAFSSTGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642161_HBx_P-D Product feature CHAIN JN642161_HBx_P-D of FT:mat_peptide JN642161_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTADLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642162_HBx_P-D Product feature CHAIN JN642162_HBx_P-D of FT:mat_peptide JN642162_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb58). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642163_HBx_P-D Product feature CHAIN JN642163_HBx_P-D of FT:mat_peptide JN642163_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb59). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|JN642164_HBx_P-D Product feature CHAIN JN642164_HBx_P-D of FT:mat_peptide JN642164_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb60). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642165_HBx_P-D Product feature CHAIN JN642165_HBx_P-D of FT:mat_peptide JN642165_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLCVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642166_HBx_P-D Product feature CHAIN JN642166_HBx_P-D of FT:mat_peptide JN642166_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVTAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKMFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN642167_HBx_P-D Product feature CHAIN JN642167_HBx_P-D of FT:mat_peptide JN642167_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664909_HBx_P-D Product feature CHAIN JN664909_HBx_P-D of FT:mat_peptide JN664909_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB36_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALSFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664910_HBx_P-D Product feature CHAIN JN664910_HBx_P-D of FT:mat_peptide JN664910_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB43_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664911_HBx_P-D Product feature CHAIN JN664911_HBx_P-D of FT:mat_peptide JN664911_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB47_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664912_HBx_P-D Product feature CHAIN JN664912_HBx_P-D of FT:mat_peptide JN664912_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB49_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLARDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664913_HBx_P-D Product feature CHAIN JN664913_HBx_P-D of FT:mat_peptide JN664913_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN01_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTLSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664914_HBx_P-D Product feature CHAIN JN664914_HBx_P-D of FT:mat_peptide JN664914_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN48_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664917_HBx_P-D Product feature CHAIN JN664917_HBx_P-D of FT:mat_peptide JN664917_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SKR_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664918_HBx_P-D Product feature CHAIN JN664918_HBx_P-D of FT:mat_peptide JN664918_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2198_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664919_HBx_P-D Product feature CHAIN JN664919_HBx_P-D of FT:mat_peptide JN664919_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2320_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|JN664920_HBx_P-D Product feature CHAIN JN664920_HBx_P-D of FT:mat_peptide JN664920_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1903_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664921_HBx_P-D Product feature CHAIN JN664921_HBx_P-D of FT:mat_peptide JN664921_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN47_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDILCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664922_HBx_P-D Product feature CHAIN JN664922_HBx_P-D of FT:mat_peptide JN664922_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DH01_IC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664924_HBx_P-D Product feature CHAIN JN664924_HBx_P-D of FT:mat_peptide JN664924_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN32_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRSLPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVSGKLELFFFTSA
>gnl|hbvpro|JN664926_HBx_P-D Product feature CHAIN JN664926_HBx_P-D of FT:mat_peptide JN664926_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN63_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKILHKRTLGLSTMSTIDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664927_HBx_P-D Product feature CHAIN JN664927_HBx_P-D of FT:mat_peptide JN664927_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE20_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLASPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664928_HBx_P-D Product feature CHAIN JN664928_HBx_P-D of FT:mat_peptide JN664928_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE27_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664930_HBx_P-D Product feature CHAIN JN664930_HBx_P-D of FT:mat_peptide JN664930_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEN9_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664931_HBx_P-D Product feature CHAIN JN664931_HBx_P-D of FT:mat_peptide JN664931_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB6_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSSHHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRSLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664932_HBx_P-D Product feature CHAIN JN664932_HBx_P-D of FT:mat_peptide JN664932_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2235_CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664936_HBx_P-D Product feature CHAIN JN664936_HBx_P-D of FT:mat_peptide JN664936_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate E3529_LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664937_HBx_P-D Product feature CHAIN JN664937_HBx_P-D of FT:mat_peptide JN664937_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN45_LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664938_HBx_P-D Product feature CHAIN JN664938_HBx_P-D of FT:mat_peptide JN664938_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN46_LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664939_HBx_P-D Product feature CHAIN JN664939_HBx_P-D of FT:mat_peptide JN664939_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN71_LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664941_HBx_P-D Product feature CHAIN JN664941_HBx_P-D of FT:mat_peptide JN664941_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB21_LC). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSSSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN664947_HBx_P-D Product feature CHAIN JN664947_HBx_P-D of FT:mat_peptide JN664947_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB41_LC). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGPRSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKILYKRTLGLSTMSTTDLEQYFQDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPWNFFTSA
>gnl|hbvpro|JN664948_HBx_P-D Product feature CHAIN JN664948_HBx_P-D of FT:mat_peptide JN664948_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN64_LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN688678_HBx_P-D Product feature CHAIN JN688678_HBx_P-D of FT:mat_peptide JN688678_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV007). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEELRLKVFVLGGCRHKLVCAPAPCDFFTSA
>gnl|hbvpro|JN688679_HBx_P-D Product feature CHAIN JN688679_HBx_P-D of FT:mat_peptide JN688679_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV010). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN688683_HBx_P-D Product feature CHAIN JN688683_HBx_P-D of FT:mat_peptide JN688683_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV087). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPXRDVLCLRPVGAESRGRPXSGXLGTLSSPSPSAVPXDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPRNFFTSA
>gnl|hbvpro|JN688685_HBx_P-D Product feature CHAIN JN688685_HBx_P-D of FT:mat_peptide JN688685_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV097). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYXRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN688695_HBx_P-D Product feature CHAIN JN688695_HBx_P-D of FT:mat_peptide JN688695_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV128). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPATCNFFTSA
>gnl|hbvpro|JN688708_HBx_P-D Product feature CHAIN JN688708_HBx_P-D of FT:mat_peptide JN688708_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV142). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPXSGXLGTXSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLXKRTLELFAMSTTDLEAYFKDCLFKDWEELGEEIXLLIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN688710_HBx_P-D Product feature CHAIN JN688710_HBx_P-D of FT:mat_peptide JN688710_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV144). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLFAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN688711_HBx_P-D Product feature CHAIN JN688711_HBx_P-D of FT:mat_peptide JN688711_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV161). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLFTMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|JN688712_HBx_P-D Product feature CHAIN JN688712_HBx_P-D of FT:mat_peptide JN688712_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV163). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHHVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN688713_HBx_P-D Product feature CHAIN JN688713_HBx_P-D of FT:mat_peptide JN688713_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV173). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRVTSASCRM
ETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|JN688722_HBx_P-D Product feature CHAIN JN688722_HBx_P-D of FT:mat_peptide JN688722_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV228). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLXAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792903_HBx_P-D Product feature CHAIN JN792903_HBx_P-D of FT:mat_peptide JN792903_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 310000127). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792904_HBx_P-D Product feature CHAIN JN792904_HBx_P-D of FT:mat_peptide JN792904_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002943). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792905_HBx_P-D Product feature CHAIN JN792905_HBx_P-D of FT:mat_peptide JN792905_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000345). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792906_HBx_P-D Product feature CHAIN JN792906_HBx_P-D of FT:mat_peptide JN792906_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002958). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792907_HBx_P-D Product feature CHAIN JN792907_HBx_P-D of FT:mat_peptide JN792907_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000473). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792908_HBx_P-D Product feature CHAIN JN792908_HBx_P-D of FT:mat_peptide JN792908_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002951). Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRPFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKEWEDLGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792909_HBx_P-D Product feature CHAIN JN792909_HBx_P-D of FT:mat_peptide JN792909_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000479). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792910_HBx_P-D Product feature CHAIN JN792910_HBx_P-D of FT:mat_peptide JN792910_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 109001205). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792911_HBx_P-D Product feature CHAIN JN792911_HBx_P-D of FT:mat_peptide JN792911_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002952). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLKAHQCLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEELRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JN792912_HBx_P-D Product feature CHAIN JN792912_HBx_P-D of FT:mat_peptide JN792912_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 307000449). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEDLGEELRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ032005_HBx_P-D Product feature CHAIN JQ032005_HBx_P-D of FT:mat_peptide JQ032005_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M16). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLVPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFGLGGCKHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ032006_HBx_P-D Product feature CHAIN JQ032006_HBx_P-D of FT:mat_peptide JQ032006_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M17). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCHGVPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLQVFVLGGCRNILVCAPAPCTFFTSA
>gnl|hbvpro|JQ032007_HBx_P-D Product feature CHAIN JQ032007_HBx_P-D of FT:mat_peptide JQ032007_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M23). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|JQ272897_HBx_P-D Product feature CHAIN JQ272897_HBx_P-D of FT:mat_peptide JQ272897_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_MDQ10). Partial genome (Contains: HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ518361_HBx_P-D Product feature CHAIN JQ518361_HBx_P-D of FT:mat_peptide JQ518361_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ687530_HBx_P-D Product feature CHAIN JQ687530_HBx_P-D of FT:mat_peptide JQ687530_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 200). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEKRLKVFVLGGCRHKLVCAPPPCNFFTSA
>gnl|hbvpro|JQ687531_HBx_P-D Product feature CHAIN JQ687531_HBx_P-D of FT:mat_peptide JQ687531_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 205). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVIVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707476_HBx_P-D Product feature CHAIN JQ707476_HBx_P-D of FT:mat_peptide JQ707476_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707477_HBx_P-D Product feature CHAIN JQ707477_HBx_P-D of FT:mat_peptide JQ707477_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707478_HBx_P-D Product feature CHAIN JQ707478_HBx_P-D of FT:mat_peptide JQ707478_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707479_HBx_P-D Product feature CHAIN JQ707479_HBx_P-D of FT:mat_peptide JQ707479_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707480_HBx_P-D Product feature CHAIN JQ707480_HBx_P-D of FT:mat_peptide JQ707480_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707481_HBx_P-D Product feature CHAIN JQ707481_HBx_P-D of FT:mat_peptide JQ707481_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707482_HBx_P-D Product feature CHAIN JQ707482_HBx_P-D of FT:mat_peptide JQ707482_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C17-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707483_HBx_P-D Product feature CHAIN JQ707483_HBx_P-D of FT:mat_peptide JQ707483_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707484_HBx_P-D Product feature CHAIN JQ707484_HBx_P-D of FT:mat_peptide JQ707484_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C19). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707485_HBx_P-D Product feature CHAIN JQ707485_HBx_P-D of FT:mat_peptide JQ707485_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707486_HBx_P-D Product feature CHAIN JQ707486_HBx_P-D of FT:mat_peptide JQ707486_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707487_HBx_P-D Product feature CHAIN JQ707487_HBx_P-D of FT:mat_peptide JQ707487_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707488_HBx_P-D Product feature CHAIN JQ707488_HBx_P-D of FT:mat_peptide JQ707488_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707489_HBx_P-D Product feature CHAIN JQ707489_HBx_P-D of FT:mat_peptide JQ707489_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707490_HBx_P-D Product feature CHAIN JQ707490_HBx_P-D of FT:mat_peptide JQ707490_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707491_HBx_P-D Product feature CHAIN JQ707491_HBx_P-D of FT:mat_peptide JQ707491_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C3). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707492_HBx_P-D Product feature CHAIN JQ707492_HBx_P-D of FT:mat_peptide JQ707492_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C30). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707493_HBx_P-D Product feature CHAIN JQ707493_HBx_P-D of FT:mat_peptide JQ707493_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRPSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707494_HBx_P-D Product feature CHAIN JQ707494_HBx_P-D of FT:mat_peptide JQ707494_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707495_HBx_P-D Product feature CHAIN JQ707495_HBx_P-D of FT:mat_peptide JQ707495_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C33). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707496_HBx_P-D Product feature CHAIN JQ707496_HBx_P-D of FT:mat_peptide JQ707496_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C34-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707497_HBx_P-D Product feature CHAIN JQ707497_HBx_P-D of FT:mat_peptide JQ707497_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFTDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707498_HBx_P-D Product feature CHAIN JQ707498_HBx_P-D of FT:mat_peptide JQ707498_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C37). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707499_HBx_P-D Product feature CHAIN JQ707499_HBx_P-D of FT:mat_peptide JQ707499_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707500_HBx_P-D Product feature CHAIN JQ707500_HBx_P-D of FT:mat_peptide JQ707500_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707501_HBx_P-D Product feature CHAIN JQ707501_HBx_P-D of FT:mat_peptide JQ707501_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C41). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707502_HBx_P-D Product feature CHAIN JQ707502_HBx_P-D of FT:mat_peptide JQ707502_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707503_HBx_P-D Product feature CHAIN JQ707503_HBx_P-D of FT:mat_peptide JQ707503_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707504_HBx_P-D Product feature CHAIN JQ707504_HBx_P-D of FT:mat_peptide JQ707504_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C44). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707505_HBx_P-D Product feature CHAIN JQ707505_HBx_P-D of FT:mat_peptide JQ707505_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707506_HBx_P-D Product feature CHAIN JQ707506_HBx_P-D of FT:mat_peptide JQ707506_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C46). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707507_HBx_P-D Product feature CHAIN JQ707507_HBx_P-D of FT:mat_peptide JQ707507_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707508_HBx_P-D Product feature CHAIN JQ707508_HBx_P-D of FT:mat_peptide JQ707508_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSSSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707509_HBx_P-D Product feature CHAIN JQ707509_HBx_P-D of FT:mat_peptide JQ707509_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYCKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707510_HBx_P-D Product feature CHAIN JQ707510_HBx_P-D of FT:mat_peptide JQ707510_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVRSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707511_HBx_P-D Product feature CHAIN JQ707511_HBx_P-D of FT:mat_peptide JQ707511_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707512_HBx_P-D Product feature CHAIN JQ707512_HBx_P-D of FT:mat_peptide JQ707512_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C1-22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707513_HBx_P-D Product feature CHAIN JQ707513_HBx_P-D of FT:mat_peptide JQ707513_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707514_HBx_P-D Product feature CHAIN JQ707514_HBx_P-D of FT:mat_peptide JQ707514_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707515_HBx_P-D Product feature CHAIN JQ707515_HBx_P-D of FT:mat_peptide JQ707515_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707516_HBx_P-D Product feature CHAIN JQ707516_HBx_P-D of FT:mat_peptide JQ707516_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707517_HBx_P-D Product feature CHAIN JQ707517_HBx_P-D of FT:mat_peptide JQ707517_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707518_HBx_P-D Product feature CHAIN JQ707518_HBx_P-D of FT:mat_peptide JQ707518_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C17-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707519_HBx_P-D Product feature CHAIN JQ707519_HBx_P-D of FT:mat_peptide JQ707519_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707520_HBx_P-D Product feature CHAIN JQ707520_HBx_P-D of FT:mat_peptide JQ707520_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707521_HBx_P-D Product feature CHAIN JQ707521_HBx_P-D of FT:mat_peptide JQ707521_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707522_HBx_P-D Product feature CHAIN JQ707522_HBx_P-D of FT:mat_peptide JQ707522_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707523_HBx_P-D Product feature CHAIN JQ707523_HBx_P-D of FT:mat_peptide JQ707523_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707524_HBx_P-D Product feature CHAIN JQ707524_HBx_P-D of FT:mat_peptide JQ707524_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707525_HBx_P-D Product feature CHAIN JQ707525_HBx_P-D of FT:mat_peptide JQ707525_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707526_HBx_P-D Product feature CHAIN JQ707526_HBx_P-D of FT:mat_peptide JQ707526_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCFRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707527_HBx_P-D Product feature CHAIN JQ707527_HBx_P-D of FT:mat_peptide JQ707527_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707528_HBx_P-D Product feature CHAIN JQ707528_HBx_P-D of FT:mat_peptide JQ707528_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
ATVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707529_HBx_P-D Product feature CHAIN JQ707529_HBx_P-D of FT:mat_peptide JQ707529_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707530_HBx_P-D Product feature CHAIN JQ707530_HBx_P-D of FT:mat_peptide JQ707530_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSLSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLQVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707682_HBx_P-D Product feature CHAIN JQ707682_HBx_P-D of FT:mat_peptide JQ707682_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_1-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707683_HBx_P-D Product feature CHAIN JQ707683_HBx_P-D of FT:mat_peptide JQ707683_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707684_HBx_P-D Product feature CHAIN JQ707684_HBx_P-D of FT:mat_peptide JQ707684_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707685_HBx_P-D Product feature CHAIN JQ707685_HBx_P-D of FT:mat_peptide JQ707685_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707686_HBx_P-D Product feature CHAIN JQ707686_HBx_P-D of FT:mat_peptide JQ707686_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707687_HBx_P-D Product feature CHAIN JQ707687_HBx_P-D of FT:mat_peptide JQ707687_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707688_HBx_P-D Product feature CHAIN JQ707688_HBx_P-D of FT:mat_peptide JQ707688_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFPSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707689_HBx_P-D Product feature CHAIN JQ707689_HBx_P-D of FT:mat_peptide JQ707689_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707690_HBx_P-D Product feature CHAIN JQ707690_HBx_P-D of FT:mat_peptide JQ707690_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707691_HBx_P-D Product feature CHAIN JQ707691_HBx_P-D of FT:mat_peptide JQ707691_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707692_HBx_P-D Product feature CHAIN JQ707692_HBx_P-D of FT:mat_peptide JQ707692_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707693_HBx_P-D Product feature CHAIN JQ707693_HBx_P-D of FT:mat_peptide JQ707693_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707694_HBx_P-D Product feature CHAIN JQ707694_HBx_P-D of FT:mat_peptide JQ707694_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707695_HBx_P-D Product feature CHAIN JQ707695_HBx_P-D of FT:mat_peptide JQ707695_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707696_HBx_P-D Product feature CHAIN JQ707696_HBx_P-D of FT:mat_peptide JQ707696_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707697_HBx_P-D Product feature CHAIN JQ707697_HBx_P-D of FT:mat_peptide JQ707697_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707698_HBx_P-D Product feature CHAIN JQ707698_HBx_P-D of FT:mat_peptide JQ707698_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707699_HBx_P-D Product feature CHAIN JQ707699_HBx_P-D of FT:mat_peptide JQ707699_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707700_HBx_P-D Product feature CHAIN JQ707700_HBx_P-D of FT:mat_peptide JQ707700_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_36-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707701_HBx_P-D Product feature CHAIN JQ707701_HBx_P-D of FT:mat_peptide JQ707701_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707702_HBx_P-D Product feature CHAIN JQ707702_HBx_P-D of FT:mat_peptide JQ707702_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707703_HBx_P-D Product feature CHAIN JQ707703_HBx_P-D of FT:mat_peptide JQ707703_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707704_HBx_P-D Product feature CHAIN JQ707704_HBx_P-D of FT:mat_peptide JQ707704_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707705_HBx_P-D Product feature CHAIN JQ707705_HBx_P-D of FT:mat_peptide JQ707705_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ707706_HBx_P-D Product feature CHAIN JQ707706_HBx_P-D of FT:mat_peptide JQ707706_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_8-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JQ927384_HBx_P-D Product feature CHAIN JQ927384_HBx_P-D of FT:mat_peptide JQ927384_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KM2109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPLGTLPSPXTPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX096954_HBx_P-D Product feature CHAIN JX096954_HBx_P-D of FT:mat_peptide JX096954_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1-3242). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX096955_HBx_P-D Product feature CHAIN JX096955_HBx_P-D of FT:mat_peptide JX096955_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2-3051). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX096956_HBx_P-D Product feature CHAIN JX096956_HBx_P-D of FT:mat_peptide JX096956_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5-6154). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX096957_HBx_P-D Product feature CHAIN JX096957_HBx_P-D of FT:mat_peptide JX096957_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6-2646). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDREELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX096958_HBx_P-D Product feature CHAIN JX096958_HBx_P-D of FT:mat_peptide JX096958_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7-1276). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX470760_HBx_P-D Product feature CHAIN JX470760_HBx_P-D of FT:mat_peptide JX470760_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H-IDU6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898689_HBx_P-D Product feature CHAIN JX898689_HBx_P-D of FT:mat_peptide JX898689_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898691_HBx_P-D Product feature CHAIN JX898691_HBx_P-D of FT:mat_peptide JX898691_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898692_HBx_P-D Product feature CHAIN JX898692_HBx_P-D of FT:mat_peptide JX898692_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898694_HBx_P-D Product feature CHAIN JX898694_HBx_P-D of FT:mat_peptide JX898694_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|JX898697_HBx_P-D Product feature CHAIN JX898697_HBx_P-D of FT:mat_peptide JX898697_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLAKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC012652_HBx_P-D Product feature CHAIN KC012652_HBx_P-D of FT:mat_peptide KC012652_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFLLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC774436_HBx_P-D Product feature CHAIN KC774436_HBx_P-D of FT:mat_peptide KC774436_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1008). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPAGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774437_HBx_P-D Product feature CHAIN KC774437_HBx_P-D of FT:mat_peptide KC774437_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1009). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|KC774440_HBx_P-D Product feature CHAIN KC774440_HBx_P-D of FT:mat_peptide KC774440_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1028). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESSGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774444_HBx_P-D Product feature CHAIN KC774444_HBx_P-D of FT:mat_peptide KC774444_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1038). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774445_HBx_P-D Product feature CHAIN KC774445_HBx_P-D of FT:mat_peptide KC774445_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1040). Complete genome. [Hepadnaviridae] (length=154 residues).
MAVRLCCQLDRARDVLCLRPVGAESRGRPFSGPLGILLSLCPFAVSSDPGAHLSLRGLPVCAFSSAGPCALRFTSARGME
TTVNAHQFLPKVLHKRTLGLFVMSTTDLEAYFKDCLFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774459_HBx_P-D Product feature CHAIN KC774459_HBx_P-D of FT:mat_peptide KC774459_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1111). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774460_HBx_P-D Product feature CHAIN KC774460_HBx_P-D of FT:mat_peptide KC774460_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1112). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFQGPAGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774462_HBx_P-D Product feature CHAIN KC774462_HBx_P-D of FT:mat_peptide KC774462_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dxa2047). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLNVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|KC774477_HBx_P-D Product feature CHAIN KC774477_HBx_P-D of FT:mat_peptide KC774477_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dxn1031). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLLSPSPSAVSSDPGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFFPKVLHKRTLGLFVMSTTDLEAYFKDCLFQDWEELGEENRFKVFVLGGCRHKMVCAPAPCNFFTSA
>gnl|hbvpro|KC875275_HBx_P-D Product feature CHAIN KC875275_HBx_P-D of FT:mat_peptide KC875275_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV39). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875276_HBx_P-D Product feature CHAIN KC875276_HBx_P-D of FT:mat_peptide KC875276_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSMTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875277_HBx_P-D Product feature CHAIN KC875277_HBx_P-D of FT:mat_peptide KC875277_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875278_HBx_P-D Product feature CHAIN KC875278_HBx_P-D of FT:mat_peptide KC875278_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875279_HBx_P-D Product feature CHAIN KC875279_HBx_P-D of FT:mat_peptide KC875279_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPNVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875280_HBx_P-D Product feature CHAIN KC875280_HBx_P-D of FT:mat_peptide KC875280_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875281_HBx_P-D Product feature CHAIN KC875281_HBx_P-D of FT:mat_peptide KC875281_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV32). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875282_HBx_P-D Product feature CHAIN KC875282_HBx_P-D of FT:mat_peptide KC875282_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875283_HBx_P-D Product feature CHAIN KC875283_HBx_P-D of FT:mat_peptide KC875283_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875284_HBx_P-D Product feature CHAIN KC875284_HBx_P-D of FT:mat_peptide KC875284_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV28). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSFAGPCALRFTSARRME
TTVNARRFLPKVLHKRTLGLSVMSMTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875285_HBx_P-D Product feature CHAIN KC875285_HBx_P-D of FT:mat_peptide KC875285_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV29). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875286_HBx_P-D Product feature CHAIN KC875286_HBx_P-D of FT:mat_peptide KC875286_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHVSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875287_HBx_P-D Product feature CHAIN KC875287_HBx_P-D of FT:mat_peptide KC875287_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875288_HBx_P-D Product feature CHAIN KC875288_HBx_P-D of FT:mat_peptide KC875288_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875289_HBx_P-D Product feature CHAIN KC875289_HBx_P-D of FT:mat_peptide KC875289_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV55). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875290_HBx_P-D Product feature CHAIN KC875290_HBx_P-D of FT:mat_peptide KC875290_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875291_HBx_P-D Product feature CHAIN KC875291_HBx_P-D of FT:mat_peptide KC875291_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV58). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLDAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875292_HBx_P-D Product feature CHAIN KC875292_HBx_P-D of FT:mat_peptide KC875292_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875293_HBx_P-D Product feature CHAIN KC875293_HBx_P-D of FT:mat_peptide KC875293_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV69). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875294_HBx_P-D Product feature CHAIN KC875294_HBx_P-D of FT:mat_peptide KC875294_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV70). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875295_HBx_P-D Product feature CHAIN KC875295_HBx_P-D of FT:mat_peptide KC875295_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV81). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875296_HBx_P-D Product feature CHAIN KC875296_HBx_P-D of FT:mat_peptide KC875296_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV82). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875297_HBx_P-D Product feature CHAIN KC875297_HBx_P-D of FT:mat_peptide KC875297_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV84). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875298_HBx_P-D Product feature CHAIN KC875298_HBx_P-D of FT:mat_peptide KC875298_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV76). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875299_HBx_P-D Product feature CHAIN KC875299_HBx_P-D of FT:mat_peptide KC875299_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV85). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARRFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875300_HBx_P-D Product feature CHAIN KC875300_HBx_P-D of FT:mat_peptide KC875300_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV80). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875301_HBx_P-D Product feature CHAIN KC875301_HBx_P-D of FT:mat_peptide KC875301_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV89). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875302_HBx_P-D Product feature CHAIN KC875302_HBx_P-D of FT:mat_peptide KC875302_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875303_HBx_P-D Product feature CHAIN KC875303_HBx_P-D of FT:mat_peptide KC875303_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV92). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875304_HBx_P-D Product feature CHAIN KC875304_HBx_P-D of FT:mat_peptide KC875304_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV91). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLPGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875305_HBx_P-D Product feature CHAIN KC875305_HBx_P-D of FT:mat_peptide KC875305_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV41). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875306_HBx_P-D Product feature CHAIN KC875306_HBx_P-D of FT:mat_peptide KC875306_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV71). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPRNFFTSA
>gnl|hbvpro|KC875307_HBx_P-D Product feature CHAIN KC875307_HBx_P-D of FT:mat_peptide KC875307_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV74). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875308_HBx_P-D Product feature CHAIN KC875308_HBx_P-D of FT:mat_peptide KC875308_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV72). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875309_HBx_P-D Product feature CHAIN KC875309_HBx_P-D of FT:mat_peptide KC875309_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV43). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875310_HBx_P-D Product feature CHAIN KC875310_HBx_P-D of FT:mat_peptide KC875310_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875311_HBx_P-D Product feature CHAIN KC875311_HBx_P-D of FT:mat_peptide KC875311_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAVSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875312_HBx_P-D Product feature CHAIN KC875312_HBx_P-D of FT:mat_peptide KC875312_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV22). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTCARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875313_HBx_P-D Product feature CHAIN KC875313_HBx_P-D of FT:mat_peptide KC875313_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875314_HBx_P-D Product feature CHAIN KC875314_HBx_P-D of FT:mat_peptide KC875314_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV2). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSMTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875315_HBx_P-D Product feature CHAIN KC875315_HBx_P-D of FT:mat_peptide KC875315_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV8). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPGGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLRGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875316_HBx_P-D Product feature CHAIN KC875316_HBx_P-D of FT:mat_peptide KC875316_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875317_HBx_P-D Product feature CHAIN KC875317_HBx_P-D of FT:mat_peptide KC875317_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875318_HBx_P-D Product feature CHAIN KC875318_HBx_P-D of FT:mat_peptide KC875318_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV40). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSTSAVPTDHGAHLSLHGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875319_HBx_P-D Product feature CHAIN KC875319_HBx_P-D of FT:mat_peptide KC875319_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV30). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875320_HBx_P-D Product feature CHAIN KC875320_HBx_P-D of FT:mat_peptide KC875320_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875321_HBx_P-D Product feature CHAIN KC875321_HBx_P-D of FT:mat_peptide KC875321_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV19). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875322_HBx_P-D Product feature CHAIN KC875322_HBx_P-D of FT:mat_peptide KC875322_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV54). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875323_HBx_P-D Product feature CHAIN KC875323_HBx_P-D of FT:mat_peptide KC875323_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV53). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875324_HBx_P-D Product feature CHAIN KC875324_HBx_P-D of FT:mat_peptide KC875324_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV59). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875325_HBx_P-D Product feature CHAIN KC875325_HBx_P-D of FT:mat_peptide KC875325_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV60). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875326_HBx_P-D Product feature CHAIN KC875326_HBx_P-D of FT:mat_peptide KC875326_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV37). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875328_HBx_P-D Product feature CHAIN KC875328_HBx_P-D of FT:mat_peptide KC875328_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV83). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875329_HBx_P-D Product feature CHAIN KC875329_HBx_P-D of FT:mat_peptide KC875329_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV90). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875330_HBx_P-D Product feature CHAIN KC875330_HBx_P-D of FT:mat_peptide KC875330_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV87). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875331_HBx_P-D Product feature CHAIN KC875331_HBx_P-D of FT:mat_peptide KC875331_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV88). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875332_HBx_P-D Product feature CHAIN KC875332_HBx_P-D of FT:mat_peptide KC875332_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875333_HBx_P-D Product feature CHAIN KC875333_HBx_P-D of FT:mat_peptide KC875333_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875334_HBx_P-D Product feature CHAIN KC875334_HBx_P-D of FT:mat_peptide KC875334_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV47). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875335_HBx_P-D Product feature CHAIN KC875335_HBx_P-D of FT:mat_peptide KC875335_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV44). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875336_HBx_P-D Product feature CHAIN KC875336_HBx_P-D of FT:mat_peptide KC875336_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875337_HBx_P-D Product feature CHAIN KC875337_HBx_P-D of FT:mat_peptide KC875337_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KC875340_HBx_P-D Product feature CHAIN KC875340_HBx_P-D of FT:mat_peptide KC875340_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV34). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|KC875341_HBx_P-D Product feature CHAIN KC875341_HBx_P-D of FT:mat_peptide KC875341_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV67). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|KC875342_HBx_P-D Product feature CHAIN KC875342_HBx_P-D of FT:mat_peptide KC875342_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV79). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHEILPKILYKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|KF018197_HBx_P-D Product feature CHAIN KF018197_HBx_P-D of FT:mat_peptide KF018197_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF018208_HBx_P-D Product feature CHAIN KF018208_HBx_P-D of FT:mat_peptide KF018208_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF018210_HBx_P-D Product feature CHAIN KF018210_HBx_P-D of FT:mat_peptide KF018210_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF018211_HBx_P-D Product feature CHAIN KF018211_HBx_P-D of FT:mat_peptide KF018211_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF061167_HBx_P-D Product feature CHAIN KF061167_HBx_P-D of FT:mat_peptide KF061167_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_1a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLXKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHNWVCAPAPCNFFTSA
>gnl|hbvpro|KF061168_HBx_P-D Product feature CHAIN KF061168_HBx_P-D of FT:mat_peptide KF061168_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_3a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLXKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHNWVCAPAPCNFFTSA
>gnl|hbvpro|KF061169_HBx_P-D Product feature CHAIN KF061169_HBx_P-D of FT:mat_peptide KF061169_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_7a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLXKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHNWVCAPAPCNFFTSA
>gnl|hbvpro|KF061170_HBx_P-D Product feature CHAIN KF061170_HBx_P-D of FT:mat_peptide KF061170_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_13a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLXKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF170739_HBx_P-D Product feature CHAIN KF170739_HBx_P-D of FT:mat_peptide KF170739_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_024). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKEWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192830_HBx_P-D Product feature CHAIN KF192830_HBx_P-D of FT:mat_peptide KF192830_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP71). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192831_HBx_P-D Product feature CHAIN KF192831_HBx_P-D of FT:mat_peptide KF192831_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP59). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192832_HBx_P-D Product feature CHAIN KF192832_HBx_P-D of FT:mat_peptide KF192832_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP67). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF192834_HBx_P-D Product feature CHAIN KF192834_HBx_P-D of FT:mat_peptide KF192834_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP63). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471640_HBx_P-D Product feature CHAIN KF471640_HBx_P-D of FT:mat_peptide KF471640_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-86). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471641_HBx_P-D Product feature CHAIN KF471641_HBx_P-D of FT:mat_peptide KF471641_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-66). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLEVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471642_HBx_P-D Product feature CHAIN KF471642_HBx_P-D of FT:mat_peptide KF471642_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-65). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKNWEELGEEIRLKLFVLGGCRHKLVCAPASYDFFTSA
>gnl|hbvpro|KF471644_HBx_P-D Product feature CHAIN KF471644_HBx_P-D of FT:mat_peptide KF471644_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-52). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|KF471645_HBx_P-D Product feature CHAIN KF471645_HBx_P-D of FT:mat_peptide KF471645_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-50). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTMNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471646_HBx_P-D Product feature CHAIN KF471646_HBx_P-D of FT:mat_peptide KF471646_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCALLSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471647_HBx_P-D Product feature CHAIN KF471647_HBx_P-D of FT:mat_peptide KF471647_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471649_HBx_P-D Product feature CHAIN KF471649_HBx_P-D of FT:mat_peptide KF471649_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-31). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471650_HBx_P-D Product feature CHAIN KF471650_HBx_P-D of FT:mat_peptide KF471650_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471653_HBx_P-D Product feature CHAIN KF471653_HBx_P-D of FT:mat_peptide KF471653_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-18). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTAAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471654_HBx_P-D Product feature CHAIN KF471654_HBx_P-D of FT:mat_peptide KF471654_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471655_HBx_P-D Product feature CHAIN KF471655_HBx_P-D of FT:mat_peptide KF471655_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|KF471656_HBx_P-D Product feature CHAIN KF471656_HBx_P-D of FT:mat_peptide KF471656_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-8). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471657_HBx_P-D Product feature CHAIN KF471657_HBx_P-D of FT:mat_peptide KF471657_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471658_HBx_P-D Product feature CHAIN KF471658_HBx_P-D of FT:mat_peptide KF471658_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG_4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEEWGEEFRLMCFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471659_HBx_P-D Product feature CHAIN KF471659_HBx_P-D of FT:mat_peptide KF471659_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF471660_HBx_P-D Product feature CHAIN KF471660_HBx_P-D of FT:mat_peptide KF471660_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTGLEAYFKDCLLKDWEELGEESRLCLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF584160_HBx_P-D Product feature CHAIN KF584160_HBx_P-D of FT:mat_peptide KF584160_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF584161_HBx_P-D Product feature CHAIN KF584161_HBx_P-D of FT:mat_peptide KF584161_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF584162_HBx_P-D Product feature CHAIN KF584162_HBx_P-D of FT:mat_peptide KF584162_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF584163_HBx_P-D Product feature CHAIN KF584163_HBx_P-D of FT:mat_peptide KF584163_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2a). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF584164_HBx_P-D Product feature CHAIN KF584164_HBx_P-D of FT:mat_peptide KF584164_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2b). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF584165_HBx_P-D Product feature CHAIN KF584165_HBx_P-D of FT:mat_peptide KF584165_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Da). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF584166_HBx_P-D Product feature CHAIN KF584166_HBx_P-D of FT:mat_peptide KF584166_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Db). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679989_HBx_P-D Product feature CHAIN KF679989_HBx_P-D of FT:mat_peptide KF679989_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679990_HBx_P-D Product feature CHAIN KF679990_HBx_P-D of FT:mat_peptide KF679990_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-57). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSFGTLTSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679992_HBx_P-D Product feature CHAIN KF679992_HBx_P-D of FT:mat_peptide KF679992_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-75). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679993_HBx_P-D Product feature CHAIN KF679993_HBx_P-D of FT:mat_peptide KF679993_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-76). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679994_HBx_P-D Product feature CHAIN KF679994_HBx_P-D of FT:mat_peptide KF679994_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679995_HBx_P-D Product feature CHAIN KF679995_HBx_P-D of FT:mat_peptide KF679995_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679996_HBx_P-D Product feature CHAIN KF679996_HBx_P-D of FT:mat_peptide KF679996_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-51). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679997_HBx_P-D Product feature CHAIN KF679997_HBx_P-D of FT:mat_peptide KF679997_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-56). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF679998_HBx_P-D Product feature CHAIN KF679998_HBx_P-D of FT:mat_peptide KF679998_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-63). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KF922432_HBx_P-D Product feature CHAIN KF922432_HBx_P-D of FT:mat_peptide KF922432_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate N011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ470885_HBx_P-D Product feature CHAIN KJ470885_HBx_P-D of FT:mat_peptide KJ470885_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8136). Partial genome (Contains: HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPGNFFTSA
>gnl|hbvpro|KJ470889_HBx_P-D Product feature CHAIN KJ470889_HBx_P-D of FT:mat_peptide KJ470889_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8034). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPGNFFTSA
>gnl|hbvpro|KJ470893_HBx_P-D Product feature CHAIN KJ470893_HBx_P-D of FT:mat_peptide KJ470893_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8118). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQSLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ470894_HBx_P-D Product feature CHAIN KJ470894_HBx_P-D of FT:mat_peptide KJ470894_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8066). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTLA
>gnl|hbvpro|KJ470895_HBx_P-D Product feature CHAIN KJ470895_HBx_P-D of FT:mat_peptide KJ470895_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8120). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTLA
>gnl|hbvpro|KJ470896_HBx_P-D Product feature CHAIN KJ470896_HBx_P-D of FT:mat_peptide KJ470896_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ647350_HBx_P-D Product feature CHAIN KJ647350_HBx_P-D of FT:mat_peptide KJ647350_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV197). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ647352_HBx_P-D Product feature CHAIN KJ647352_HBx_P-D of FT:mat_peptide KJ647352_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV219). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ647353_HBx_P-D Product feature CHAIN KJ647353_HBx_P-D of FT:mat_peptide KJ647353_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV230). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSRSLGTLSSPSPSAVPXDHGAHLSLRGLPVCAFSSAGPCALRFTSARXME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ647355_HBx_P-D Product feature CHAIN KJ647355_HBx_P-D of FT:mat_peptide KJ647355_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV247). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQILPKVLHKRTLDLFAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ843187_HBx_P-D Product feature CHAIN KJ843187_HBx_P-D of FT:mat_peptide KJ843187_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ag26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KJ997852_HBx_P-D Product feature CHAIN KJ997852_HBx_P-D of FT:mat_peptide KJ997852_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHRLVCAPAPCNFFTSA
>gnl|hbvpro|KJ997853_HBx_P-D Product feature CHAIN KJ997853_HBx_P-D of FT:mat_peptide KJ997853_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHRLVCAPAPCNFFTSA
>gnl|hbvpro|KJ997854_HBx_P-D Product feature CHAIN KJ997854_HBx_P-D of FT:mat_peptide KJ997854_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHRLVCAPAPCNFFTSA
>gnl|hbvpro|KJ997855_HBx_P-D Product feature CHAIN KJ997855_HBx_P-D of FT:mat_peptide KJ997855_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHRLVCAPAPCNFFTSA
>gnl|hbvpro|KJ997857_HBx_P-D Product feature CHAIN KJ997857_HBx_P-D of FT:mat_peptide KJ997857_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHRLVCAPAPCNFFTSA
>gnl|hbvpro|KJ997858_HBx_P-D Product feature CHAIN KJ997858_HBx_P-D of FT:mat_peptide KJ997858_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHRLVCAPAPCNFFTSA
>gnl|hbvpro|KJ997859_HBx_P-D Product feature CHAIN KJ997859_HBx_P-D of FT:mat_peptide KJ997859_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHRLVCAPAPCNFFTSA
>gnl|hbvpro|KJ997860_HBx_P-D Product feature CHAIN KJ997860_HBx_P-D of FT:mat_peptide KJ997860_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAFFKDCLFRDWEELGEEIRLKVFVLGGCRHRLVCAPAPCNFFTSA
>gnl|hbvpro|KJ997861_HBx_P-D Product feature CHAIN KJ997861_HBx_P-D of FT:mat_peptide KJ997861_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGVSVMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHRLVCAPAPCNFFTSA
>gnl|hbvpro|KM519455_HBx_P-D Product feature CHAIN KM519455_HBx_P-D of FT:mat_peptide KM519455_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_WT_SA). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDRLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524338_HBx_P-D Product feature CHAIN KM524338_HBx_P-D of FT:mat_peptide KM524338_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV136_EP-CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524339_HBx_P-D Product feature CHAIN KM524339_HBx_P-D of FT:mat_peptide KM524339_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV064_EP-CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAISSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524340_HBx_P-D Product feature CHAIN KM524340_HBx_P-D of FT:mat_peptide KM524340_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV094_EP-CHB). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524341_HBx_P-D Product feature CHAIN KM524341_HBx_P-D of FT:mat_peptide KM524341_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV128_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHNRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524342_HBx_P-D Product feature CHAIN KM524342_HBx_P-D of FT:mat_peptide KM524342_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DR003_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524344_HBx_P-D Product feature CHAIN KM524344_HBx_P-D of FT:mat_peptide KM524344_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK070_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524345_HBx_P-D Product feature CHAIN KM524345_HBx_P-D of FT:mat_peptide KM524345_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK082_EP-CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524346_HBx_P-D Product feature CHAIN KM524346_HBx_P-D of FT:mat_peptide KM524346_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK096_EP-CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524347_HBx_P-D Product feature CHAIN KM524347_HBx_P-D of FT:mat_peptide KM524347_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK102_EP-CHB). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524348_HBx_P-D Product feature CHAIN KM524348_HBx_P-D of FT:mat_peptide KM524348_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK129_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524349_HBx_P-D Product feature CHAIN KM524349_HBx_P-D of FT:mat_peptide KM524349_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-015_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524351_HBx_P-D Product feature CHAIN KM524351_HBx_P-D of FT:mat_peptide KM524351_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-020_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524352_HBx_P-D Product feature CHAIN KM524352_HBx_P-D of FT:mat_peptide KM524352_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-025_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524353_HBx_P-D Product feature CHAIN KM524353_HBx_P-D of FT:mat_peptide KM524353_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-031_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524354_HBx_P-D Product feature CHAIN KM524354_HBx_P-D of FT:mat_peptide KM524354_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-058_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524355_HBx_P-D Product feature CHAIN KM524355_HBx_P-D of FT:mat_peptide KM524355_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-092_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524356_HBx_P-D Product feature CHAIN KM524356_HBx_P-D of FT:mat_peptide KM524356_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-123_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTFSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM524358_HBx_P-D Product feature CHAIN KM524358_HBx_P-D of FT:mat_peptide KM524358_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV.I-057_HIV-HBV). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM577668_HBx_P-D Product feature CHAIN KM577668_HBx_P-D of FT:mat_peptide KM577668_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDTARDVLCLRPVSAESRGRPVSGPLGTLASPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM577669_HBx_P-D Product feature CHAIN KM577669_HBx_P-D of FT:mat_peptide KM577669_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLASPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM577670_HBx_P-D Product feature CHAIN KM577670_HBx_P-D of FT:mat_peptide KM577670_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLASPSPSAVSTDHGAHLSLRGLPVCTFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606744_HBx_P-D Product feature CHAIN KM606744_HBx_P-D of FT:mat_peptide KM606744_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba9). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606745_HBx_P-D Product feature CHAIN KM606745_HBx_P-D of FT:mat_peptide KM606745_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESSGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606752_HBx_P-D Product feature CHAIN KM606752_HBx_P-D of FT:mat_peptide KM606752_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba100). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLRGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606753_HBx_P-D Product feature CHAIN KM606753_HBx_P-D of FT:mat_peptide KM606753_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606754_HBx_P-D Product feature CHAIN KM606754_HBx_P-D of FT:mat_peptide KM606754_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba120). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLRGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KM606755_HBx_P-D Product feature CHAIN KM606755_HBx_P-D of FT:mat_peptide KM606755_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba139). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP090177_HBx_P-D Product feature CHAIN KP090177_HBx_P-D of FT:mat_peptide KP090177_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP090178_HBx_P-D Product feature CHAIN KP090178_HBx_P-D of FT:mat_peptide KP090178_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP090179_HBx_P-D Product feature CHAIN KP090179_HBx_P-D of FT:mat_peptide KP090179_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR6). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTAHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP090180_HBx_P-D Product feature CHAIN KP090180_HBx_P-D of FT:mat_peptide KP090180_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP090181_HBx_P-D Product feature CHAIN KP090181_HBx_P-D of FT:mat_peptide KP090181_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR40). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP168419_HBx_P-D Product feature CHAIN KP168419_HBx_P-D of FT:mat_peptide KP168419_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KN109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPLGTLPSPSTPPVSPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP317981_HBx_P-D Product feature CHAIN KP317981_HBx_P-D of FT:mat_peptide KP317981_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2X[RAMEZANI]). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPASCNFFTSA
>gnl|hbvpro|KP317982_HBx_P-D Product feature CHAIN KP317982_HBx_P-D of FT:mat_peptide KP317982_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 11X[RAMEZANI]). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP317983_HBx_P-D Product feature CHAIN KP317983_HBx_P-D of FT:mat_peptide KP317983_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 12X[RAMEZANI]). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLNPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP322599_HBx_P-D Product feature CHAIN KP322599_HBx_P-D of FT:mat_peptide KP322599_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2811). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP322600_HBx_P-D Product feature CHAIN KP322600_HBx_P-D of FT:mat_peptide KP322600_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2812). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP322601_HBx_P-D Product feature CHAIN KP322601_HBx_P-D of FT:mat_peptide KP322601_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2813). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KP995100_HBx_P-D Product feature CHAIN KP995100_HBx_P-D of FT:mat_peptide KP995100_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 49-Cirrhosis). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR811561_HBx_P-D Product feature CHAIN KR811561_HBx_P-D of FT:mat_peptide KR811561_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 94NT). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=152 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETXLMIFVLGGCRHKLVCAPPPCNFLK
>gnl|hbvpro|KR905423_HBx_P-D Product feature CHAIN KR905423_HBx_P-D of FT:mat_peptide KR905423_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KR905424_HBx_P-D Product feature CHAIN KR905424_HBx_P-D of FT:mat_peptide KR905424_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT151620_HBx_P-D Product feature CHAIN KT151620_HBx_P-D of FT:mat_peptide KT151620_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHXFLPKVLHKRTLGLSXMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCXFFTSA
>gnl|hbvpro|KT235615_HBx_P-D Product feature CHAIN KT235615_HBx_P-D of FT:mat_peptide KT235615_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-07149). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235619_HBx_P-D Product feature CHAIN KT235619_HBx_P-D of FT:mat_peptide KT235619_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-09014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235620_HBx_P-D Product feature CHAIN KT235620_HBx_P-D of FT:mat_peptide KT235620_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-09024). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235621_HBx_P-D Product feature CHAIN KT235621_HBx_P-D of FT:mat_peptide KT235621_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-09059). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235623_HBx_P-D Product feature CHAIN KT235623_HBx_P-D of FT:mat_peptide KT235623_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-09079). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235624_HBx_P-D Product feature CHAIN KT235624_HBx_P-D of FT:mat_peptide KT235624_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-1037). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235626_HBx_P-D Product feature CHAIN KT235626_HBx_P-D of FT:mat_peptide KT235626_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-1069). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235629_HBx_P-D Product feature CHAIN KT235629_HBx_P-D of FT:mat_peptide KT235629_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-1120). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235630_HBx_P-D Product feature CHAIN KT235630_HBx_P-D of FT:mat_peptide KT235630_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-1135). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAFFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235631_HBx_P-D Product feature CHAIN KT235631_HBx_P-D of FT:mat_peptide KT235631_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-1292). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235632_HBx_P-D Product feature CHAIN KT235632_HBx_P-D of FT:mat_peptide KT235632_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-12106). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAFFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT235637_HBx_P-D Product feature CHAIN KT235637_HBx_P-D of FT:mat_peptide KT235637_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AEI-09068). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT347090_HBx_P-D Product feature CHAIN KT347090_HBx_P-D of FT:mat_peptide KT347090_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGMTMG). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGACRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366465_HBx_P-D Product feature CHAIN KT366465_HBx_P-D of FT:mat_peptide KT366465_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.49). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366491_HBx_P-D Product feature CHAIN KT366491_HBx_P-D of FT:mat_peptide KT366491_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSVVSSDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366493_HBx_P-D Product feature CHAIN KT366493_HBx_P-D of FT:mat_peptide KT366493_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.41). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366494_HBx_P-D Product feature CHAIN KT366494_HBx_P-D of FT:mat_peptide KT366494_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.42). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366495_HBx_P-D Product feature CHAIN KT366495_HBx_P-D of FT:mat_peptide KT366495_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.45). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366496_HBx_P-D Product feature CHAIN KT366496_HBx_P-D of FT:mat_peptide KT366496_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.46). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366497_HBx_P-D Product feature CHAIN KT366497_HBx_P-D of FT:mat_peptide KT366497_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.48). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366498_HBx_P-D Product feature CHAIN KT366498_HBx_P-D of FT:mat_peptide KT366498_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.7). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAFFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366499_HBx_P-D Product feature CHAIN KT366499_HBx_P-D of FT:mat_peptide KT366499_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.11). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSHSTSALSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366500_HBx_P-D Product feature CHAIN KT366500_HBx_P-D of FT:mat_peptide KT366500_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAFFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366501_HBx_P-D Product feature CHAIN KT366501_HBx_P-D of FT:mat_peptide KT366501_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAFFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366502_HBx_P-D Product feature CHAIN KT366502_HBx_P-D of FT:mat_peptide KT366502_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAFFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366506_HBx_P-D Product feature CHAIN KT366506_HBx_P-D of FT:mat_peptide KT366506_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366507_HBx_P-D Product feature CHAIN KT366507_HBx_P-D of FT:mat_peptide KT366507_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.24). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366508_HBx_P-D Product feature CHAIN KT366508_HBx_P-D of FT:mat_peptide KT366508_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.25). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDVSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366509_HBx_P-D Product feature CHAIN KT366509_HBx_P-D of FT:mat_peptide KT366509_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.26). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366510_HBx_P-D Product feature CHAIN KT366510_HBx_P-D of FT:mat_peptide KT366510_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.36). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT366511_HBx_P-D Product feature CHAIN KT366511_HBx_P-D of FT:mat_peptide KT366511_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.37). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749821_HBx_P-D Product feature CHAIN KT749821_HBx_P-D of FT:mat_peptide KT749821_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749823_HBx_P-D Product feature CHAIN KT749823_HBx_P-D of FT:mat_peptide KT749823_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL3). Non-functional genomic sequence. [Hepadnaviridae] (length=155 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSAARRM
ETTVNAHTFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKMVCAPAPCNFFTSA
>gnl|hbvpro|KT749827_HBx_P-D Product feature CHAIN KT749827_HBx_P-D of FT:mat_peptide KT749827_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749828_HBx_P-D Product feature CHAIN KT749828_HBx_P-D of FT:mat_peptide KT749828_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL13). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARSME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KT749845_HBx_P-D Product feature CHAIN KT749845_HBx_P-D of FT:mat_peptide KT749845_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL24). Partial genome (Contains: HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRITSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|KT963508_HBx_P-D Product feature CHAIN KT963508_HBx_P-D of FT:mat_peptide KT963508_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARMCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRSLPKVLHKRTLGLSVMSTSDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668433_HBx_P-D Product feature CHAIN KU668433_HBx_P-D of FT:mat_peptide KU668433_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV071). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668434_HBx_P-D Product feature CHAIN KU668434_HBx_P-D of FT:mat_peptide KU668434_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV072). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIGLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668435_HBx_P-D Product feature CHAIN KU668435_HBx_P-D of FT:mat_peptide KU668435_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668436_HBx_P-D Product feature CHAIN KU668436_HBx_P-D of FT:mat_peptide KU668436_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFQQD
>gnl|hbvpro|KU668437_HBx_P-D Product feature CHAIN KU668437_HBx_P-D of FT:mat_peptide KU668437_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV108). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668439_HBx_P-D Product feature CHAIN KU668439_HBx_P-D of FT:mat_peptide KU668439_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV124). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHEILPKILHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668441_HBx_P-D Product feature CHAIN KU668441_HBx_P-D of FT:mat_peptide KU668441_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV170). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668442_HBx_P-D Product feature CHAIN KU668442_HBx_P-D of FT:mat_peptide KU668442_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV175). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668444_HBx_P-D Product feature CHAIN KU668444_HBx_P-D of FT:mat_peptide KU668444_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV180). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668445_HBx_P-D Product feature CHAIN KU668445_HBx_P-D of FT:mat_peptide KU668445_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV181). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668446_HBx_P-D Product feature CHAIN KU668446_HBx_P-D of FT:mat_peptide KU668446_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV183). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668447_HBx_P-D Product feature CHAIN KU668447_HBx_P-D of FT:mat_peptide KU668447_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV191). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668448_HBx_P-D Product feature CHAIN KU668448_HBx_P-D of FT:mat_peptide KU668448_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV192). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSAMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU668449_HBx_P-D Product feature CHAIN KU668449_HBx_P-D of FT:mat_peptide KU668449_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV207). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLASPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736924_HBx_P-D Product feature CHAIN KU736924_HBx_P-D of FT:mat_peptide KU736924_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KU736925_HBx_P-D Product feature CHAIN KU736925_HBx_P-D of FT:mat_peptide KU736925_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_15). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|KU736926_HBx_P-D Product feature CHAIN KU736926_HBx_P-D of FT:mat_peptide KU736926_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_18). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KU736927_HBx_P-D Product feature CHAIN KU736927_HBx_P-D of FT:mat_peptide KU736927_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_20). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196208_HBx_P-D Product feature CHAIN KX196208_HBx_P-D of FT:mat_peptide KX196208_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL093). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196209_HBx_P-D Product feature CHAIN KX196209_HBx_P-D of FT:mat_peptide KX196209_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL094). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196210_HBx_P-D Product feature CHAIN KX196210_HBx_P-D of FT:mat_peptide KX196210_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL095). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLDAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196211_HBx_P-D Product feature CHAIN KX196211_HBx_P-D of FT:mat_peptide KX196211_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL096). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196212_HBx_P-D Product feature CHAIN KX196212_HBx_P-D of FT:mat_peptide KX196212_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL097). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196213_HBx_P-D Product feature CHAIN KX196213_HBx_P-D of FT:mat_peptide KX196213_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL098). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLDAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196214_HBx_P-D Product feature CHAIN KX196214_HBx_P-D of FT:mat_peptide KX196214_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL099). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSMTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196215_HBx_P-D Product feature CHAIN KX196215_HBx_P-D of FT:mat_peptide KX196215_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0100). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196216_HBx_P-D Product feature CHAIN KX196216_HBx_P-D of FT:mat_peptide KX196216_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0101). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196217_HBx_P-D Product feature CHAIN KX196217_HBx_P-D of FT:mat_peptide KX196217_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0102). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196218_HBx_P-D Product feature CHAIN KX196218_HBx_P-D of FT:mat_peptide KX196218_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0103). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196219_HBx_P-D Product feature CHAIN KX196219_HBx_P-D of FT:mat_peptide KX196219_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0104). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196220_HBx_P-D Product feature CHAIN KX196220_HBx_P-D of FT:mat_peptide KX196220_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0105). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196221_HBx_P-D Product feature CHAIN KX196221_HBx_P-D of FT:mat_peptide KX196221_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0106). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196222_HBx_P-D Product feature CHAIN KX196222_HBx_P-D of FT:mat_peptide KX196222_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0107). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196224_HBx_P-D Product feature CHAIN KX196224_HBx_P-D of FT:mat_peptide KX196224_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0109). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196225_HBx_P-D Product feature CHAIN KX196225_HBx_P-D of FT:mat_peptide KX196225_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0110). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196226_HBx_P-D Product feature CHAIN KX196226_HBx_P-D of FT:mat_peptide KX196226_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0111). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196227_HBx_P-D Product feature CHAIN KX196227_HBx_P-D of FT:mat_peptide KX196227_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0112). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196228_HBx_P-D Product feature CHAIN KX196228_HBx_P-D of FT:mat_peptide KX196228_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0113). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196229_HBx_P-D Product feature CHAIN KX196229_HBx_P-D of FT:mat_peptide KX196229_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHEILPKILYKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|KX196230_HBx_P-D Product feature CHAIN KX196230_HBx_P-D of FT:mat_peptide KX196230_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0115). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196231_HBx_P-D Product feature CHAIN KX196231_HBx_P-D of FT:mat_peptide KX196231_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196232_HBx_P-D Product feature CHAIN KX196232_HBx_P-D of FT:mat_peptide KX196232_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0117). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196233_HBx_P-D Product feature CHAIN KX196233_HBx_P-D of FT:mat_peptide KX196233_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0118). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196234_HBx_P-D Product feature CHAIN KX196234_HBx_P-D of FT:mat_peptide KX196234_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0119). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196235_HBx_P-D Product feature CHAIN KX196235_HBx_P-D of FT:mat_peptide KX196235_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0120). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQILPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX196236_HBx_P-D Product feature CHAIN KX196236_HBx_P-D of FT:mat_peptide KX196236_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0121). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX260231_HBx_P-D Product feature CHAIN KX260231_HBx_P-D of FT:mat_peptide KX260231_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR-32). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX276856_HBx_P-D Product feature CHAIN KX276856_HBx_P-D of FT:mat_peptide KX276856_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLYKRTLGLSVVSTTDLEAYFKDCLFKDWEELGEEIRLKVXVLGGCRHKLVCAPAPCNFFXSA
>gnl|hbvpro|KX276857_HBx_P-D Product feature CHAIN KX276857_HBx_P-D of FT:mat_peptide KX276857_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHXLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKEWEELGEEIRLXXFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357622_HBx_P-D Product feature CHAIN KX357622_HBx_P-D of FT:mat_peptide KX357622_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GD104ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSAVSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357637_HBx_P-D Product feature CHAIN KX357637_HBx_P-D of FT:mat_peptide KX357637_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK20ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357638_HBx_P-D Product feature CHAIN KX357638_HBx_P-D of FT:mat_peptide KX357638_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AA95ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX357639_HBx_P-D Product feature CHAIN KX357639_HBx_P-D of FT:mat_peptide KX357639_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GD82ETH). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTHSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423692_HBx_P-D Product feature CHAIN KX423692_HBx_P-D of FT:mat_peptide KX423692_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1/Human/IND/Kerala-15HB04/2015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|KX423693_HBx_P-D Product feature CHAIN KX423693_HBx_P-D of FT:mat_peptide KX423693_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-15HB07/2015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423695_HBx_P-D Product feature CHAIN KX423695_HBx_P-D of FT:mat_peptide KX423695_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-15HB15/2015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVXSTTDLEAYFKDXLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423696_HBx_P-D Product feature CHAIN KX423696_HBx_P-D of FT:mat_peptide KX423696_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-15HB17/2015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFXLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423698_HBx_P-D Product feature CHAIN KX423698_HBx_P-D of FT:mat_peptide KX423698_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-15HB45/2015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423702_HBx_P-D Product feature CHAIN KX423702_HBx_P-D of FT:mat_peptide KX423702_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-15HB95/2015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423706_HBx_P-D Product feature CHAIN KX423706_HBx_P-D of FT:mat_peptide KX423706_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D5/Human/IND/Kerala-14HB17/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKILHKRTLGLSTLSTTDLEQYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423707_HBx_P-D Product feature CHAIN KX423707_HBx_P-D of FT:mat_peptide KX423707_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D5/Human/IND/Kerala-14HB18/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKILHKRTLGLSTLSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423710_HBx_P-D Product feature CHAIN KX423710_HBx_P-D of FT:mat_peptide KX423710_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-14HB40/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPFGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423711_HBx_P-D Product feature CHAIN KX423711_HBx_P-D of FT:mat_peptide KX423711_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1/Human/IND/Kerala-14HB46/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLFVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423713_HBx_P-D Product feature CHAIN KX423713_HBx_P-D of FT:mat_peptide KX423713_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1/Human/IND/Kerala-14HB58/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423715_HBx_P-D Product feature CHAIN KX423715_HBx_P-D of FT:mat_peptide KX423715_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-14HB81/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423717_HBx_P-D Product feature CHAIN KX423717_HBx_P-D of FT:mat_peptide KX423717_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-14HB101/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423718_HBx_P-D Product feature CHAIN KX423718_HBx_P-D of FT:mat_peptide KX423718_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-14HB15/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423719_HBx_P-D Product feature CHAIN KX423719_HBx_P-D of FT:mat_peptide KX423719_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-14HB20/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPFGSLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423721_HBx_P-D Product feature CHAIN KX423721_HBx_P-D of FT:mat_peptide KX423721_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D/Human/IND/Kerala-14HB24/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423722_HBx_P-D Product feature CHAIN KX423722_HBx_P-D of FT:mat_peptide KX423722_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D5/Human/IND/Kerala-15HB22/2015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKILHKRTLGLSTLSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX423723_HBx_P-D Product feature CHAIN KX423723_HBx_P-D of FT:mat_peptide KX423723_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2/Human/IND/Kerala-15HB27/2015). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX712265_HBx_P-D Product feature CHAIN KX712265_HBx_P-D of FT:mat_peptide KX712265_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D/Human/IND/Kerala-14HB73/2014). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827290_HBx_P-D Product feature CHAIN KX827290_HBx_P-D of FT:mat_peptide KX827290_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno1.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSTVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827291_HBx_P-D Product feature CHAIN KX827291_HBx_P-D of FT:mat_peptide KX827291_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno2.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827292_HBx_P-D Product feature CHAIN KX827292_HBx_P-D of FT:mat_peptide KX827292_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno3.1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRMLPKVLHKRTLGLSAMSATDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827300_HBx_P-D Product feature CHAIN KX827300_HBx_P-D of FT:mat_peptide KX827300_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno21.2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRVE
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFALGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KX827301_HBx_P-D Product feature CHAIN KX827301_HBx_P-D of FT:mat_peptide KX827301_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno30.4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY382412_HBx_P-D Product feature CHAIN KY382412_HBx_P-D of FT:mat_peptide KY382412_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1_1896). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY382414_HBx_P-D Product feature CHAIN KY382414_HBx_P-D of FT:mat_peptide KY382414_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1_wt). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY629630_HBx_P-D Product feature CHAIN KY629630_HBx_P-D of FT:mat_peptide KY629630_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TYM13097). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY629633_HBx_P-D Product feature CHAIN KY629633_HBx_P-D of FT:mat_peptide KY629633_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KLMY14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKXFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|KY629634_HBx_P-D Product feature CHAIN KY629634_HBx_P-D of FT:mat_peptide KY629634_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KLMY16). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGDEIRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|L27106_HBx_P-D Product feature CHAIN L27106_HBx_P-D of FT:mat_peptide L27106_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=155 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAAHLFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEDNRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LC365689_HBx_P-D Product feature CHAIN LC365689_HBx_P-D of FT:mat_peptide LC365689_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HB17-0791). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHGAHLSLRGLPVCAYSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|LT992454_HBx_P-D Product feature CHAIN LT992454_HBx_P-D of FT:mat_peptide LT992454_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA222). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|M32138_HBx_P-D Product feature CHAIN M32138_HBx_P-D of FT:mat_peptide M32138_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-21). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115851_HBx_P-D Product feature CHAIN MF115851_HBx_P-D of FT:mat_peptide MF115851_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM55). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115857_HBx_P-D Product feature CHAIN MF115857_HBx_P-D of FT:mat_peptide MF115857_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM19). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLPLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115865_HBx_P-D Product feature CHAIN MF115865_HBx_P-D of FT:mat_peptide MF115865_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM19c1). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAGRLCCQLDPARGVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLPLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115866_HBx_P-D Product feature CHAIN MF115866_HBx_P-D of FT:mat_peptide MF115866_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM19c2). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115867_HBx_P-D Product feature CHAIN MF115867_HBx_P-D of FT:mat_peptide MF115867_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM19c3). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAGRLCCQLDPARGVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGARLPLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLLTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115868_HBx_P-D Product feature CHAIN MF115868_HBx_P-D of FT:mat_peptide MF115868_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM25c1). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115869_HBx_P-D Product feature CHAIN MF115869_HBx_P-D of FT:mat_peptide MF115869_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM25c2). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPYALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115870_HBx_P-D Product feature CHAIN MF115870_HBx_P-D of FT:mat_peptide MF115870_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM25c3). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115923_HBx_P-D Product feature CHAIN MF115923_HBx_P-D of FT:mat_peptide MF115923_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM289c1). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFSPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF115924_HBx_P-D Product feature CHAIN MF115924_HBx_P-D of FT:mat_peptide MF115924_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM289c2). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=156 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLPLRGLPVCAFSSAGPCALRFTSARRMG
METTVNARQFLPKVLYKRTLGLSVMSTIDLEAYFKDCLFTNWEELGEENGLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF488704_HBx_P-D Product feature CHAIN MF488704_HBx_P-D of FT:mat_peptide MF488704_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-PCP229). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF618339_HBx_P-D Product feature CHAIN MF618339_HBx_P-D of FT:mat_peptide MF618339_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV006). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF618341_HBx_P-D Product feature CHAIN MF618341_HBx_P-D of FT:mat_peptide MF618341_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV011). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTANAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF618342_HBx_P-D Product feature CHAIN MF618342_HBx_P-D of FT:mat_peptide MF618342_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV053). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF618343_HBx_P-D Product feature CHAIN MF618343_HBx_P-D of FT:mat_peptide MF618343_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV054). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPRNFFTSA
>gnl|hbvpro|MF618349_HBx_P-D Product feature CHAIN MF618349_HBx_P-D of FT:mat_peptide MF618349_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV165). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHRILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925358_HBx_P-D Product feature CHAIN MF925358_HBx_P-D of FT:mat_peptide MF925358_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV01). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF925363_HBx_P-D Product feature CHAIN MF925363_HBx_P-D of FT:mat_peptide MF925363_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV07). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF925364_HBx_P-D Product feature CHAIN MF925364_HBx_P-D of FT:mat_peptide MF925364_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV08). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF925366_HBx_P-D Product feature CHAIN MF925366_HBx_P-D of FT:mat_peptide MF925366_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV10). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCRRLEAARDVLCLRPVGAESRGRPLPGPLGALPSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQVLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925379_HBx_P-D Product feature CHAIN MF925379_HBx_P-D of FT:mat_peptide MF925379_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV23). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLFCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPTVHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MF925383_HBx_P-D Product feature CHAIN MF925383_HBx_P-D of FT:mat_peptide MF925383_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV27). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|MF925390_HBx_P-D Product feature CHAIN MF925390_HBx_P-D of FT:mat_peptide MF925390_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV34). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF925391_HBx_P-D Product feature CHAIN MF925391_HBx_P-D of FT:mat_peptide MF925391_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV35). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MF925393_HBx_P-D Product feature CHAIN MF925393_HBx_P-D of FT:mat_peptide MF925393_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV38). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776378_HBx_P-D Product feature CHAIN MG776378_HBx_P-D of FT:mat_peptide MG776378_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-3). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHLCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|MG776379_HBx_P-D Product feature CHAIN MG776379_HBx_P-D of FT:mat_peptide MG776379_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-4). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|MG776382_HBx_P-D Product feature CHAIN MG776382_HBx_P-D of FT:mat_peptide MG776382_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-9). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776383_HBx_P-D Product feature CHAIN MG776383_HBx_P-D of FT:mat_peptide MG776383_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-10). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776384_HBx_P-D Product feature CHAIN MG776384_HBx_P-D of FT:mat_peptide MG776384_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-11). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776386_HBx_P-D Product feature CHAIN MG776386_HBx_P-D of FT:mat_peptide MG776386_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-13). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCYFFTSA
>gnl|hbvpro|MG776387_HBx_P-D Product feature CHAIN MG776387_HBx_P-D of FT:mat_peptide MG776387_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-16). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVTAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776389_HBx_P-D Product feature CHAIN MG776389_HBx_P-D of FT:mat_peptide MG776389_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-18). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALASPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776390_HBx_P-D Product feature CHAIN MG776390_HBx_P-D of FT:mat_peptide MG776390_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-19). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776391_HBx_P-D Product feature CHAIN MG776391_HBx_P-D of FT:mat_peptide MG776391_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-20). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776392_HBx_P-D Product feature CHAIN MG776392_HBx_P-D of FT:mat_peptide MG776392_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-21). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPFAGPLGTFSSPSPSAVSTDHGAHLSLRELPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776393_HBx_P-D Product feature CHAIN MG776393_HBx_P-D of FT:mat_peptide MG776393_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-22). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776394_HBx_P-D Product feature CHAIN MG776394_HBx_P-D of FT:mat_peptide MG776394_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-23). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776395_HBx_P-D Product feature CHAIN MG776395_HBx_P-D of FT:mat_peptide MG776395_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-24). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776396_HBx_P-D Product feature CHAIN MG776396_HBx_P-D of FT:mat_peptide MG776396_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-25). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776397_HBx_P-D Product feature CHAIN MG776397_HBx_P-D of FT:mat_peptide MG776397_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-28). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLGPARDVLCLRPVSAESRGRPFSGPLGTLPSPAASAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEVRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|MG776398_HBx_P-D Product feature CHAIN MG776398_HBx_P-D of FT:mat_peptide MG776398_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-30). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMG
TTVNAHLCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776399_HBx_P-D Product feature CHAIN MG776399_HBx_P-D of FT:mat_peptide MG776399_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-32). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776400_HBx_P-D Product feature CHAIN MG776400_HBx_P-D of FT:mat_peptide MG776400_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-33). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776401_HBx_P-D Product feature CHAIN MG776401_HBx_P-D of FT:mat_peptide MG776401_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-34). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776402_HBx_P-D Product feature CHAIN MG776402_HBx_P-D of FT:mat_peptide MG776402_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-35). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTFA
>gnl|hbvpro|MG776404_HBx_P-D Product feature CHAIN MG776404_HBx_P-D of FT:mat_peptide MG776404_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-38). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776405_HBx_P-D Product feature CHAIN MG776405_HBx_P-D of FT:mat_peptide MG776405_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-39). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776406_HBx_P-D Product feature CHAIN MG776406_HBx_P-D of FT:mat_peptide MG776406_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-40). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776407_HBx_P-D Product feature CHAIN MG776407_HBx_P-D of FT:mat_peptide MG776407_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-41). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776409_HBx_P-D Product feature CHAIN MG776409_HBx_P-D of FT:mat_peptide MG776409_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-45). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776410_HBx_P-D Product feature CHAIN MG776410_HBx_P-D of FT:mat_peptide MG776410_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-47). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776411_HBx_P-D Product feature CHAIN MG776411_HBx_P-D of FT:mat_peptide MG776411_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-48). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776412_HBx_P-D Product feature CHAIN MG776412_HBx_P-D of FT:mat_peptide MG776412_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-52). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAISTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776415_HBx_P-D Product feature CHAIN MG776415_HBx_P-D of FT:mat_peptide MG776415_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-59). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCKFFTSA
>gnl|hbvpro|MG776416_HBx_P-D Product feature CHAIN MG776416_HBx_P-D of FT:mat_peptide MG776416_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-60). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776417_HBx_P-D Product feature CHAIN MG776417_HBx_P-D of FT:mat_peptide MG776417_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-61). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKMFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776418_HBx_P-D Product feature CHAIN MG776418_HBx_P-D of FT:mat_peptide MG776418_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-62). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776419_HBx_P-D Product feature CHAIN MG776419_HBx_P-D of FT:mat_peptide MG776419_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-64). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEEIRLLIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776420_HBx_P-D Product feature CHAIN MG776420_HBx_P-D of FT:mat_peptide MG776420_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-68). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776421_HBx_P-D Product feature CHAIN MG776421_HBx_P-D of FT:mat_peptide MG776421_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-69). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776423_HBx_P-D Product feature CHAIN MG776423_HBx_P-D of FT:mat_peptide MG776423_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-73). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776424_HBx_P-D Product feature CHAIN MG776424_HBx_P-D of FT:mat_peptide MG776424_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-75). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776428_HBx_P-D Product feature CHAIN MG776428_HBx_P-D of FT:mat_peptide MG776428_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-83). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPCTVSTDNGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776430_HBx_P-D Product feature CHAIN MG776430_HBx_P-D of FT:mat_peptide MG776430_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-91). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776433_HBx_P-D Product feature CHAIN MG776433_HBx_P-D of FT:mat_peptide MG776433_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-101). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTIGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPFDFFTSA
>gnl|hbvpro|MG776434_HBx_P-D Product feature CHAIN MG776434_HBx_P-D of FT:mat_peptide MG776434_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-102). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776435_HBx_P-D Product feature CHAIN MG776435_HBx_P-D of FT:mat_peptide MG776435_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-105). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776436_HBx_P-D Product feature CHAIN MG776436_HBx_P-D of FT:mat_peptide MG776436_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-107). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776437_HBx_P-D Product feature CHAIN MG776437_HBx_P-D of FT:mat_peptide MG776437_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-111). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776438_HBx_P-D Product feature CHAIN MG776438_HBx_P-D of FT:mat_peptide MG776438_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-119). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776439_HBx_P-D Product feature CHAIN MG776439_HBx_P-D of FT:mat_peptide MG776439_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA_123). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKMFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776440_HBx_P-D Product feature CHAIN MG776440_HBx_P-D of FT:mat_peptide MG776440_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-124). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776441_HBx_P-D Product feature CHAIN MG776441_HBx_P-D of FT:mat_peptide MG776441_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-125). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSSDHGARLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEESRLQMFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776442_HBx_P-D Product feature CHAIN MG776442_HBx_P-D of FT:mat_peptide MG776442_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-134). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVHVGRACRHKLVLAPTPWNFFTSA
>gnl|hbvpro|MG776443_HBx_P-D Product feature CHAIN MG776443_HBx_P-D of FT:mat_peptide MG776443_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-138). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFPSA
>gnl|hbvpro|MG776444_HBx_P-D Product feature CHAIN MG776444_HBx_P-D of FT:mat_peptide MG776444_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-142). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776445_HBx_P-D Product feature CHAIN MG776445_HBx_P-D of FT:mat_peptide MG776445_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-143). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776448_HBx_P-D Product feature CHAIN MG776448_HBx_P-D of FT:mat_peptide MG776448_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-153). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776449_HBx_P-D Product feature CHAIN MG776449_HBx_P-D of FT:mat_peptide MG776449_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-158). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776450_HBx_P-D Product feature CHAIN MG776450_HBx_P-D of FT:mat_peptide MG776450_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-160). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776451_HBx_P-D Product feature CHAIN MG776451_HBx_P-D of FT:mat_peptide MG776451_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-162). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776452_HBx_P-D Product feature CHAIN MG776452_HBx_P-D of FT:mat_peptide MG776452_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-170). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKFFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776453_HBx_P-D Product feature CHAIN MG776453_HBx_P-D of FT:mat_peptide MG776453_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-172). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776454_HBx_P-D Product feature CHAIN MG776454_HBx_P-D of FT:mat_peptide MG776454_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-175). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776455_HBx_P-D Product feature CHAIN MG776455_HBx_P-D of FT:mat_peptide MG776455_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-178). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776457_HBx_P-D Product feature CHAIN MG776457_HBx_P-D of FT:mat_peptide MG776457_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-183). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776459_HBx_P-D Product feature CHAIN MG776459_HBx_P-D of FT:mat_peptide MG776459_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-187). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776460_HBx_P-D Product feature CHAIN MG776460_HBx_P-D of FT:mat_peptide MG776460_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-188). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776461_HBx_P-D Product feature CHAIN MG776461_HBx_P-D of FT:mat_peptide MG776461_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-193). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776462_HBx_P-D Product feature CHAIN MG776462_HBx_P-D of FT:mat_peptide MG776462_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-195). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776464_HBx_P-D Product feature CHAIN MG776464_HBx_P-D of FT:mat_peptide MG776464_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-202). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVLVLGGCRHKLVCAPAPCNFFPSA
>gnl|hbvpro|MG776466_HBx_P-D Product feature CHAIN MG776466_HBx_P-D of FT:mat_peptide MG776466_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-213). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEEIRLLIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776468_HBx_P-D Product feature CHAIN MG776468_HBx_P-D of FT:mat_peptide MG776468_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-217). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776469_HBx_P-D Product feature CHAIN MG776469_HBx_P-D of FT:mat_peptide MG776469_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-220). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776470_HBx_P-D Product feature CHAIN MG776470_HBx_P-D of FT:mat_peptide MG776470_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-221). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776471_HBx_P-D Product feature CHAIN MG776471_HBx_P-D of FT:mat_peptide MG776471_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-224). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776473_HBx_P-D Product feature CHAIN MG776473_HBx_P-D of FT:mat_peptide MG776473_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-228). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MVVRLCCQQDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776474_HBx_P-D Product feature CHAIN MG776474_HBx_P-D of FT:mat_peptide MG776474_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-231). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776476_HBx_P-D Product feature CHAIN MG776476_HBx_P-D of FT:mat_peptide MG776476_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-235). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHRRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776477_HBx_P-D Product feature CHAIN MG776477_HBx_P-D of FT:mat_peptide MG776477_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-236). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEESRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776478_HBx_P-D Product feature CHAIN MG776478_HBx_P-D of FT:mat_peptide MG776478_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-240). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776479_HBx_P-D Product feature CHAIN MG776479_HBx_P-D of FT:mat_peptide MG776479_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-246). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776480_HBx_P-D Product feature CHAIN MG776480_HBx_P-D of FT:mat_peptide MG776480_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-250). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776481_HBx_P-D Product feature CHAIN MG776481_HBx_P-D of FT:mat_peptide MG776481_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-254). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776482_HBx_P-D Product feature CHAIN MG776482_HBx_P-D of FT:mat_peptide MG776482_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-255). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776483_HBx_P-D Product feature CHAIN MG776483_HBx_P-D of FT:mat_peptide MG776483_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-256). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCHFFTSA
>gnl|hbvpro|MG776484_HBx_P-D Product feature CHAIN MG776484_HBx_P-D of FT:mat_peptide MG776484_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-257). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSASAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776486_HBx_P-D Product feature CHAIN MG776486_HBx_P-D of FT:mat_peptide MG776486_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-264). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776487_HBx_P-D Product feature CHAIN MG776487_HBx_P-D of FT:mat_peptide MG776487_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-267). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTPARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTGLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776488_HBx_P-D Product feature CHAIN MG776488_HBx_P-D of FT:mat_peptide MG776488_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-268). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776490_HBx_P-D Product feature CHAIN MG776490_HBx_P-D of FT:mat_peptide MG776490_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-273). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776491_HBx_P-D Product feature CHAIN MG776491_HBx_P-D of FT:mat_peptide MG776491_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-274). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776492_HBx_P-D Product feature CHAIN MG776492_HBx_P-D of FT:mat_peptide MG776492_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-276). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEESRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776493_HBx_P-D Product feature CHAIN MG776493_HBx_P-D of FT:mat_peptide MG776493_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sa-277). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776495_HBx_P-D Product feature CHAIN MG776495_HBx_P-D of FT:mat_peptide MG776495_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-282). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPCNFFTSA
>gnl|hbvpro|MG776496_HBx_P-D Product feature CHAIN MG776496_HBx_P-D of FT:mat_peptide MG776496_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-283). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776497_HBx_P-D Product feature CHAIN MG776497_HBx_P-D of FT:mat_peptide MG776497_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-285). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776498_HBx_P-D Product feature CHAIN MG776498_HBx_P-D of FT:mat_peptide MG776498_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-286). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTIGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776499_HBx_P-D Product feature CHAIN MG776499_HBx_P-D of FT:mat_peptide MG776499_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-289). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776500_HBx_P-D Product feature CHAIN MG776500_HBx_P-D of FT:mat_peptide MG776500_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-294). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPRVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776501_HBx_P-D Product feature CHAIN MG776501_HBx_P-D of FT:mat_peptide MG776501_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-295). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776502_HBx_P-D Product feature CHAIN MG776502_HBx_P-D of FT:mat_peptide MG776502_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-297). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776504_HBx_P-D Product feature CHAIN MG776504_HBx_P-D of FT:mat_peptide MG776504_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-299). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776505_HBx_P-D Product feature CHAIN MG776505_HBx_P-D of FT:mat_peptide MG776505_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-309). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALHFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKIFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776506_HBx_P-D Product feature CHAIN MG776506_HBx_P-D of FT:mat_peptide MG776506_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-311). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776507_HBx_P-D Product feature CHAIN MG776507_HBx_P-D of FT:mat_peptide MG776507_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-313). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776509_HBx_P-D Product feature CHAIN MG776509_HBx_P-D of FT:mat_peptide MG776509_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-321). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPEPCNFFTSA
>gnl|hbvpro|MG776510_HBx_P-D Product feature CHAIN MG776510_HBx_P-D of FT:mat_peptide MG776510_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-328). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776511_HBx_P-D Product feature CHAIN MG776511_HBx_P-D of FT:mat_peptide MG776511_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-329). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776513_HBx_P-D Product feature CHAIN MG776513_HBx_P-D of FT:mat_peptide MG776513_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-335). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776514_HBx_P-D Product feature CHAIN MG776514_HBx_P-D of FT:mat_peptide MG776514_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-336). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776516_HBx_P-D Product feature CHAIN MG776516_HBx_P-D of FT:mat_peptide MG776516_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-339). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEEIRLLIFVLGGCRHKLVCTPAPCNFFTSA
>gnl|hbvpro|MG776518_HBx_P-D Product feature CHAIN MG776518_HBx_P-D of FT:mat_peptide MG776518_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-342). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIKLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776520_HBx_P-D Product feature CHAIN MG776520_HBx_P-D of FT:mat_peptide MG776520_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-346). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLWVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776522_HBx_P-D Product feature CHAIN MG776522_HBx_P-D of FT:mat_peptide MG776522_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-348). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVXCLRPVGAESRGRPFSGPLGTFSSPSPSXVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARXME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776523_HBx_P-D Product feature CHAIN MG776523_HBx_P-D of FT:mat_peptide MG776523_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-351). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSGMSTTDLEAYFKDCLFKDWEELGEEIRLLIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776524_HBx_P-D Product feature CHAIN MG776524_HBx_P-D of FT:mat_peptide MG776524_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-354). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEDIRLKPFVLGGRNNKSVPFPAPHNFITSA
>gnl|hbvpro|MG776525_HBx_P-D Product feature CHAIN MG776525_HBx_P-D of FT:mat_peptide MG776525_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-357). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKNYVFGGCRHKPVFAPTPPSFFTFA
>gnl|hbvpro|MG776527_HBx_P-D Product feature CHAIN MG776527_HBx_P-D of FT:mat_peptide MG776527_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-360). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776528_HBx_P-D Product feature CHAIN MG776528_HBx_P-D of FT:mat_peptide MG776528_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-365). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776529_HBx_P-D Product feature CHAIN MG776529_HBx_P-D of FT:mat_peptide MG776529_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-367). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGDCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776530_HBx_P-D Product feature CHAIN MG776530_HBx_P-D of FT:mat_peptide MG776530_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-368). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARVCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGDCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776532_HBx_P-D Product feature CHAIN MG776532_HBx_P-D of FT:mat_peptide MG776532_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-372). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776533_HBx_P-D Product feature CHAIN MG776533_HBx_P-D of FT:mat_peptide MG776533_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-373). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776535_HBx_P-D Product feature CHAIN MG776535_HBx_P-D of FT:mat_peptide MG776535_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-376). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVMMLGGCMGKLVCSPAPCNFFTSA
>gnl|hbvpro|MG776536_HBx_P-D Product feature CHAIN MG776536_HBx_P-D of FT:mat_peptide MG776536_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-377). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776537_HBx_P-D Product feature CHAIN MG776537_HBx_P-D of FT:mat_peptide MG776537_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-378). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776538_HBx_P-D Product feature CHAIN MG776538_HBx_P-D of FT:mat_peptide MG776538_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-380). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776539_HBx_P-D Product feature CHAIN MG776539_HBx_P-D of FT:mat_peptide MG776539_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-385). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776541_HBx_P-D Product feature CHAIN MG776541_HBx_P-D of FT:mat_peptide MG776541_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-388). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776543_HBx_P-D Product feature CHAIN MG776543_HBx_P-D of FT:mat_peptide MG776543_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-390). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTYARCME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776544_HBx_P-D Product feature CHAIN MG776544_HBx_P-D of FT:mat_peptide MG776544_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-397). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776545_HBx_P-D Product feature CHAIN MG776545_HBx_P-D of FT:mat_peptide MG776545_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-400). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776546_HBx_P-D Product feature CHAIN MG776546_HBx_P-D of FT:mat_peptide MG776546_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-404). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776547_HBx_P-D Product feature CHAIN MG776547_HBx_P-D of FT:mat_peptide MG776547_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-406). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|MG776548_HBx_P-D Product feature CHAIN MG776548_HBx_P-D of FT:mat_peptide MG776548_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-408). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776549_HBx_P-D Product feature CHAIN MG776549_HBx_P-D of FT:mat_peptide MG776549_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-409). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776553_HBx_P-D Product feature CHAIN MG776553_HBx_P-D of FT:mat_peptide MG776553_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-433). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLETYFKDCLFKDWEELGEETRLTLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776554_HBx_P-D Product feature CHAIN MG776554_HBx_P-D of FT:mat_peptide MG776554_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-462). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776555_HBx_P-D Product feature CHAIN MG776555_HBx_P-D of FT:mat_peptide MG776555_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-463). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVVCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLTLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776558_HBx_P-D Product feature CHAIN MG776558_HBx_P-D of FT:mat_peptide MG776558_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-478). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHNRTLGLSVMSTTDLEAYFKDCLFRDWEELGEELRLKVFVLGGCRHKLVCAPAPSNFFTSA
>gnl|hbvpro|MG776559_HBx_P-D Product feature CHAIN MG776559_HBx_P-D of FT:mat_peptide MG776559_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-485). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776560_HBx_P-D Product feature CHAIN MG776560_HBx_P-D of FT:mat_peptide MG776560_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-512). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776561_HBx_P-D Product feature CHAIN MG776561_HBx_P-D of FT:mat_peptide MG776561_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-515). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776563_HBx_P-D Product feature CHAIN MG776563_HBx_P-D of FT:mat_peptide MG776563_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-517). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776566_HBx_P-D Product feature CHAIN MG776566_HBx_P-D of FT:mat_peptide MG776566_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-527). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776567_HBx_P-D Product feature CHAIN MG776567_HBx_P-D of FT:mat_peptide MG776567_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-530). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776568_HBx_P-D Product feature CHAIN MG776568_HBx_P-D of FT:mat_peptide MG776568_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-531). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776569_HBx_P-D Product feature CHAIN MG776569_HBx_P-D of FT:mat_peptide MG776569_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-534). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776571_HBx_P-D Product feature CHAIN MG776571_HBx_P-D of FT:mat_peptide MG776571_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-536). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776572_HBx_P-D Product feature CHAIN MG776572_HBx_P-D of FT:mat_peptide MG776572_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-537). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPYNFFTSA
>gnl|hbvpro|MG776574_HBx_P-D Product feature CHAIN MG776574_HBx_P-D of FT:mat_peptide MG776574_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-541). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776576_HBx_P-D Product feature CHAIN MG776576_HBx_P-D of FT:mat_peptide MG776576_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-544). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRLTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFLTSA
>gnl|hbvpro|MG776578_HBx_P-D Product feature CHAIN MG776578_HBx_P-D of FT:mat_peptide MG776578_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-547). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSASAVSTDHGAHLSLRELPVCAFSSAGPCALRFTSARRME
TTVNAHHVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776579_HBx_P-D Product feature CHAIN MG776579_HBx_P-D of FT:mat_peptide MG776579_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-548). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776581_HBx_P-D Product feature CHAIN MG776581_HBx_P-D of FT:mat_peptide MG776581_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-550). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLRLFVLGGCRHKLVRHPAPCNFFTSA
>gnl|hbvpro|MG776582_HBx_P-D Product feature CHAIN MG776582_HBx_P-D of FT:mat_peptide MG776582_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-552). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSACAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776583_HBx_P-D Product feature CHAIN MG776583_HBx_P-D of FT:mat_peptide MG776583_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-559). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776584_HBx_P-D Product feature CHAIN MG776584_HBx_P-D of FT:mat_peptide MG776584_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-560). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776585_HBx_P-D Product feature CHAIN MG776585_HBx_P-D of FT:mat_peptide MG776585_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-561). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776586_HBx_P-D Product feature CHAIN MG776586_HBx_P-D of FT:mat_peptide MG776586_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-563). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776587_HBx_P-D Product feature CHAIN MG776587_HBx_P-D of FT:mat_peptide MG776587_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-565). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776588_HBx_P-D Product feature CHAIN MG776588_HBx_P-D of FT:mat_peptide MG776588_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-566). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776589_HBx_P-D Product feature CHAIN MG776589_HBx_P-D of FT:mat_peptide MG776589_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-567). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776590_HBx_P-D Product feature CHAIN MG776590_HBx_P-D of FT:mat_peptide MG776590_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-568). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776591_HBx_P-D Product feature CHAIN MG776591_HBx_P-D of FT:mat_peptide MG776591_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-570). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776592_HBx_P-D Product feature CHAIN MG776592_HBx_P-D of FT:mat_peptide MG776592_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-571). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNCFTSA
>gnl|hbvpro|MG776593_HBx_P-D Product feature CHAIN MG776593_HBx_P-D of FT:mat_peptide MG776593_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-572). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776594_HBx_P-D Product feature CHAIN MG776594_HBx_P-D of FT:mat_peptide MG776594_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-573). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCVPAPCNFFTSA
>gnl|hbvpro|MG776595_HBx_P-D Product feature CHAIN MG776595_HBx_P-D of FT:mat_peptide MG776595_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-574). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776596_HBx_P-D Product feature CHAIN MG776596_HBx_P-D of FT:mat_peptide MG776596_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA_575). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776597_HBx_P-D Product feature CHAIN MG776597_HBx_P-D of FT:mat_peptide MG776597_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-578). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776598_HBx_P-D Product feature CHAIN MG776598_HBx_P-D of FT:mat_peptide MG776598_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-581). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776599_HBx_P-D Product feature CHAIN MG776599_HBx_P-D of FT:mat_peptide MG776599_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-585). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776600_HBx_P-D Product feature CHAIN MG776600_HBx_P-D of FT:mat_peptide MG776600_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-592). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLRLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776602_HBx_P-D Product feature CHAIN MG776602_HBx_P-D of FT:mat_peptide MG776602_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-597). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGSPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGSCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776603_HBx_P-D Product feature CHAIN MG776603_HBx_P-D of FT:mat_peptide MG776603_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-598). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776604_HBx_P-D Product feature CHAIN MG776604_HBx_P-D of FT:mat_peptide MG776604_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-602). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSIMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776606_HBx_P-D Product feature CHAIN MG776606_HBx_P-D of FT:mat_peptide MG776606_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-605). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776607_HBx_P-D Product feature CHAIN MG776607_HBx_P-D of FT:mat_peptide MG776607_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-606). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776610_HBx_P-D Product feature CHAIN MG776610_HBx_P-D of FT:mat_peptide MG776610_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-615). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPCNFFPPA
>gnl|hbvpro|MG776611_HBx_P-D Product feature CHAIN MG776611_HBx_P-D of FT:mat_peptide MG776611_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-616). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGPLSSPSPSVVSTRHGAHLSLRGLPVCALSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776612_HBx_P-D Product feature CHAIN MG776612_HBx_P-D of FT:mat_peptide MG776612_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-618). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHGAHLSLRGLPVCAFSSAGTCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSVMSTTDLEAYFKDRLFKDWEELGEELRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776613_HBx_P-D Product feature CHAIN MG776613_HBx_P-D of FT:mat_peptide MG776613_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-619). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVISTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776614_HBx_P-D Product feature CHAIN MG776614_HBx_P-D of FT:mat_peptide MG776614_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-622). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776615_HBx_P-D Product feature CHAIN MG776615_HBx_P-D of FT:mat_peptide MG776615_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-624). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776616_HBx_P-D Product feature CHAIN MG776616_HBx_P-D of FT:mat_peptide MG776616_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-626). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFPSA
>gnl|hbvpro|MG776619_HBx_P-D Product feature CHAIN MG776619_HBx_P-D of FT:mat_peptide MG776619_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-634). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776620_HBx_P-D Product feature CHAIN MG776620_HBx_P-D of FT:mat_peptide MG776620_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-638). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776622_HBx_P-D Product feature CHAIN MG776622_HBx_P-D of FT:mat_peptide MG776622_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-642). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776623_HBx_P-D Product feature CHAIN MG776623_HBx_P-D of FT:mat_peptide MG776623_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-646). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNDHHCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776624_HBx_P-D Product feature CHAIN MG776624_HBx_P-D of FT:mat_peptide MG776624_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-648). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRRRPFSGPLGSLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776625_HBx_P-D Product feature CHAIN MG776625_HBx_P-D of FT:mat_peptide MG776625_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-650). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776626_HBx_P-D Product feature CHAIN MG776626_HBx_P-D of FT:mat_peptide MG776626_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-653). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776628_HBx_P-D Product feature CHAIN MG776628_HBx_P-D of FT:mat_peptide MG776628_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-670). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCMDKLVCSPPPCNFFTSA
>gnl|hbvpro|MG776629_HBx_P-D Product feature CHAIN MG776629_HBx_P-D of FT:mat_peptide MG776629_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-671). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776630_HBx_P-D Product feature CHAIN MG776630_HBx_P-D of FT:mat_peptide MG776630_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-680). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVTSTTDLEAYFKDCLFKDWEELGEETRLKIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776631_HBx_P-D Product feature CHAIN MG776631_HBx_P-D of FT:mat_peptide MG776631_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-681). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776632_HBx_P-D Product feature CHAIN MG776632_HBx_P-D of FT:mat_peptide MG776632_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-686). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776633_HBx_P-D Product feature CHAIN MG776633_HBx_P-D of FT:mat_peptide MG776633_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-695). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776634_HBx_P-D Product feature CHAIN MG776634_HBx_P-D of FT:mat_peptide MG776634_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-696). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRVTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776635_HBx_P-D Product feature CHAIN MG776635_HBx_P-D of FT:mat_peptide MG776635_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-700). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776636_HBx_P-D Product feature CHAIN MG776636_HBx_P-D of FT:mat_peptide MG776636_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-708). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776637_HBx_P-D Product feature CHAIN MG776637_HBx_P-D of FT:mat_peptide MG776637_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-710). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776638_HBx_P-D Product feature CHAIN MG776638_HBx_P-D of FT:mat_peptide MG776638_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-714). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKYWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFSSA
>gnl|hbvpro|MG776639_HBx_P-D Product feature CHAIN MG776639_HBx_P-D of FT:mat_peptide MG776639_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-718). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFPSA
>gnl|hbvpro|MG776640_HBx_P-D Product feature CHAIN MG776640_HBx_P-D of FT:mat_peptide MG776640_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-720). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEESGEEIRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776641_HBx_P-D Product feature CHAIN MG776641_HBx_P-D of FT:mat_peptide MG776641_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-721). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776642_HBx_P-D Product feature CHAIN MG776642_HBx_P-D of FT:mat_peptide MG776642_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-722). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCAPRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEESRLMVYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776643_HBx_P-D Product feature CHAIN MG776643_HBx_P-D of FT:mat_peptide MG776643_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-724). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776644_HBx_P-D Product feature CHAIN MG776644_HBx_P-D of FT:mat_peptide MG776644_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-725). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQPDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVYAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776647_HBx_P-D Product feature CHAIN MG776647_HBx_P-D of FT:mat_peptide MG776647_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-768). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARGME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776648_HBx_P-D Product feature CHAIN MG776648_HBx_P-D of FT:mat_peptide MG776648_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-769). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSVRRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776649_HBx_P-D Product feature CHAIN MG776649_HBx_P-D of FT:mat_peptide MG776649_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-771). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776650_HBx_P-D Product feature CHAIN MG776650_HBx_P-D of FT:mat_peptide MG776650_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-774). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776651_HBx_P-D Product feature CHAIN MG776651_HBx_P-D of FT:mat_peptide MG776651_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-782). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776652_HBx_P-D Product feature CHAIN MG776652_HBx_P-D of FT:mat_peptide MG776652_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-785). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776653_HBx_P-D Product feature CHAIN MG776653_HBx_P-D of FT:mat_peptide MG776653_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-808). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCAPAPCNFFPSA
>gnl|hbvpro|MG776654_HBx_P-D Product feature CHAIN MG776654_HBx_P-D of FT:mat_peptide MG776654_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-809). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776655_HBx_P-D Product feature CHAIN MG776655_HBx_P-D of FT:mat_peptide MG776655_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-810). Partial genome (Contains: HBe, HBx). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEESRLMFFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776656_HBx_P-D Product feature CHAIN MG776656_HBx_P-D of FT:mat_peptide MG776656_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-830). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776657_HBx_P-D Product feature CHAIN MG776657_HBx_P-D of FT:mat_peptide MG776657_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-834). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSADHGAHLSLRGLPVCAFSSAEPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776658_HBx_P-D Product feature CHAIN MG776658_HBx_P-D of FT:mat_peptide MG776658_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-838). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776661_HBx_P-D Product feature CHAIN MG776661_HBx_P-D of FT:mat_peptide MG776661_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-846). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776662_HBx_P-D Product feature CHAIN MG776662_HBx_P-D of FT:mat_peptide MG776662_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-847). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776663_HBx_P-D Product feature CHAIN MG776663_HBx_P-D of FT:mat_peptide MG776663_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-848). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776664_HBx_P-D Product feature CHAIN MG776664_HBx_P-D of FT:mat_peptide MG776664_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-852). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776666_HBx_P-D Product feature CHAIN MG776666_HBx_P-D of FT:mat_peptide MG776666_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-855). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRITSARRME
TTVNAHLCLPKVLHKRTLGLSVMSTIDLEAYFKDCLFKDWEELGEEIRLKMFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776667_HBx_P-D Product feature CHAIN MG776667_HBx_P-D of FT:mat_peptide MG776667_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-858). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776668_HBx_P-D Product feature CHAIN MG776668_HBx_P-D of FT:mat_peptide MG776668_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-862). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLNVRMLGGCIALLVCTPAPCNFFTSA
>gnl|hbvpro|MG776669_HBx_P-D Product feature CHAIN MG776669_HBx_P-D of FT:mat_peptide MG776669_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-863). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776670_HBx_P-D Product feature CHAIN MG776670_HBx_P-D of FT:mat_peptide MG776670_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-865). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776671_HBx_P-D Product feature CHAIN MG776671_HBx_P-D of FT:mat_peptide MG776671_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-867). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776672_HBx_P-D Product feature CHAIN MG776672_HBx_P-D of FT:mat_peptide MG776672_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-869). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776676_HBx_P-D Product feature CHAIN MG776676_HBx_P-D of FT:mat_peptide MG776676_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-878). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCEDKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776679_HBx_P-D Product feature CHAIN MG776679_HBx_P-D of FT:mat_peptide MG776679_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-891). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776680_HBx_P-D Product feature CHAIN MG776680_HBx_P-D of FT:mat_peptide MG776680_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-892). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDYLFKEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776681_HBx_P-D Product feature CHAIN MG776681_HBx_P-D of FT:mat_peptide MG776681_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-893). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPFNFFTSA
>gnl|hbvpro|MG776682_HBx_P-D Product feature CHAIN MG776682_HBx_P-D of FT:mat_peptide MG776682_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-895). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARMSCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLSCAPAPSNFFTSA
>gnl|hbvpro|MG776683_HBx_P-D Product feature CHAIN MG776683_HBx_P-D of FT:mat_peptide MG776683_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-897). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776684_HBx_P-D Product feature CHAIN MG776684_HBx_P-D of FT:mat_peptide MG776684_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-898). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776687_HBx_P-D Product feature CHAIN MG776687_HBx_P-D of FT:mat_peptide MG776687_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-913). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRIKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776688_HBx_P-D Product feature CHAIN MG776688_HBx_P-D of FT:mat_peptide MG776688_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-942). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MG776689_HBx_P-D Product feature CHAIN MG776689_HBx_P-D of FT:mat_peptide MG776689_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-943). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776691_HBx_P-D Product feature CHAIN MG776691_HBx_P-D of FT:mat_peptide MG776691_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-950). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSTAAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776692_HBx_P-D Product feature CHAIN MG776692_HBx_P-D of FT:mat_peptide MG776692_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-956). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776695_HBx_P-D Product feature CHAIN MG776695_HBx_P-D of FT:mat_peptide MG776695_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-963). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGTCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776701_HBx_P-D Product feature CHAIN MG776701_HBx_P-D of FT:mat_peptide MG776701_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-979). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776703_HBx_P-D Product feature CHAIN MG776703_HBx_P-D of FT:mat_peptide MG776703_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-984). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776704_HBx_P-D Product feature CHAIN MG776704_HBx_P-D of FT:mat_peptide MG776704_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-987). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776705_HBx_P-D Product feature CHAIN MG776705_HBx_P-D of FT:mat_peptide MG776705_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1000). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776706_HBx_P-D Product feature CHAIN MG776706_HBx_P-D of FT:mat_peptide MG776706_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1001). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776708_HBx_P-D Product feature CHAIN MG776708_HBx_P-D of FT:mat_peptide MG776708_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1009). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776710_HBx_P-D Product feature CHAIN MG776710_HBx_P-D of FT:mat_peptide MG776710_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1025). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776712_HBx_P-D Product feature CHAIN MG776712_HBx_P-D of FT:mat_peptide MG776712_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1029). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776713_HBx_P-D Product feature CHAIN MG776713_HBx_P-D of FT:mat_peptide MG776713_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1030). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSRTLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776714_HBx_P-D Product feature CHAIN MG776714_HBx_P-D of FT:mat_peptide MG776714_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1032). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDREELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776715_HBx_P-D Product feature CHAIN MG776715_HBx_P-D of FT:mat_peptide MG776715_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1036). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDREELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776717_HBx_P-D Product feature CHAIN MG776717_HBx_P-D of FT:mat_peptide MG776717_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1051). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776718_HBx_P-D Product feature CHAIN MG776718_HBx_P-D of FT:mat_peptide MG776718_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1054). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TAVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPSNFFTSA
>gnl|hbvpro|MG776720_HBx_P-D Product feature CHAIN MG776720_HBx_P-D of FT:mat_peptide MG776720_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1057). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEENRLQLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776722_HBx_P-D Product feature CHAIN MG776722_HBx_P-D of FT:mat_peptide MG776722_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1064). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776723_HBx_P-D Product feature CHAIN MG776723_HBx_P-D of FT:mat_peptide MG776723_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1065). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTIHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776725_HBx_P-D Product feature CHAIN MG776725_HBx_P-D of FT:mat_peptide MG776725_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1075). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776726_HBx_P-D Product feature CHAIN MG776726_HBx_P-D of FT:mat_peptide MG776726_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1078). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKAFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776727_HBx_P-D Product feature CHAIN MG776727_HBx_P-D of FT:mat_peptide MG776727_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1079). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776730_HBx_P-D Product feature CHAIN MG776730_HBx_P-D of FT:mat_peptide MG776730_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1087). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776731_HBx_P-D Product feature CHAIN MG776731_HBx_P-D of FT:mat_peptide MG776731_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA_1088). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKWFCAPAPCNFFTSA
>gnl|hbvpro|MG776732_HBx_P-D Product feature CHAIN MG776732_HBx_P-D of FT:mat_peptide MG776732_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1092). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPWNFFTSA
>gnl|hbvpro|MG776735_HBx_P-D Product feature CHAIN MG776735_HBx_P-D of FT:mat_peptide MG776735_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1098). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776736_HBx_P-D Product feature CHAIN MG776736_HBx_P-D of FT:mat_peptide MG776736_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1099). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSASAVSPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776738_HBx_P-D Product feature CHAIN MG776738_HBx_P-D of FT:mat_peptide MG776738_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1107). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776739_HBx_P-D Product feature CHAIN MG776739_HBx_P-D of FT:mat_peptide MG776739_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1109). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776742_HBx_P-D Product feature CHAIN MG776742_HBx_P-D of FT:mat_peptide MG776742_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1114). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEELGEEIRLELFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776743_HBx_P-D Product feature CHAIN MG776743_HBx_P-D of FT:mat_peptide MG776743_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1115). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776746_HBx_P-D Product feature CHAIN MG776746_HBx_P-D of FT:mat_peptide MG776746_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1126). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSASAVSPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776747_HBx_P-D Product feature CHAIN MG776747_HBx_P-D of FT:mat_peptide MG776747_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1128). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPVPCNLFPSA
>gnl|hbvpro|MG776748_HBx_P-D Product feature CHAIN MG776748_HBx_P-D of FT:mat_peptide MG776748_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1129). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776749_HBx_P-D Product feature CHAIN MG776749_HBx_P-D of FT:mat_peptide MG776749_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1137). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPYPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776751_HBx_P-D Product feature CHAIN MG776751_HBx_P-D of FT:mat_peptide MG776751_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1145). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVSAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDSLFKDWEELGEETRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776752_HBx_P-D Product feature CHAIN MG776752_HBx_P-D of FT:mat_peptide MG776752_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1153). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776753_HBx_P-D Product feature CHAIN MG776753_HBx_P-D of FT:mat_peptide MG776753_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1154). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776754_HBx_P-D Product feature CHAIN MG776754_HBx_P-D of FT:mat_peptide MG776754_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1155). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIYVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776755_HBx_P-D Product feature CHAIN MG776755_HBx_P-D of FT:mat_peptide MG776755_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1162). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776756_HBx_P-D Product feature CHAIN MG776756_HBx_P-D of FT:mat_peptide MG776756_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1171). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776757_HBx_P-D Product feature CHAIN MG776757_HBx_P-D of FT:mat_peptide MG776757_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1193). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFPSA
>gnl|hbvpro|MG776759_HBx_P-D Product feature CHAIN MG776759_HBx_P-D of FT:mat_peptide MG776759_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1201). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCAPAPCNFSTSA
>gnl|hbvpro|MG776760_HBx_P-D Product feature CHAIN MG776760_HBx_P-D of FT:mat_peptide MG776760_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1202). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLYKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776761_HBx_P-D Product feature CHAIN MG776761_HBx_P-D of FT:mat_peptide MG776761_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1204). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGTPGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSPAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVISTTDLEAYFKDCLFKDWEESGEEIRLKLFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776762_HBx_P-D Product feature CHAIN MG776762_HBx_P-D of FT:mat_peptide MG776762_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1210). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776763_HBx_P-D Product feature CHAIN MG776763_HBx_P-D of FT:mat_peptide MG776763_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1212). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEFRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776764_HBx_P-D Product feature CHAIN MG776764_HBx_P-D of FT:mat_peptide MG776764_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1216). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776765_HBx_P-D Product feature CHAIN MG776765_HBx_P-D of FT:mat_peptide MG776765_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1221). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHLCLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVRHPVPCNFFTSA
>gnl|hbvpro|MG776766_HBx_P-D Product feature CHAIN MG776766_HBx_P-D of FT:mat_peptide MG776766_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1227). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAHFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776767_HBx_P-D Product feature CHAIN MG776767_HBx_P-D of FT:mat_peptide MG776767_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1230). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776768_HBx_P-D Product feature CHAIN MG776768_HBx_P-D of FT:mat_peptide MG776768_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1232). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSADHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776770_HBx_P-D Product feature CHAIN MG776770_HBx_P-D of FT:mat_peptide MG776770_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1242). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTLNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFPSA
>gnl|hbvpro|MG776771_HBx_P-D Product feature CHAIN MG776771_HBx_P-D of FT:mat_peptide MG776771_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1247). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776774_HBx_P-D Product feature CHAIN MG776774_HBx_P-D of FT:mat_peptide MG776774_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1259). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776775_HBx_P-D Product feature CHAIN MG776775_HBx_P-D of FT:mat_peptide MG776775_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1266). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776776_HBx_P-D Product feature CHAIN MG776776_HBx_P-D of FT:mat_peptide MG776776_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1268). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLPVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776777_HBx_P-D Product feature CHAIN MG776777_HBx_P-D of FT:mat_peptide MG776777_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1273). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVIHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEITLKLFVLLGCKHKLVGSPDPCNFFTSA
>gnl|hbvpro|MG776778_HBx_P-D Product feature CHAIN MG776778_HBx_P-D of FT:mat_peptide MG776778_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1281). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFPSA
>gnl|hbvpro|MG776779_HBx_P-D Product feature CHAIN MG776779_HBx_P-D of FT:mat_peptide MG776779_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1284). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776781_HBx_P-D Product feature CHAIN MG776781_HBx_P-D of FT:mat_peptide MG776781_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1305). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
NTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776783_HBx_P-D Product feature CHAIN MG776783_HBx_P-D of FT:mat_peptide MG776783_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1327). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNARQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776784_HBx_P-D Product feature CHAIN MG776784_HBx_P-D of FT:mat_peptide MG776784_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1330). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776785_HBx_P-D Product feature CHAIN MG776785_HBx_P-D of FT:mat_peptide MG776785_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1352). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLYKRTLGLSVMSTTDLEAYFKDRLFKDWEELGEELRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776788_HBx_P-D Product feature CHAIN MG776788_HBx_P-D of FT:mat_peptide MG776788_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1382). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNFFTSA
>gnl|hbvpro|MG776789_HBx_P-D Product feature CHAIN MG776789_HBx_P-D of FT:mat_peptide MG776789_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1396). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGSCRHKLVCPPPPCNFFTSA
>gnl|hbvpro|MG776790_HBx_P-D Product feature CHAIN MG776790_HBx_P-D of FT:mat_peptide MG776790_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1402). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776791_HBx_P-D Product feature CHAIN MG776791_HBx_P-D of FT:mat_peptide MG776791_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1412). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPSPCNFFTSA
>gnl|hbvpro|MG776792_HBx_P-D Product feature CHAIN MG776792_HBx_P-D of FT:mat_peptide MG776792_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1413). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSASAVPPNHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEELRLKTFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776793_HBx_P-D Product feature CHAIN MG776793_HBx_P-D of FT:mat_peptide MG776793_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1429). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776794_HBx_P-D Product feature CHAIN MG776794_HBx_P-D of FT:mat_peptide MG776794_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1454). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSASAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TSVNAHQLLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MG776796_HBx_P-D Product feature CHAIN MG776796_HBx_P-D of FT:mat_peptide MG776796_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1467). Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAHFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH464834_HBx_P-D Product feature CHAIN MH464834_HBx_P-D of FT:mat_peptide MH464834_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA112). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPXXCNFFTSA
>gnl|hbvpro|MH464836_HBx_P-D Product feature CHAIN MH464836_HBx_P-D of FT:mat_peptide MH464836_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA114). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464838_HBx_P-D Product feature CHAIN MH464838_HBx_P-D of FT:mat_peptide MH464838_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA116). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLYKRTLGLSAMPTTDLEAYFKDCLFKDWEDLGEERRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH464839_HBx_P-D Product feature CHAIN MH464839_HBx_P-D of FT:mat_peptide MH464839_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA117). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH464840_HBx_P-D Product feature CHAIN MH464840_HBx_P-D of FT:mat_peptide MH464840_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA118). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH464841_HBx_P-D Product feature CHAIN MH464841_HBx_P-D of FT:mat_peptide MH464841_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPXDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEXRLKVFVLGGCRHKLVCAPSSCNFFTSA
>gnl|hbvpro|MH464844_HBx_P-D Product feature CHAIN MH464844_HBx_P-D of FT:mat_peptide MH464844_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA122). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMA
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAXCNFFTSA
>gnl|hbvpro|MH464854_HBx_P-D Product feature CHAIN MH464854_HBx_P-D of FT:mat_peptide MH464854_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA132). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MH932714_HBx_P-D Product feature CHAIN MH932714_HBx_P-D of FT:mat_peptide MH932714_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Hiroshima GtD CL2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052947_HBx_P-D Product feature CHAIN MK052947_HBx_P-D of FT:mat_peptide MK052947_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-1). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052948_HBx_P-D Product feature CHAIN MK052948_HBx_P-D of FT:mat_peptide MK052948_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052949_HBx_P-D Product feature CHAIN MK052949_HBx_P-D of FT:mat_peptide MK052949_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052950_HBx_P-D Product feature CHAIN MK052950_HBx_P-D of FT:mat_peptide MK052950_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGARLSLRGLPVCAFSSVGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052951_HBx_P-D Product feature CHAIN MK052951_HBx_P-D of FT:mat_peptide MK052951_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052952_HBx_P-D Product feature CHAIN MK052952_HBx_P-D of FT:mat_peptide MK052952_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-6). Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052953_HBx_P-D Product feature CHAIN MK052953_HBx_P-D of FT:mat_peptide MK052953_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052954_HBx_P-D Product feature CHAIN MK052954_HBx_P-D of FT:mat_peptide MK052954_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
VAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052955_HBx_P-D Product feature CHAIN MK052955_HBx_P-D of FT:mat_peptide MK052955_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052956_HBx_P-D Product feature CHAIN MK052956_HBx_P-D of FT:mat_peptide MK052956_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCASSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVLVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052958_HBx_P-D Product feature CHAIN MK052958_HBx_P-D of FT:mat_peptide MK052958_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052959_HBx_P-D Product feature CHAIN MK052959_HBx_P-D of FT:mat_peptide MK052959_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVPCLRPVSAESGGRPVSGPPGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEESGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052960_HBx_P-D Product feature CHAIN MK052960_HBx_P-D of FT:mat_peptide MK052960_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-14). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPPPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRTE
TTVNAHQVLPRVLHKRTLGLSAMSTTDLESYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052961_HBx_P-D Product feature CHAIN MK052961_HBx_P-D of FT:mat_peptide MK052961_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-15). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTADLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|MK052963_HBx_P-D Product feature CHAIN MK052963_HBx_P-D of FT:mat_peptide MK052963_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052966_HBx_P-D Product feature CHAIN MK052966_HBx_P-D of FT:mat_peptide MK052966_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052971_HBx_P-D Product feature CHAIN MK052971_HBx_P-D of FT:mat_peptide MK052971_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052972_HBx_P-D Product feature CHAIN MK052972_HBx_P-D of FT:mat_peptide MK052972_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-12). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVRASSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFRDWEELGEETRLKVSVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052973_HBx_P-D Product feature CHAIN MK052973_HBx_P-D of FT:mat_peptide MK052973_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-14). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052974_HBx_P-D Product feature CHAIN MK052974_HBx_P-D of FT:mat_peptide MK052974_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPNHGAHLSLRGLPVCVFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|MK052975_HBx_P-D Product feature CHAIN MK052975_HBx_P-D of FT:mat_peptide MK052975_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-17). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA
>gnl|hbvpro|S41175_HBx_P-D Product feature CHAIN S41175_HBx_P-D of FT:mat_peptide S41175_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSTVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|S77748_HBx_P-D Product feature CHAIN S77748_HBx_P-D of FT:mat_peptide S77748_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARPVE
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|V01460_HBx_P-D Product feature CHAIN V01460_HBx_P-D of FT:mat_peptide V01460_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X02496_HBx_P-D Product feature CHAIN X02496_HBx_P-D of FT:mat_peptide X02496_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVKAQPFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X59795_HBx_P-D Product feature CHAIN X59795_HBx_P-D of FT:mat_peptide X59795_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Patient MG; HBV/S). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPERDVLRLRPVGAESSGRPFSGPLGTLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKEWEELGEEIRLKLFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X65258_HBx_P-D Product feature CHAIN X65258_HBx_P-D of FT:mat_peptide X65258_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient CI; HBV subtype ayw). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQILPKVLHKRTLGLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X72702_HBx_P-D Product feature CHAIN X72702_HBx_P-D of FT:mat_peptide X72702_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient C1005). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVPSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X80924_HBx_P-D Product feature CHAIN X80924_HBx_P-D of FT:mat_peptide X80924_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 4). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQMLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X80926_HBx_P-D Product feature CHAIN X80926_HBx_P-D of FT:mat_peptide X80926_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 5). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQMLPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X85254_HBx_P-D Product feature CHAIN X85254_HBx_P-D of FT:mat_peptide X85254_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTFSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPSALRFTSARRME
TTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIWLKVFVLGGCRHKLVCAPAPCDFFTSA
>gnl|hbvpro|X97848_HBx_P-D Product feature CHAIN X97848_HBx_P-D of FT:mat_peptide X97848_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 2). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|X97849_HBx_P-D Product feature CHAIN X97849_HBx_P-D of FT:mat_peptide X97849_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 3). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHHFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEEFGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|Y07587_HBx_P-D Product feature CHAIN Y07587_HBx_P-D of FT:mat_peptide Y07587_HBx_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESHGRPFSGSLGALSSPSPSTVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
>gnl|hbvpro|Z35716_HBx_P-D Product feature CHAIN Z35716_HBx_P-D of FT:mat_peptide Z35716_HBx_P-D of [Viruses] Hepatitis B Virus genotype D (isolate hb321). Complete genome. [Hepadnaviridae] (length=154 residues).
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRME
TTVNAHQFLPKVLHKRTLGLSVMSTTDLEAYFKDCLFKDWEELGEEVRLKVFVLGGCRHKLVCAPAPCNFFTSA
© 1998-2019