HBVdb

Dataset for protein LHBs of genotype D

[Download (right click)] [Alignment] [Repertoires]

1318 sequence(s)

>gnl|hbvpro|AB048701_LHBs_P-D Product feature CHAIN AB048701_LHBs_P-D of FT:mat_peptide AB048701_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPTLSTSSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCVGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB078031_LHBs_P-D Product feature CHAIN AB078031_LHBs_P-D of FT:mat_peptide AB078031_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FH1-YS). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB078032_LHBs_P-D Product feature CHAIN AB078032_LHBs_P-D of FT:mat_peptide AB078032_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AH1-SY). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTFPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB078033_LHBs_P-D Product feature CHAIN AB078033_LHBs_P-D of FT:mat_peptide AB078033_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IS1-OY). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB090268_LHBs_P-D Product feature CHAIN AB090268_LHBs_P-D of FT:mat_peptide AB090268_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDGNKVGAGAFGPGFTPPHGGLLGWSPQAQGILTTLPAN
PPPASTNRQSGRQSTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB090269_LHBs_P-D Product feature CHAIN AB090269_LHBs_P-D of FT:mat_peptide AB090269_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=393 residues).
MGQNMEKNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQT
LPANPPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSR
IGDPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYR
WMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIP
SSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB090270_LHBs_P-D Product feature CHAIN AB090270_LHBs_P-D of FT:mat_peptide AB090270_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRGRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB104709_LHBs_P-D Product feature CHAIN AB104709_LHBs_P-D of FT:mat_peptide AB104709_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG64). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB104710_LHBs_P-D Product feature CHAIN AB104710_LHBs_P-D of FT:mat_peptide AB104710_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG105). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB104711_LHBs_P-D Product feature CHAIN AB104711_LHBs_P-D of FT:mat_peptide AB104711_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG104). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWSWGPSLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB104712_LHBs_P-D Product feature CHAIN AB104712_LHBs_P-D of FT:mat_peptide AB104712_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG75). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109475_LHBs_P-D Product feature CHAIN AB109475_LHBs_P-D of FT:mat_peptide AB109475_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPMGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109476_LHBs_P-D Product feature CHAIN AB109476_LHBs_P-D of FT:mat_peptide AB109476_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109477_LHBs_P-D Product feature CHAIN AB109477_LHBs_P-D of FT:mat_peptide AB109477_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109478_LHBs_P-D Product feature CHAIN AB109478_LHBs_P-D of FT:mat_peptide AB109478_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMTTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109479_LHBs_P-D Product feature CHAIN AB109479_LHBs_P-D of FT:mat_peptide AB109479_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB110075_LHBs_P-D Product feature CHAIN AB110075_LHBs_P-D of FT:mat_peptide AB110075_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB116266_LHBs_P-D Product feature CHAIN AB116266_LHBs_P-D of FT:mat_peptide AB116266_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPIKDTWPDAKKVGAGAFGLGFTPPHGGLLGTSPQAQGIIETLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119251_LHBs_P-D Product feature CHAIN AB119251_LHBs_P-D of FT:mat_peptide AB119251_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119252_LHBs_P-D Product feature CHAIN AB119252_LHBs_P-D of FT:mat_peptide AB119252_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119253_LHBs_P-D Product feature CHAIN AB119253_LHBs_P-D of FT:mat_peptide AB119253_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119254_LHBs_P-D Product feature CHAIN AB119254_LHBs_P-D of FT:mat_peptide AB119254_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119255_LHBs_P-D Product feature CHAIN AB119255_LHBs_P-D of FT:mat_peptide AB119255_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPAN
PPPASTNRRSTRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB120308_LHBs_P-D Product feature CHAIN AB120308_LHBs_P-D of FT:mat_peptide AB120308_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB126581_LHBs_P-D Product feature CHAIN AB126581_LHBs_P-D of FT:mat_peptide AB126581_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU301). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTWTTPGQGTSMYPSWCWTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB188241_LHBs_P-D Product feature CHAIN AB188241_LHBs_P-D of FT:mat_peptide AB188241_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA25). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQSLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
AMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVYPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB188242_LHBs_P-D Product feature CHAIN AB188242_LHBs_P-D of FT:mat_peptide AB188242_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA38). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMTTLPAN
PPPASTNRKSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB188244_LHBs_P-D Product feature CHAIN AB188244_LHBs_P-D of FT:mat_peptide AB188244_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZ24). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMWPSCCCTKPTDGNCTCIPIPSSWA
FAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205126_LHBs_P-D Product feature CHAIN AB205126_LHBs_P-D of FT:mat_peptide AB205126_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-IF714-1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205127_LHBs_P-D Product feature CHAIN AB205127_LHBs_P-D of FT:mat_peptide AB205127_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU313-2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205128_LHBs_P-D Product feature CHAIN AB205128_LHBs_P-D of FT:mat_peptide AB205128_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU316-1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTAHPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRIFTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFPFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSSTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB210820_LHBs_P-D Product feature CHAIN AB210820_LHBs_P-D of FT:mat_peptide AB210820_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGKVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB210821_LHBs_P-D Product feature CHAIN AB210821_LHBs_P-D of FT:mat_peptide AB210821_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB210822_LHBs_P-D Product feature CHAIN AB210822_LHBs_P-D of FT:mat_peptide AB210822_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222709_LHBs_P-D Product feature CHAIN AB222709_LHBs_P-D of FT:mat_peptide AB222709_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV34). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSRRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
XLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222710_LHBs_P-D Product feature CHAIN AB222710_LHBs_P-D of FT:mat_peptide AB222710_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6M). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=388 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSRRQPTPLSPPLRNTHPQAQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDPX
LNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLR
RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAF
GKFLWEWASARFCWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222711_LHBs_P-D Product feature CHAIN AB222711_LHBs_P-D of FT:mat_peptide AB222711_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNV24). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222712_LHBs_P-D Product feature CHAIN AB222712_LHBs_P-D of FT:mat_peptide AB222712_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV61). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIXSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222713_LHBs_P-D Product feature CHAIN AB222713_LHBs_P-D of FT:mat_peptide AB222713_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246347_LHBs_P-D Product feature CHAIN AB246347_LHBs_P-D of FT:mat_peptide AB246347_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246348_LHBs_P-D Product feature CHAIN AB246348_LHBs_P-D of FT:mat_peptide AB246348_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQSSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB267090_LHBs_P-D Product feature CHAIN AB267090_LHBs_P-D of FT:mat_peptide AB267090_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ehime 22-HS). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270539_LHBs_P-D Product feature CHAIN AB270539_LHBs_P-D of FT:mat_peptide AB270539_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL200F). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDH
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270541_LHBs_P-D Product feature CHAIN AB270541_LHBs_P-D of FT:mat_peptide AB270541_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL47F). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRMXSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|AB270542_LHBs_P-D Product feature CHAIN AB270542_LHBs_P-D of FT:mat_peptide AB270542_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL12F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPXTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270543_LHBs_P-D Product feature CHAIN AB270543_LHBs_P-D of FT:mat_peptide AB270543_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL209F). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270546_LHBs_P-D Product feature CHAIN AB270546_LHBs_P-D of FT:mat_peptide AB270546_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL88F). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
AXNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270547_LHBs_P-D Product feature CHAIN AB270547_LHBs_P-D of FT:mat_peptide AB270547_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL295F). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB270548_LHBs_P-D Product feature CHAIN AB270548_LHBs_P-D of FT:mat_peptide AB270548_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL207F). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270550_LHBs_P-D Product feature CHAIN AB270550_LHBs_P-D of FT:mat_peptide AB270550_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL247F). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFQQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB330367_LHBs_P-D Product feature CHAIN AB330367_LHBs_P-D of FT:mat_peptide AB330367_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ14HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRVTHPQAMQWNSTTFHQTLQDSRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRLMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB330369_LHBs_P-D Product feature CHAIN AB330369_LHBs_P-D of FT:mat_peptide AB330369_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ5HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB330370_LHBs_P-D Product feature CHAIN AB330370_LHBs_P-D of FT:mat_peptide AB330370_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ6HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB471856_LHBs_P-D Product feature CHAIN AB471856_LHBs_P-D of FT:mat_peptide AB471856_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471857_LHBs_P-D Product feature CHAIN AB471857_LHBs_P-D of FT:mat_peptide AB471857_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB493846_LHBs_P-D Product feature CHAIN AB493846_LHBs_P-D of FT:mat_peptide AB493846_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17UC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIYSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB555496_LHBs_P-D Product feature CHAIN AB555496_LHBs_P-D of FT:mat_peptide AB555496_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA31). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDL
ALNMENITSGFLGALLMIQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB555497_LHBs_P-D Product feature CHAIN AB555497_LHBs_P-D of FT:mat_peptide AB555497_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA37). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRETHPQAMQWKSTNFQQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSKIGGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB555500_LHBs_P-D Product feature CHAIN AB555500_LHBs_P-D of FT:mat_peptide AB555500_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA64). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTCCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLLNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB555501_LHBs_P-D Product feature CHAIN AB555501_LHBs_P-D of FT:mat_peptide AB555501_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA65). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
AMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFLCLWVFI
>gnl|hbvpro|AB583680_LHBs_P-D Product feature CHAIN AB583680_LHBs_P-D of FT:mat_peptide AB583680_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pkst7912). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674405_LHBs_P-D Product feature CHAIN AB674405_LHBs_P-D of FT:mat_peptide AB674405_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraHCCA12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674406_LHBs_P-D Product feature CHAIN AB674406_LHBs_P-D of FT:mat_peptide AB674406_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB23). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALKMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGATVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674407_LHBs_P-D Product feature CHAIN AB674407_LHBs_P-D of FT:mat_peptide AB674407_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD35). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB674408_LHBs_P-D Product feature CHAIN AB674408_LHBs_P-D of FT:mat_peptide AB674408_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD83). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLEWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674411_LHBs_P-D Product feature CHAIN AB674411_LHBs_P-D of FT:mat_peptide AB674411_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD84). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSISSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWFSVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674416_LHBs_P-D Product feature CHAIN AB674416_LHBs_P-D of FT:mat_peptide AB674416_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE19). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRDTHPQAIQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGGP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674419_LHBs_P-D Product feature CHAIN AB674419_LHBs_P-D of FT:mat_peptide AB674419_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC16). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAIQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWCWGPSLYSILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|AB674420_LHBs_P-D Product feature CHAIN AB674420_LHBs_P-D of FT:mat_peptide AB674420_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunLCD2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWA
FAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB674422_LHBs_P-D Product feature CHAIN AB674422_LHBs_P-D of FT:mat_peptide AB674422_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674423_LHBs_P-D Product feature CHAIN AB674423_LHBs_P-D of FT:mat_peptide AB674423_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD18). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILHTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTVSPISSILSRIGDL
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674424_LHBs_P-D Product feature CHAIN AB674424_LHBs_P-D of FT:mat_peptide AB674424_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE24). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQNPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGVP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTSPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674425_LHBs_P-D Product feature CHAIN AB674425_LHBs_P-D of FT:mat_peptide AB674425_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE44). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPPSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTANPVPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674427_LHBs_P-D Product feature CHAIN AB674427_LHBs_P-D of FT:mat_peptide AB674427_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD54). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLLRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674428_LHBs_P-D Product feature CHAIN AB674428_LHBs_P-D of FT:mat_peptide AB674428_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB26). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQATQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTSPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674431_LHBs_P-D Product feature CHAIN AB674431_LHBs_P-D of FT:mat_peptide AB674431_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC27). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSRFLGPLLGLLAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF043593_LHBs_P-D Product feature CHAIN AF043593_LHBs_P-D of FT:mat_peptide AF043593_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6/89). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=385 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRPAGGSSSGTVNPVPTTASPISSIFSRIGDPALNM
ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFI
IFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKF
LWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF043594_LHBs_P-D Product feature CHAIN AF043594_LHBs_P-D of FT:mat_peptide AF043594_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1/91). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF121239_LHBs_P-D Product feature CHAIN AF121239_LHBs_P-D of FT:mat_peptide AF121239_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1303). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF121240_LHBs_C-D Product feature CHAIN AF121240_LHBs_C-D of FT:mat_peptide AF121240_LHBs_C-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/11066). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF121241_LHBs_P-D Product feature CHAIN AF121241_LHBs_P-D of FT:mat_peptide AF121241_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1758). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF121242_LHBs_P-D Product feature CHAIN AF121242_LHBs_P-D of FT:mat_peptide AF121242_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1218). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF151735_LHBs_P-D Product feature CHAIN AF151735_LHBs_P-D of FT:mat_peptide AF151735_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISLIFSKIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSEGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF280817_LHBs_P-D Product feature CHAIN AF280817_LHBs_P-D of FT:mat_peptide AF280817_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-D1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ131956_LHBs_P-D Product feature CHAIN AJ131956_LHBs_P-D of FT:mat_peptide AJ131956_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ344116_LHBs_P-D Product feature CHAIN AJ344116_LHBs_P-D of FT:mat_peptide AJ344116_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBsAg negative patient GX27). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ627215_LHBs_P-D Product feature CHAIN AJ627215_LHBs_P-D of FT:mat_peptide AJ627215_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 06115). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSRFLPLLPIFLCLWVYI
>gnl|hbvpro|AJ627216_LHBs_P-D Product feature CHAIN AJ627216_LHBs_P-D of FT:mat_peptide AJ627216_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17707). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGVXQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSRFLPLLPIFXCLWVYI
>gnl|hbvpro|AJ627218_LHBs_P-D Product feature CHAIN AJ627218_LHBs_P-D of FT:mat_peptide AJ627218_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 21116). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGVMQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSRFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ627219_LHBs_P-D Product feature CHAIN AJ627219_LHBs_P-D of FT:mat_peptide AJ627219_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 24039). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQSXPAN
PPPASTNRKSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ627220_LHBs_P-D Product feature CHAIN AJ627220_LHBs_P-D of FT:mat_peptide AJ627220_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 29234). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIXQTLPAN
PPPASTNRQSARQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGNSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ627222_LHBs_P-D Product feature CHAIN AJ627222_LHBs_P-D of FT:mat_peptide AJ627222_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 31228). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTSARIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLQIFFCLWVYI
>gnl|hbvpro|AJ627223_LHBs_P-D Product feature CHAIN AJ627223_LHBs_P-D of FT:mat_peptide AJ627223_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33720). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVTPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ627224_LHBs_P-D Product feature CHAIN AJ627224_LHBs_P-D of FT:mat_peptide AJ627224_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33852). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AM422939_LHBs_P-D Product feature CHAIN AM422939_LHBs_P-D of FT:mat_peptide AM422939_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate X28). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY090452_LHBs_P-D Product feature CHAIN AY090452_LHBs_P-D of FT:mat_peptide AY090452_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGITQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFQQTLQDPRVKGLFLPAGGSSSGTVNPVPTTASPISSIFSRIGAP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY090453_LHBs_P-D Product feature CHAIN AY090453_LHBs_P-D of FT:mat_peptide AY090453_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWSDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RHFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCKTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFFWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161150_LHBs_P-D Product feature CHAIN AY161150_LHBs_P-D of FT:mat_peptide AY161150_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSISNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSIHPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161157_LHBs_P-D Product feature CHAIN AY161157_LHBs_P-D of FT:mat_peptide AY161157_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPASNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161158_LHBs_P-D Product feature CHAIN AY161158_LHBs_P-D of FT:mat_peptide AY161158_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPASNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY233291_LHBs_P-D Product feature CHAIN AY233291_LHBs_P-D of FT:mat_peptide AY233291_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 179). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWP
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY233292_LHBs_P-D Product feature CHAIN AY233292_LHBs_P-D of FT:mat_peptide AY233292_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 184). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPIPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY233294_LHBs_P-D Product feature CHAIN AY233294_LHBs_P-D of FT:mat_peptide AY233294_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 305). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVRLSPTVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233296_LHBs_P-D Product feature CHAIN AY233296_LHBs_P-D of FT:mat_peptide AY233296_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 185). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFSPLLPIFFCLWVYI
>gnl|hbvpro|AY236160_LHBs_P-D Product feature CHAIN AY236160_LHBs_P-D of FT:mat_peptide AY236160_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1A). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTQPHGGLLGWSPQVQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARSSWLSLLVPFVQGFGGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|AY236162_LHBs_P-D Product feature CHAIN AY236162_LHBs_P-D of FT:mat_peptide AY236162_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 23A). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY661792_LHBs_P-D Product feature CHAIN AY661792_LHBs_P-D of FT:mat_peptide AY661792_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ayw). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPTSTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY661793_LHBs_P-D Product feature CHAIN AY661793_LHBs_P-D of FT:mat_peptide AY661793_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGRGFTPPHGGLLGWSPQAQGILQTLPAN
PPPTSTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721605_LHBs_P-D Product feature CHAIN AY721605_LHBs_P-D of FT:mat_peptide AY721605_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AK1.1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721606_LHBs_P-D Product feature CHAIN AY721606_LHBs_P-D of FT:mat_peptide AY721606_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AT1.2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721607_LHBs_P-D Product feature CHAIN AY721607_LHBs_P-D of FT:mat_peptide AY721607_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HIY1.3). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721608_LHBs_P-D Product feature CHAIN AY721608_LHBs_P-D of FT:mat_peptide AY721608_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IB1.4). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721612_LHBs_P-D Product feature CHAIN AY721612_LHBs_P-D of FT:mat_peptide AY721612_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BL1.8). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTYHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741794_LHBs_P-D Product feature CHAIN AY741794_LHBs_P-D of FT:mat_peptide AY741794_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-50). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPVPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741795_LHBs_P-D Product feature CHAIN AY741795_LHBs_P-D of FT:mat_peptide AY741795_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-Hi). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPVPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741796_LHBs_P-D Product feature CHAIN AY741796_LHBs_P-D of FT:mat_peptide AY741796_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P3). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVWPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPVPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741797_LHBs_P-D Product feature CHAIN AY741797_LHBs_P-D of FT:mat_peptide AY741797_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-21). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741798_LHBs_P-D Product feature CHAIN AY741798_LHBs_P-D of FT:mat_peptide AY741798_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDTTVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPVIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSILRPFIPLLSIFFGLWVFI
>gnl|hbvpro|AY796030_LHBs_P-D Product feature CHAIN AY796030_LHBs_P-D of FT:mat_peptide AY796030_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FC1.9). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTHRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY796031_LHBs_P-D Product feature CHAIN AY796031_LHBs_P-D of FT:mat_peptide AY796031_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RA1.10). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNTTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY796032_LHBs_P-D Product feature CHAIN AY796032_LHBs_P-D of FT:mat_peptide AY796032_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NA1.11). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAHKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY945307_LHBs_P-D Product feature CHAIN AY945307_LHBs_P-D of FT:mat_peptide AY945307_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
LGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ111986_LHBs_P-D Product feature CHAIN DQ111986_LHBs_P-D of FT:mat_peptide DQ111986_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MBT181). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGMGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPPSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGVP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ304547_LHBs_P-D Product feature CHAIN DQ304547_LHBs_P-D of FT:mat_peptide DQ304547_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLAVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ304548_LHBs_P-D Product feature CHAIN DQ304548_LHBs_P-D of FT:mat_peptide DQ304548_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISTIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ304550_LHBs_P-D Product feature CHAIN DQ304550_LHBs_P-D of FT:mat_peptide DQ304550_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSRTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ304551_LHBs_P-D Product feature CHAIN DQ304551_LHBs_P-D of FT:mat_peptide DQ304551_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSRTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ315776_LHBs_P-D Product feature CHAIN DQ315776_LHBs_P-D of FT:mat_peptide DQ315776_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI00615). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ329356_LHBs_P-D Product feature CHAIN DQ329356_LHBs_P-D of FT:mat_peptide DQ329356_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFLPDHQLDPAFRANTGNPDWDFNPNKDTWQDANKEGAGAFGLGFTQPHGGLLGWSPQVQGMLQTLPAN
PPPASTNRQSGRQPTPLSQPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ329357_LHBs_P-D Product feature CHAIN DQ329357_LHBs_P-D of FT:mat_peptide DQ329357_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFLPDHQLDPAFRANTGNPDWDFNPNKDTWQDANKVGAGAFGLGFTQPHGGLLGWSPQVQGMLQTLPAN
PPPASTNRQSGRQPTPLSQPLRNTHPQAMQWNSSTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336674_LHBs_P-D Product feature CHAIN DQ336674_LHBs_P-D of FT:mat_peptide DQ336674_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336675_LHBs_P-D Product feature CHAIN DQ336675_LHBs_P-D of FT:mat_peptide DQ336675_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336676_LHBs_P-D Product feature CHAIN DQ336676_LHBs_P-D of FT:mat_peptide DQ336676_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336677_LHBs_P-D Product feature CHAIN DQ336677_LHBs_P-D of FT:mat_peptide DQ336677_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336678_LHBs_P-D Product feature CHAIN DQ336678_LHBs_P-D of FT:mat_peptide DQ336678_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336679_LHBs_P-D Product feature CHAIN DQ336679_LHBs_P-D of FT:mat_peptide DQ336679_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336685_LHBs_P-D Product feature CHAIN DQ336685_LHBs_P-D of FT:mat_peptide DQ336685_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336686_LHBs_P-D Product feature CHAIN DQ336686_LHBs_P-D of FT:mat_peptide DQ336686_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCS
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336687_LHBs_P-D Product feature CHAIN DQ336687_LHBs_P-D of FT:mat_peptide DQ336687_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQSDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCS
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336688_LHBs_P-D Product feature CHAIN DQ336688_LHBs_P-D of FT:mat_peptide DQ336688_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDYQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCS
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336689_LHBs_P-D Product feature CHAIN DQ336689_LHBs_P-D of FT:mat_peptide DQ336689_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSETANPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336690_LHBs_P-D Product feature CHAIN DQ336690_LHBs_P-D of FT:mat_peptide DQ336690_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRMGTL
ALNMENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILGPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336691_LHBs_P-D Product feature CHAIN DQ336691_LHBs_P-D of FT:mat_peptide DQ336691_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASNKCQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWDWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|DQ336692_LHBs_P-D Product feature CHAIN DQ336692_LHBs_P-D of FT:mat_peptide DQ336692_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCS
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ399006_LHBs_P-D Product feature CHAIN DQ399006_LHBs_P-D of FT:mat_peptide DQ399006_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate G1). Complete genome. [Hepadnaviridae] (length=392 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPICPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPS
SWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464168_LHBs_P-D Product feature CHAIN DQ464168_LHBs_P-D of FT:mat_peptide DQ464168_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRAATANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSEQVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGCRWVCL
RRFVSFLFSLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464169_LHBs_P-D Product feature CHAIN DQ464169_LHBs_P-D of FT:mat_peptide DQ464169_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPGWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTRLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGILGPLLVLQAGFFLLTRILTIRQSLDSWWTSLNFLGGTTVCLGENSQSPTSNHSPTSCPPTCPGYRSMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464170_LHBs_P-D Product feature CHAIN DQ464170_LHBs_P-D of FT:mat_peptide DQ464170_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPHHQLDPAFRSNTANPDWDFNPNKNTWPDANKVGAGAFGLGFTPPHGGLLGWDPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGENSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464172_LHBs_P-D Product feature CHAIN DQ464172_LHBs_P-D of FT:mat_peptide DQ464172_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|DQ464173_LHBs_P-D Product feature CHAIN DQ464173_LHBs_P-D of FT:mat_peptide DQ464173_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|DQ464174_LHBs_P-D Product feature CHAIN DQ464174_LHBs_P-D of FT:mat_peptide DQ464174_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464175_LHBs_P-D Product feature CHAIN DQ464175_LHBs_P-D of FT:mat_peptide DQ464175_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILCPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464176_LHBs_P-D Product feature CHAIN DQ464176_LHBs_P-D of FT:mat_peptide DQ464176_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASSNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464177_LHBs_P-D Product feature CHAIN DQ464177_LHBs_P-D of FT:mat_peptide DQ464177_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464178_LHBs_P-D Product feature CHAIN DQ464178_LHBs_P-D of FT:mat_peptide DQ464178_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTAIPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVGPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILCPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464182_LHBs_P-D Product feature CHAIN DQ464182_LHBs_P-D of FT:mat_peptide DQ464182_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGRNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGFSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTFAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ486021_LHBs_P-D Product feature CHAIN DQ486021_LHBs_P-D of FT:mat_peptide DQ486021_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT13). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILAIPQCLDSWRTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFWLWVYI
>gnl|hbvpro|DQ486025_LHBs_P-D Product feature CHAIN DQ486025_LHBs_P-D of FT:mat_peptide DQ486025_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAVQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSHFLPLLPIFFCLWVYI
>gnl|hbvpro|EF103275_LHBs_P-D Product feature CHAIN EF103275_LHBs_P-D of FT:mat_peptide EF103275_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran11). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF103276_LHBs_P-D Product feature CHAIN EF103276_LHBs_P-D of FT:mat_peptide EF103276_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran22). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPPPLSPPLRNTHPQAMQWNPTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQQLQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMLWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF103277_LHBs_P-D Product feature CHAIN EF103277_LHBs_P-D of FT:mat_peptide EF103277_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran33). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSPNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCV
RRLIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF103281_LHBs_P-D Product feature CHAIN EF103281_LHBs_P-D of FT:mat_peptide EF103281_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLFTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRGEGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWPSARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU155893_LHBs_P-D Product feature CHAIN EU155893_LHBs_P-D of FT:mat_peptide EU155893_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANQDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPVSTNRQSRRQPTPLSPPLRNTHPQAMQWNSKTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMGNITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDCQGMLPVCPLISGSSTTSTGPCRPCITTAQETSMFASCCCTKPLDGNYTCIPIPSSWA
FGKFLWEWASARFSWLSSLVPFVQWFAGLSPTVWLSVIWTMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU155895_LHBs_P-D Product feature CHAIN EU155895_LHBs_P-D of FT:mat_peptide EU155895_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5b). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGSLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHHTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALSMENITSGFLGPLLVLQAGFFLLTRILRIPQSLDSWWTSLNFQGGTTVCLGQNSQSPTFNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFSLALLDYRGMLPVCPPMLASSNTSRGTCRSCMIHAPGTSMSPFCCCTKPSDGNCTCIPIPSSWA
FGKFLWGWASARFSWLSSLVQFVQWFVGLSPTVWLSVIWMIWYWGPSLYSILSPFLPLLPISFYLWVYI
>gnl|hbvpro|EU414135_LHBs_P-D Product feature CHAIN EU414135_LHBs_P-D of FT:mat_peptide EU414135_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQBPXVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414136_LHBs_P-D Product feature CHAIN EU414136_LHBs_P-D of FT:mat_peptide EU414136_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRHSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDANCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414138_LHBs_P-D Product feature CHAIN EU414138_LHBs_P-D of FT:mat_peptide EU414138_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGXNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPYVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414139_LHBs_P-D Product feature CHAIN EU414139_LHBs_P-D of FT:mat_peptide EU414139_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414140_LHBs_P-D Product feature CHAIN EU414140_LHBs_P-D of FT:mat_peptide EU414140_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASXISSIFSRIGDP
VPNMESITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTXVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDXQGMLPVCPLIPGSSTTSXGPCXTCTTXXQGTSMXPSCCCXKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414141_LHBs_P-D Product feature CHAIN EU414141_LHBs_P-D of FT:mat_peptide EU414141_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGIIQTXPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414142_LHBs_P-D Product feature CHAIN EU414142_LHBs_P-D of FT:mat_peptide EU414142_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGXLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSXIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414143_LHBs_P-D Product feature CHAIN EU414143_LHBs_P-D of FT:mat_peptide EU414143_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594382_LHBs_P-D Product feature CHAIN EU594382_LHBs_P-D of FT:mat_peptide EU594382_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRTGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594396_LHBs_P-D Product feature CHAIN EU594396_LHBs_P-D of FT:mat_peptide EU594396_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594397_LHBs_P-D Product feature CHAIN EU594397_LHBs_P-D of FT:mat_peptide EU594397_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594398_LHBs_P-D Product feature CHAIN EU594398_LHBs_P-D of FT:mat_peptide EU594398_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTAAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594399_LHBs_P-D Product feature CHAIN EU594399_LHBs_P-D of FT:mat_peptide EU594399_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594400_LHBs_P-D Product feature CHAIN EU594400_LHBs_P-D of FT:mat_peptide EU594400_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRHSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594401_LHBs_P-D Product feature CHAIN EU594401_LHBs_P-D of FT:mat_peptide EU594401_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594402_LHBs_P-D Product feature CHAIN EU594402_LHBs_P-D of FT:mat_peptide EU594402_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594403_LHBs_P-D Product feature CHAIN EU594403_LHBs_P-D of FT:mat_peptide EU594403_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594404_LHBs_P-D Product feature CHAIN EU594404_LHBs_P-D of FT:mat_peptide EU594404_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594405_LHBs_P-D Product feature CHAIN EU594405_LHBs_P-D of FT:mat_peptide EU594405_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRTLTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594407_LHBs_P-D Product feature CHAIN EU594407_LHBs_P-D of FT:mat_peptide EU594407_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FAKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594408_LHBs_P-D Product feature CHAIN EU594408_LHBs_P-D of FT:mat_peptide EU594408_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU594409_LHBs_P-D Product feature CHAIN EU594409_LHBs_P-D of FT:mat_peptide EU594409_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594410_LHBs_P-D Product feature CHAIN EU594410_LHBs_P-D of FT:mat_peptide EU594410_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594413_LHBs_P-D Product feature CHAIN EU594413_LHBs_P-D of FT:mat_peptide EU594413_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594414_LHBs_P-D Product feature CHAIN EU594414_LHBs_P-D of FT:mat_peptide EU594414_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594415_LHBs_P-D Product feature CHAIN EU594415_LHBs_P-D of FT:mat_peptide EU594415_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594416_LHBs_P-D Product feature CHAIN EU594416_LHBs_P-D of FT:mat_peptide EU594416_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594417_LHBs_P-D Product feature CHAIN EU594417_LHBs_P-D of FT:mat_peptide EU594417_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594418_LHBs_P-D Product feature CHAIN EU594418_LHBs_P-D of FT:mat_peptide EU594418_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594419_LHBs_P-D Product feature CHAIN EU594419_LHBs_P-D of FT:mat_peptide EU594419_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594420_LHBs_P-D Product feature CHAIN EU594420_LHBs_P-D of FT:mat_peptide EU594420_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594421_LHBs_P-D Product feature CHAIN EU594421_LHBs_P-D of FT:mat_peptide EU594421_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594422_LHBs_P-D Product feature CHAIN EU594422_LHBs_P-D of FT:mat_peptide EU594422_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594423_LHBs_P-D Product feature CHAIN EU594423_LHBs_P-D of FT:mat_peptide EU594423_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594424_LHBs_P-D Product feature CHAIN EU594424_LHBs_P-D of FT:mat_peptide EU594424_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594425_LHBs_P-D Product feature CHAIN EU594425_LHBs_P-D of FT:mat_peptide EU594425_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPXYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVELSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594426_LHBs_P-D Product feature CHAIN EU594426_LHBs_P-D of FT:mat_peptide EU594426_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594427_LHBs_P-D Product feature CHAIN EU594427_LHBs_P-D of FT:mat_peptide EU594427_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FAKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594428_LHBs_P-D Product feature CHAIN EU594428_LHBs_P-D of FT:mat_peptide EU594428_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594429_LHBs_P-D Product feature CHAIN EU594429_LHBs_P-D of FT:mat_peptide EU594429_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594430_LHBs_P-D Product feature CHAIN EU594430_LHBs_P-D of FT:mat_peptide EU594430_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594431_LHBs_P-D Product feature CHAIN EU594431_LHBs_P-D of FT:mat_peptide EU594431_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594432_LHBs_P-D Product feature CHAIN EU594432_LHBs_P-D of FT:mat_peptide EU594432_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594433_LHBs_P-D Product feature CHAIN EU594433_LHBs_P-D of FT:mat_peptide EU594433_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGTCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594434_LHBs_P-D Product feature CHAIN EU594434_LHBs_P-D of FT:mat_peptide EU594434_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLHTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGPSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|EU787436_LHBs_P-D Product feature CHAIN EU787436_LHBs_P-D of FT:mat_peptide EU787436_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 165). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787437_LHBs_P-D Product feature CHAIN EU787437_LHBs_P-D of FT:mat_peptide EU787437_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787438_LHBs_P-D Product feature CHAIN EU787438_LHBs_P-D of FT:mat_peptide EU787438_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=388 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTIPTH
PPPASTNRQSGRQPTPLSPPLRNTHPQAQWNSTTFHQTLQDPRVRGLTFPAGGSSSGTVNPVPTTVSPISSIFSRIGDPA
LNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLR
RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAF
GKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787440_LHBs_P-D Product feature CHAIN EU787440_LHBs_P-D of FT:mat_peptide EU787440_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W17). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPHASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787441_LHBs_P-D Product feature CHAIN EU787441_LHBs_P-D of FT:mat_peptide EU787441_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787442_LHBs_P-D Product feature CHAIN EU787442_LHBs_P-D of FT:mat_peptide EU787442_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W37). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRKSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787443_LHBs_P-D Product feature CHAIN EU787443_LHBs_P-D of FT:mat_peptide EU787443_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate w40). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU787446_LHBs_P-D Product feature CHAIN EU787446_LHBs_P-D of FT:mat_peptide EU787446_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W75). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787447_LHBs_P-D Product feature CHAIN EU787447_LHBs_P-D of FT:mat_peptide EU787447_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W46). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVSLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU919197_LHBs_P-D Product feature CHAIN EU919197_LHBs_P-D of FT:mat_peptide EU919197_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJU). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFTIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPYCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU921418_LHBs_P-D Product feature CHAIN EU921418_LHBs_P-D of FT:mat_peptide EU921418_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.165.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FAKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU921419_LHBs_P-D Product feature CHAIN EU921419_LHBs_P-D of FT:mat_peptide EU921419_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.252.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939680_LHBs_P-D Product feature CHAIN EU939680_LHBs_P-D of FT:mat_peptide EU939680_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C186). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTIPAQGTSMYPSCCCTKASDRNCTCIPIPSSWA
FGKFLWEWASAHFSLLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939681_LHBs_P-D Product feature CHAIN EU939681_LHBs_P-D of FT:mat_peptide EU939681_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349205_LHBs_P-D Product feature CHAIN FJ349205_LHBs_P-D of FT:mat_peptide FJ349205_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349206_LHBs_P-D Product feature CHAIN FJ349206_LHBs_P-D of FT:mat_peptide FJ349206_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFARIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FJ349208_LHBs_P-D Product feature CHAIN FJ349208_LHBs_P-D of FT:mat_peptide FJ349208_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H25). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349209_LHBs_P-D Product feature CHAIN FJ349209_LHBs_P-D of FT:mat_peptide FJ349209_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H29). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349213_LHBs_P-D Product feature CHAIN FJ349213_LHBs_P-D of FT:mat_peptide FJ349213_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H59). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349214_LHBs_P-D Product feature CHAIN FJ349214_LHBs_P-D of FT:mat_peptide FJ349214_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H61). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPHAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ARSMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349215_LHBs_P-D Product feature CHAIN FJ349215_LHBs_P-D of FT:mat_peptide FJ349215_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H82). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWRPQAQGILQTLPTN
PPPASTNRQPGRQPTTLSPPLRNTHHQAMKWNSTTFHQTLQDPRVKGLNLPAGGSSSGTGNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVIQAGFFLLIRILTITHSLDSWWTSLNFLGGTTVCVVQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349216_LHBs_P-D Product feature CHAIN FJ349216_LHBs_P-D of FT:mat_peptide FJ349216_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H113). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349218_LHBs_P-D Product feature CHAIN FJ349218_LHBs_P-D of FT:mat_peptide FJ349218_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H135). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTASPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPAATNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349219_LHBs_P-D Product feature CHAIN FJ349219_LHBs_P-D of FT:mat_peptide FJ349219_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H138). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIGVP
ALNMENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FJ349220_LHBs_P-D Product feature CHAIN FJ349220_LHBs_P-D of FT:mat_peptide FJ349220_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H144). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349228_LHBs_P-D Product feature CHAIN FJ349228_LHBs_P-D of FT:mat_peptide FJ349228_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C11). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349229_LHBs_P-D Product feature CHAIN FJ349229_LHBs_P-D of FT:mat_peptide FJ349229_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C26). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNPHPGAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349230_LHBs_P-D Product feature CHAIN FJ349230_LHBs_P-D of FT:mat_peptide FJ349230_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C7). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349231_LHBs_P-D Product feature CHAIN FJ349231_LHBs_P-D of FT:mat_peptide FJ349231_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C22). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWFWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349232_LHBs_P-D Product feature CHAIN FJ349232_LHBs_P-D of FT:mat_peptide FJ349232_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C51). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTSAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349233_LHBs_P-D Product feature CHAIN FJ349233_LHBs_P-D of FT:mat_peptide FJ349233_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C54). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSRRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349234_LHBs_P-D Product feature CHAIN FJ349234_LHBs_P-D of FT:mat_peptide FJ349234_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C82). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349235_LHBs_P-D Product feature CHAIN FJ349235_LHBs_P-D of FT:mat_peptide FJ349235_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C90). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
ALNMENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386590_LHBs_P-D Product feature CHAIN FJ386590_LHBs_P-D of FT:mat_peptide FJ386590_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1841). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562338_LHBs_P-D Product feature CHAIN FJ562338_LHBs_P-D of FT:mat_peptide FJ562338_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I192). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIGDX
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTSAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLLLLPIFFCLWVYI
>gnl|hbvpro|FJ692506_LHBs_P-D Product feature CHAIN FJ692506_LHBs_P-D of FT:mat_peptide FJ692506_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50157). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692507_LHBs_P-D Product feature CHAIN FJ692507_LHBs_P-D of FT:mat_peptide FJ692507_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50158). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692532_LHBs_P-D Product feature CHAIN FJ692532_LHBs_P-D of FT:mat_peptide FJ692532_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50053). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692533_LHBs_P-D Product feature CHAIN FJ692533_LHBs_P-D of FT:mat_peptide FJ692533_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50064). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899792_LHBs_P-D Product feature CHAIN FJ899792_LHBs_P-D of FT:mat_peptide FJ899792_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146-1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
ALNMENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904395_LHBs_P-D Product feature CHAIN FJ904395_LHBs_P-D of FT:mat_peptide FJ904395_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A10a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMLYWGPTLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904399_LHBs_P-D Product feature CHAIN FJ904399_LHBs_P-D of FT:mat_peptide FJ904399_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A18). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904402_LHBs_P-D Product feature CHAIN FJ904402_LHBs_P-D of FT:mat_peptide FJ904402_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A26). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTKNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSXTANPVPTTVSPISSIFSRIGDX
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904410_LHBs_P-D Product feature CHAIN FJ904410_LHBs_P-D of FT:mat_peptide FJ904410_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A54b). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTWPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904412_LHBs_P-D Product feature CHAIN FJ904412_LHBs_P-D of FT:mat_peptide FJ904412_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A56). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPSSTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904415_LHBs_P-D Product feature CHAIN FJ904415_LHBs_P-D of FT:mat_peptide FJ904415_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A63). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904418_LHBs_P-D Product feature CHAIN FJ904418_LHBs_P-D of FT:mat_peptide FJ904418_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A69a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTPFHQTLQDPKVSDLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904419_LHBs_P-D Product feature CHAIN FJ904419_LHBs_P-D of FT:mat_peptide FJ904419_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A70). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVFQAGCFLLTRILTMPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|FJ904420_LHBs_P-D Product feature CHAIN FJ904420_LHBs_P-D of FT:mat_peptide FJ904420_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904421_LHBs_P-D Product feature CHAIN FJ904421_LHBs_P-D of FT:mat_peptide FJ904421_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71b). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904422_LHBs_P-D Product feature CHAIN FJ904422_LHBs_P-D of FT:mat_peptide FJ904422_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A76). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904424_LHBs_P-D Product feature CHAIN FJ904424_LHBs_P-D of FT:mat_peptide FJ904424_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A79a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904426_LHBs_P-D Product feature CHAIN FJ904426_LHBs_P-D of FT:mat_peptide FJ904426_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FAKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ904427_LHBs_P-D Product feature CHAIN FJ904427_LHBs_P-D of FT:mat_peptide FJ904427_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSERNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904431_LHBs_P-D Product feature CHAIN FJ904431_LHBs_P-D of FT:mat_peptide FJ904431_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B12). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYHILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904432_LHBs_P-D Product feature CHAIN FJ904432_LHBs_P-D of FT:mat_peptide FJ904432_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B14). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGITPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904433_LHBs_C-D Product feature CHAIN FJ904433_LHBs_C-D of FT:mat_peptide FJ904433_LHBs_C-D of [Viruses] Hepatitis B Virus genotype D (isolate B15). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSPYSIXSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904435_LHBs_P-D Product feature CHAIN FJ904435_LHBs_P-D of FT:mat_peptide FJ904435_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B27). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904438_LHBs_P-D Product feature CHAIN FJ904438_LHBs_P-D of FT:mat_peptide FJ904438_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPIRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
AVNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCTXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904439_LHBs_P-D Product feature CHAIN FJ904439_LHBs_P-D of FT:mat_peptide FJ904439_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B34). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904443_LHBs_P-D Product feature CHAIN FJ904443_LHBs_P-D of FT:mat_peptide FJ904443_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B46). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904445_LHBs_P-D Product feature CHAIN FJ904445_LHBs_P-D of FT:mat_peptide FJ904445_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B62). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ167301_LHBs_P-D Product feature CHAIN GQ167301_LHBs_P-D of FT:mat_peptide GQ167301_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM452). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLQAN
PPPASTNRQTGRQPTPLSPPLRDTHPQAAQWNSTTFQQTLQDPRVRGLNLPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFSLVLLDYRGMLPVCPVIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWPLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ167302_LHBs_P-D Product feature CHAIN GQ167302_LHBs_P-D of FT:mat_peptide GQ167302_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4521). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRDTHPQAVQWNSTTFQQTLQDPRVRGLNLPAGGSSSGTVNPVPTTVSPTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFSLVLLDYRGMLPVCPVIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWPLVIRMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183448_LHBs_P-D Product feature CHAIN GQ183448_LHBs_P-D of FT:mat_peptide GQ183448_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4629). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTIFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183449_LHBs_P-D Product feature CHAIN GQ183449_LHBs_P-D of FT:mat_peptide GQ183449_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4591). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183450_LHBs_P-D Product feature CHAIN GQ183450_LHBs_P-D of FT:mat_peptide GQ183450_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4589). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183451_LHBs_P-D Product feature CHAIN GQ183451_LHBs_P-D of FT:mat_peptide GQ183451_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4588). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183452_LHBs_P-D Product feature CHAIN GQ183452_LHBs_P-D of FT:mat_peptide GQ183452_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4590). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183453_LHBs_P-D Product feature CHAIN GQ183453_LHBs_P-D of FT:mat_peptide GQ183453_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4574). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183454_LHBs_P-D Product feature CHAIN GQ183454_LHBs_P-D of FT:mat_peptide GQ183454_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4582). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183455_LHBs_P-D Product feature CHAIN GQ183455_LHBs_P-D of FT:mat_peptide GQ183455_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4573). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183456_LHBs_P-D Product feature CHAIN GQ183456_LHBs_P-D of FT:mat_peptide GQ183456_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4572). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183457_LHBs_P-D Product feature CHAIN GQ183457_LHBs_P-D of FT:mat_peptide GQ183457_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4583). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183458_LHBs_P-D Product feature CHAIN GQ183458_LHBs_P-D of FT:mat_peptide GQ183458_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4587). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183459_LHBs_P-D Product feature CHAIN GQ183459_LHBs_P-D of FT:mat_peptide GQ183459_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4585). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183460_LHBs_P-D Product feature CHAIN GQ183460_LHBs_P-D of FT:mat_peptide GQ183460_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4584). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183461_LHBs_P-D Product feature CHAIN GQ183461_LHBs_P-D of FT:mat_peptide GQ183461_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4586). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183462_LHBs_P-D Product feature CHAIN GQ183462_LHBs_P-D of FT:mat_peptide GQ183462_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4567). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183463_LHBs_P-D Product feature CHAIN GQ183463_LHBs_P-D of FT:mat_peptide GQ183463_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4613). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183464_LHBs_P-D Product feature CHAIN GQ183464_LHBs_P-D of FT:mat_peptide GQ183464_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4703). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183465_LHBs_P-D Product feature CHAIN GQ183465_LHBs_P-D of FT:mat_peptide GQ183465_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4614). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKGGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183466_LHBs_P-D Product feature CHAIN GQ183466_LHBs_P-D of FT:mat_peptide GQ183466_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4577). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183467_LHBs_P-D Product feature CHAIN GQ183467_LHBs_P-D of FT:mat_peptide GQ183467_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4705). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCV
LRGIILLFLLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFFLWVYI
>gnl|hbvpro|GQ183468_LHBs_P-D Product feature CHAIN GQ183468_LHBs_P-D of FT:mat_peptide GQ183468_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4632). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183469_LHBs_P-D Product feature CHAIN GQ183469_LHBs_P-D of FT:mat_peptide GQ183469_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4602). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183470_LHBs_P-D Product feature CHAIN GQ183470_LHBs_P-D of FT:mat_peptide GQ183470_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4639). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183471_LHBs_P-D Product feature CHAIN GQ183471_LHBs_P-D of FT:mat_peptide GQ183471_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4610). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTSVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183472_LHBs_P-D Product feature CHAIN GQ183472_LHBs_P-D of FT:mat_peptide GQ183472_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4691). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183473_LHBs_P-D Product feature CHAIN GQ183473_LHBs_P-D of FT:mat_peptide GQ183473_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4601). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPLLPLLPFFFCLWVYI
>gnl|hbvpro|GQ183474_LHBs_P-D Product feature CHAIN GQ183474_LHBs_P-D of FT:mat_peptide GQ183474_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4594). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183475_LHBs_P-D Product feature CHAIN GQ183475_LHBs_P-D of FT:mat_peptide GQ183475_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4575). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183476_LHBs_P-D Product feature CHAIN GQ183476_LHBs_P-D of FT:mat_peptide GQ183476_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4603). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183477_LHBs_P-D Product feature CHAIN GQ183477_LHBs_P-D of FT:mat_peptide GQ183477_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4604). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183478_LHBs_P-D Product feature CHAIN GQ183478_LHBs_P-D of FT:mat_peptide GQ183478_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4605). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183479_LHBs_P-D Product feature CHAIN GQ183479_LHBs_P-D of FT:mat_peptide GQ183479_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4607). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMRL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183480_LHBs_P-D Product feature CHAIN GQ183480_LHBs_P-D of FT:mat_peptide GQ183480_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4609). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGPSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183481_LHBs_P-D Product feature CHAIN GQ183481_LHBs_P-D of FT:mat_peptide GQ183481_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4569). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183482_LHBs_P-D Product feature CHAIN GQ183482_LHBs_P-D of FT:mat_peptide GQ183482_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4570). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183483_LHBs_P-D Product feature CHAIN GQ183483_LHBs_P-D of FT:mat_peptide GQ183483_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4566). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183485_LHBs_P-D Product feature CHAIN GQ183485_LHBs_P-D of FT:mat_peptide GQ183485_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4599). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLFGWNPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ184322_LHBs_P-D Product feature CHAIN GQ184322_LHBs_P-D of FT:mat_peptide GQ184322_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4522). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPPN
PPPASTNRQTGRQPTPLSPPLRDTHPQAVQWNSTTFQQTLQDSRVRGLNLPAGGSSSGTVNPVPTTVPPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPVIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWPLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205380_LHBs_P-D Product feature CHAIN GQ205380_LHBs_P-D of FT:mat_peptide GQ205380_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1245). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205382_LHBs_P-D Product feature CHAIN GQ205382_LHBs_P-D of FT:mat_peptide GQ205382_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1360d). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205384_LHBs_P-D Product feature CHAIN GQ205384_LHBs_P-D of FT:mat_peptide GQ205384_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1434d). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGHLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTPASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|GQ205385_LHBs_P-D Product feature CHAIN GQ205385_LHBs_P-D of FT:mat_peptide GQ205385_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1469). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDENCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205388_LHBs_P-D Product feature CHAIN GQ205388_LHBs_P-D of FT:mat_peptide GQ205388_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1562). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205389_LHBs_P-D Product feature CHAIN GQ205389_LHBs_P-D of FT:mat_peptide GQ205389_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1667). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHRLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDENCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377589_LHBs_P-D Product feature CHAIN GQ377589_LHBs_P-D of FT:mat_peptide GQ377589_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate J145). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477452_LHBs_P-D Product feature CHAIN GQ477452_LHBs_P-D of FT:mat_peptide GQ477452_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGQSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477453_LHBs_P-D Product feature CHAIN GQ477453_LHBs_P-D of FT:mat_peptide GQ477453_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P39). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLRPFLQLLPIFFCLWVYI
>gnl|hbvpro|GQ477455_LHBs_P-D Product feature CHAIN GQ477455_LHBs_P-D of FT:mat_peptide GQ477455_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P73). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=388 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLTPPLGDTHPLAQWKSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPA
LNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLR
RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAF
GKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477456_LHBs_P-D Product feature CHAIN GQ477456_LHBs_P-D of FT:mat_peptide GQ477456_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P84). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477457_LHBs_P-D Product feature CHAIN GQ477457_LHBs_P-D of FT:mat_peptide GQ477457_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P118). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477458_LHBs_P-D Product feature CHAIN GQ477458_LHBs_P-D of FT:mat_peptide GQ477458_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P126). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPPTLPLRHTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALKMENITSGFLGPLLVLQAGFFLLTKIIKIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477459_LHBs_P-D Product feature CHAIN GQ477459_LHBs_P-D of FT:mat_peptide GQ477459_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P127). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922000_LHBs_P-D Product feature CHAIN GQ922000_LHBs_P-D of FT:mat_peptide GQ922000_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3552). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RHFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922001_LHBs_P-D Product feature CHAIN GQ922001_LHBs_P-D of FT:mat_peptide GQ922001_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3654). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNPQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVSTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922002_LHBs_P-D Product feature CHAIN GQ922002_LHBs_P-D of FT:mat_peptide GQ922002_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3624). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922003_LHBs_P-D Product feature CHAIN GQ922003_LHBs_P-D of FT:mat_peptide GQ922003_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3225). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTDRQSGRQPTPLSPPLRVTYPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922004_LHBs_P-D Product feature CHAIN GQ922004_LHBs_P-D of FT:mat_peptide GQ922004_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3284). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAVXXXXXXXNPVPTTASHTSLIFSRIGDL
VRNMENITSGFLGPLLXLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922005_LHBs_P-D Product feature CHAIN GQ922005_LHBs_P-D of FT:mat_peptide GQ922005_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B2894). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSHFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924652_LHBs_P-D Product feature CHAIN GQ924652_LHBs_P-D of FT:mat_peptide GQ924652_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M89). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU357846_LHBs_P-D Product feature CHAIN GU357846_LHBs_P-D of FT:mat_peptide GU357846_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y10). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNPSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFVLLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSVIWMMWYWEPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456635_LHBs_P-D Product feature CHAIN GU456635_LHBs_P-D of FT:mat_peptide GU456635_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T26). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGSLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKSLYLPAGGSSSGTVTPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456636_LHBs_P-D Product feature CHAIN GU456636_LHBs_P-D of FT:mat_peptide GU456636_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T7). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTMPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNTTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456637_LHBs_P-D Product feature CHAIN GU456637_LHBs_P-D of FT:mat_peptide GU456637_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T49). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456638_LHBs_P-D Product feature CHAIN GU456638_LHBs_P-D of FT:mat_peptide GU456638_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T35). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456639_LHBs_P-D Product feature CHAIN GU456639_LHBs_P-D of FT:mat_peptide GU456639_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T129). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQCPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPNLNCILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|GU456640_LHBs_P-D Product feature CHAIN GU456640_LHBs_P-D of FT:mat_peptide GU456640_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456641_LHBs_P-D Product feature CHAIN GU456641_LHBs_P-D of FT:mat_peptide GU456641_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T53). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSSPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456643_LHBs_P-D Product feature CHAIN GU456643_LHBs_P-D of FT:mat_peptide GU456643_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T52). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLNLLVPFVQWFAGLSPIVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456645_LHBs_P-D Product feature CHAIN GU456645_LHBs_P-D of FT:mat_peptide GU456645_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T80). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRRSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWTMWCWGPNLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456646_LHBs_P-D Product feature CHAIN GU456646_LHBs_P-D of FT:mat_peptide GU456646_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T77). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456647_LHBs_P-D Product feature CHAIN GU456647_LHBs_P-D of FT:mat_peptide GU456647_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T130). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456648_LHBs_P-D Product feature CHAIN GU456648_LHBs_P-D of FT:mat_peptide GU456648_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T85). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456649_LHBs_P-D Product feature CHAIN GU456649_LHBs_P-D of FT:mat_peptide GU456649_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T57). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQSTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDWWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPYLPLLPIFFCLWVYI
>gnl|hbvpro|GU456650_LHBs_P-D Product feature CHAIN GU456650_LHBs_P-D of FT:mat_peptide GU456650_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T62). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTMPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456651_LHBs_P-D Product feature CHAIN GU456651_LHBs_P-D of FT:mat_peptide GU456651_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T34). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456652_LHBs_P-D Product feature CHAIN GU456652_LHBs_P-D of FT:mat_peptide GU456652_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T44). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYTTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456653_LHBs_P-D Product feature CHAIN GU456653_LHBs_P-D of FT:mat_peptide GU456653_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T59). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIGVP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456654_LHBs_P-D Product feature CHAIN GU456654_LHBs_P-D of FT:mat_peptide GU456654_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T39). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGLTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|GU456655_LHBs_P-D Product feature CHAIN GU456655_LHBs_P-D of FT:mat_peptide GU456655_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T95). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456656_LHBs_P-D Product feature CHAIN GU456656_LHBs_P-D of FT:mat_peptide GU456656_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T9). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSSRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYPILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456657_LHBs_P-D Product feature CHAIN GU456657_LHBs_P-D of FT:mat_peptide GU456657_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T83). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPTSSLFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCTILSPYLPLLPIFFCLWVYI
>gnl|hbvpro|GU456658_LHBs_P-D Product feature CHAIN GU456658_LHBs_P-D of FT:mat_peptide GU456658_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T114). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLGQNSQCPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456659_LHBs_P-D Product feature CHAIN GU456659_LHBs_P-D of FT:mat_peptide GU456659_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T24). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLQLLPIFFCLWVYI
>gnl|hbvpro|GU456660_LHBs_P-D Product feature CHAIN GU456660_LHBs_P-D of FT:mat_peptide GU456660_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T64). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456661_LHBs_P-D Product feature CHAIN GU456661_LHBs_P-D of FT:mat_peptide GU456661_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T99). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456663_LHBs_P-D Product feature CHAIN GU456663_LHBs_P-D of FT:mat_peptide GU456663_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T86). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGPGLTPPHGGLLGWSPQAQGILQTLPAN
PPPTSTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456664_LHBs_P-D Product feature CHAIN GU456664_LHBs_P-D of FT:mat_peptide GU456664_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T40). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456665_LHBs_P-D Product feature CHAIN GU456665_LHBs_P-D of FT:mat_peptide GU456665_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T76). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSISSRTGDP
ALNMENITSGFLGPLVVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456666_LHBs_P-D Product feature CHAIN GU456666_LHBs_P-D of FT:mat_peptide GU456666_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456667_LHBs_P-D Product feature CHAIN GU456667_LHBs_P-D of FT:mat_peptide GU456667_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T120). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWAYI
>gnl|hbvpro|GU456668_LHBs_P-D Product feature CHAIN GU456668_LHBs_P-D of FT:mat_peptide GU456668_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T21). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTCSHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456669_LHBs_P-D Product feature CHAIN GU456669_LHBs_P-D of FT:mat_peptide GU456669_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T94). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPSSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456670_LHBs_P-D Product feature CHAIN GU456670_LHBs_P-D of FT:mat_peptide GU456670_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T27). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456673_LHBs_P-D Product feature CHAIN GU456673_LHBs_P-D of FT:mat_peptide GU456673_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T75). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSTFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456674_LHBs_P-D Product feature CHAIN GU456674_LHBs_P-D of FT:mat_peptide GU456674_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T16). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456675_LHBs_P-D Product feature CHAIN GU456675_LHBs_P-D of FT:mat_peptide GU456675_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T13). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456677_LHBs_P-D Product feature CHAIN GU456677_LHBs_P-D of FT:mat_peptide GU456677_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T46). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQSLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456678_LHBs_P-D Product feature CHAIN GU456678_LHBs_P-D of FT:mat_peptide GU456678_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T97). Complete genome. [Hepadnaviridae] (length=391 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLALLDCQGMLPVCPLTAANGSSTTSTEQCRTCTTPAQGTSMYLSCCCTKPSGGNCTCIPIPSS
WAFAKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456679_LHBs_P-D Product feature CHAIN GU456679_LHBs_P-D of FT:mat_peptide GU456679_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T63). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|GU456680_LHBs_P-D Product feature CHAIN GU456680_LHBs_P-D of FT:mat_peptide GU456680_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T88). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIGDP
AMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456681_LHBs_P-D Product feature CHAIN GU456681_LHBs_P-D of FT:mat_peptide GU456681_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T79). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456682_LHBs_P-D Product feature CHAIN GU456682_LHBs_P-D of FT:mat_peptide GU456682_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T42). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHRTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
LGKFLWEWASARFSWLSLLVPFVQWFVGCSPTVWLLVTWMMWYWGLNPFHIFSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456683_LHBs_P-D Product feature CHAIN GU456683_LHBs_P-D of FT:mat_peptide GU456683_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T101). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456684_LHBs_P-D Product feature CHAIN GU456684_LHBs_P-D of FT:mat_peptide GU456684_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T60). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPTLYNILKPFLPLLPIFFCLWAYI
>gnl|hbvpro|HM750151_LHBs_P-D Product feature CHAIN HM750151_LHBs_P-D of FT:mat_peptide HM750151_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSD-8). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750152_LHBs_P-D Product feature CHAIN HM750152_LHBs_P-D of FT:mat_peptide HM750152_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate QHN-99). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750153_LHBs_P-D Product feature CHAIN HM750153_LHBs_P-D of FT:mat_peptide HM750153_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJW-12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750154_LHBs_P-D Product feature CHAIN HM750154_LHBs_P-D of FT:mat_peptide HM750154_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XGW-23). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYRGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750155_LHBs_P-D Product feature CHAIN HM750155_LHBs_P-D of FT:mat_peptide HM750155_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750156_LHBs_P-D Product feature CHAIN HM750156_LHBs_P-D of FT:mat_peptide HM750156_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTPQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ236014_LHBs_P-D Product feature CHAIN HQ236014_LHBs_P-D of FT:mat_peptide HQ236014_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ236015_LHBs_P-D Product feature CHAIN HQ236015_LHBs_P-D of FT:mat_peptide HQ236015_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILHTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTIHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ236016_LHBs_P-D Product feature CHAIN HQ236016_LHBs_P-D of FT:mat_peptide HQ236016_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS3). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILHTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIGDL
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700440_LHBs_P-D Product feature CHAIN HQ700440_LHBs_P-D of FT:mat_peptide HQ700440_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AD05_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700441_LHBs_P-D Product feature CHAIN HQ700441_LHBs_P-D of FT:mat_peptide HQ700441_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN10_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700442_LHBs_P-D Product feature CHAIN HQ700442_LHBs_P-D of FT:mat_peptide HQ700442_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700443_LHBs_P-D Product feature CHAIN HQ700443_LHBs_P-D of FT:mat_peptide HQ700443_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1999). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700444_LHBs_P-D Product feature CHAIN HQ700444_LHBs_P-D of FT:mat_peptide HQ700444_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN19_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700445_LHBs_P-D Product feature CHAIN HQ700445_LHBs_P-D of FT:mat_peptide HQ700445_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSNSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700446_LHBs_P-D Product feature CHAIN HQ700446_LHBs_P-D of FT:mat_peptide HQ700446_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1999). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSNSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700447_LHBs_P-D Product feature CHAIN HQ700447_LHBs_P-D of FT:mat_peptide HQ700447_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700448_LHBs_P-D Product feature CHAIN HQ700448_LHBs_P-D of FT:mat_peptide HQ700448_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1999). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700449_LHBs_P-D Product feature CHAIN HQ700449_LHBs_P-D of FT:mat_peptide HQ700449_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE06_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTXNPVPTTXSHISSIFSRIGDP
ALNMEXXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700450_LHBs_P-D Product feature CHAIN HQ700450_LHBs_P-D of FT:mat_peptide HQ700450_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE09_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700451_LHBs_P-D Product feature CHAIN HQ700451_LHBs_P-D of FT:mat_peptide HQ700451_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GI11_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700453_LHBs_P-D Product feature CHAIN HQ700453_LHBs_P-D of FT:mat_peptide HQ700453_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA35_1984). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700454_LHBs_P-D Product feature CHAIN HQ700454_LHBs_P-D of FT:mat_peptide HQ700454_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTXNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700455_LHBs_P-D Product feature CHAIN HQ700455_LHBs_P-D of FT:mat_peptide HQ700455_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1999). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIXSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700458_LHBs_P-D Product feature CHAIN HQ700458_LHBs_P-D of FT:mat_peptide HQ700458_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE35_1997). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAH
PPPASTNRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700459_LHBs_P-D Product feature CHAIN HQ700459_LHBs_P-D of FT:mat_peptide HQ700459_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE55_1993). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700463_LHBs_P-D Product feature CHAIN HQ700463_LHBs_P-D of FT:mat_peptide HQ700463_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HI43_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNATTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700464_LHBs_P-D Product feature CHAIN HQ700464_LHBs_P-D of FT:mat_peptide HQ700464_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_KA40_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700466_LHBs_P-D Product feature CHAIN HQ700466_LHBs_P-D of FT:mat_peptide HQ700466_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700469_LHBs_P-D Product feature CHAIN HQ700469_LHBs_P-D of FT:mat_peptide HQ700469_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700470_LHBs_P-D Product feature CHAIN HQ700470_LHBs_P-D of FT:mat_peptide HQ700470_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1999). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700471_LHBs_P-D Product feature CHAIN HQ700471_LHBs_P-D of FT:mat_peptide HQ700471_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO70_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700472_LHBs_P-D Product feature CHAIN HQ700472_LHBs_P-D of FT:mat_peptide HQ700472_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO77_1997). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPHKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFRQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWTMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700473_LHBs_P-D Product feature CHAIN HQ700473_LHBs_P-D of FT:mat_peptide HQ700473_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLXVYI
>gnl|hbvpro|HQ700474_LHBs_P-D Product feature CHAIN HQ700474_LHBs_P-D of FT:mat_peptide HQ700474_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1999). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLLVYI
>gnl|hbvpro|HQ700478_LHBs_P-D Product feature CHAIN HQ700478_LHBs_P-D of FT:mat_peptide HQ700478_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1994). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQNNSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700479_LHBs_P-D Product feature CHAIN HQ700479_LHBs_P-D of FT:mat_peptide HQ700479_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA11_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700480_LHBs_P-D Product feature CHAIN HQ700480_LHBs_P-D of FT:mat_peptide HQ700480_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIXMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700481_LHBs_P-D Product feature CHAIN HQ700481_LHBs_P-D of FT:mat_peptide HQ700481_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1999). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700482_LHBs_P-D Product feature CHAIN HQ700482_LHBs_P-D of FT:mat_peptide HQ700482_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA40_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700483_LHBs_P-D Product feature CHAIN HQ700483_LHBs_P-D of FT:mat_peptide HQ700483_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA120_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700484_LHBs_P-D Product feature CHAIN HQ700484_LHBs_P-D of FT:mat_peptide HQ700484_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA229_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700487_LHBs_P-D Product feature CHAIN HQ700487_LHBs_P-D of FT:mat_peptide HQ700487_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TU25_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700488_LHBs_P-D Product feature CHAIN HQ700488_LHBs_P-D of FT:mat_peptide HQ700488_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1984). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700510_LHBs_P-D Product feature CHAIN HQ700510_LHBs_P-D of FT:mat_peptide HQ700510_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_128225_2003). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700511_LHBs_P-D Product feature CHAIN HQ700511_LHBs_P-D of FT:mat_peptide HQ700511_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_164317_2001). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDIWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700512_LHBs_P-D Product feature CHAIN HQ700512_LHBs_P-D of FT:mat_peptide HQ700512_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_182089_2001). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700513_LHBs_P-D Product feature CHAIN HQ700513_LHBs_P-D of FT:mat_peptide HQ700513_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_16600_2001). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPHAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700514_LHBs_P-D Product feature CHAIN HQ700514_LHBs_P-D of FT:mat_peptide HQ700514_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_1664337_2001). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ700553_LHBs_P-D Product feature CHAIN HQ700553_LHBs_P-D of FT:mat_peptide HQ700553_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1999). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCXGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQNNSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ833465_LHBs_P-D Product feature CHAIN HQ833465_LHBs_P-D of FT:mat_peptide HQ833465_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGKLQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ833467_LHBs_P-D Product feature CHAIN HQ833467_LHBs_P-D of FT:mat_peptide HQ833467_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB27). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCXKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFXCLWVYI
>gnl|hbvpro|HQ833468_LHBs_P-D Product feature CHAIN HQ833468_LHBs_P-D of FT:mat_peptide HQ833468_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB52). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ833469_LHBs_P-D Product feature CHAIN HQ833469_LHBs_P-D of FT:mat_peptide HQ833469_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB79). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGXTPPHGGLLGWSPQAQGRLQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ833470_LHBs_P-D Product feature CHAIN HQ833470_LHBs_P-D of FT:mat_peptide HQ833470_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB80). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ833471_LHBs_P-D Product feature CHAIN HQ833471_LHBs_P-D of FT:mat_peptide HQ833471_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB97). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAXKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439692_LHBs_P-D Product feature CHAIN JF439692_LHBs_P-D of FT:mat_peptide JF439692_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN132). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFPFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439696_LHBs_P-D Product feature CHAIN JF439696_LHBs_P-D of FT:mat_peptide JF439696_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
VLNMENITSGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTRPGYRWMYL
RRFIIFPFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFAQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439699_LHBs_P-D Product feature CHAIN JF439699_LHBs_P-D of FT:mat_peptide JF439699_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439700_LHBs_P-D Product feature CHAIN JF439700_LHBs_P-D of FT:mat_peptide JF439700_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN143). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439701_LHBs_P-D Product feature CHAIN JF439701_LHBs_P-D of FT:mat_peptide JF439701_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN144). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439703_LHBs_P-D Product feature CHAIN JF439703_LHBs_P-D of FT:mat_peptide JF439703_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN146). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTAASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFPFILLLCLIFLLVLLDYQGMLPVRPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439704_LHBs_P-D Product feature CHAIN JF439704_LHBs_P-D of FT:mat_peptide JF439704_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN149). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439705_LHBs_P-D Product feature CHAIN JF439705_LHBs_P-D of FT:mat_peptide JF439705_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN150). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439706_LHBs_P-D Product feature CHAIN JF439706_LHBs_P-D of FT:mat_peptide JF439706_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSSPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439708_LHBs_P-D Product feature CHAIN JF439708_LHBs_P-D of FT:mat_peptide JF439708_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN154). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWIYI
>gnl|hbvpro|JF439709_LHBs_P-D Product feature CHAIN JF439709_LHBs_P-D of FT:mat_peptide JF439709_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN155). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRSTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439710_LHBs_P-D Product feature CHAIN JF439710_LHBs_P-D of FT:mat_peptide JF439710_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439711_LHBs_P-D Product feature CHAIN JF439711_LHBs_P-D of FT:mat_peptide JF439711_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN157). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSSPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF439718_LHBs_P-D Product feature CHAIN JF439718_LHBs_P-D of FT:mat_peptide JF439718_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN167). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754588_LHBs_P-D Product feature CHAIN JF754588_LHBs_P-D of FT:mat_peptide JF754588_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK61). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGALQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIYSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCIGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFIPLLPIFCCLWVYI
>gnl|hbvpro|JF754590_LHBs_P-D Product feature CHAIN JF754590_LHBs_P-D of FT:mat_peptide JF754590_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK41). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FAKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754591_LHBs_P-D Product feature CHAIN JF754591_LHBs_P-D of FT:mat_peptide JF754591_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK38). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754592_LHBs_P-D Product feature CHAIN JF754592_LHBs_P-D of FT:mat_peptide JF754592_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK64). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754593_LHBs_P-D Product feature CHAIN JF754593_LHBs_P-D of FT:mat_peptide JF754593_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK170). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASANRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754594_LHBs_P-D Product feature CHAIN JF754594_LHBs_P-D of FT:mat_peptide JF754594_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK165). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754595_LHBs_P-D Product feature CHAIN JF754595_LHBs_P-D of FT:mat_peptide JF754595_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK164). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754596_LHBs_P-D Product feature CHAIN JF754596_LHBs_P-D of FT:mat_peptide JF754596_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK106). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754597_LHBs_P-D Product feature CHAIN JF754597_LHBs_P-D of FT:mat_peptide JF754597_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK105). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQNLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754599_LHBs_P-D Product feature CHAIN JF754599_LHBs_P-D of FT:mat_peptide JF754599_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK173). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFGGLSPTVWLSVIWMMWYWGPRLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF754600_LHBs_P-D Product feature CHAIN JF754600_LHBs_P-D of FT:mat_peptide JF754600_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK91). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754601_LHBs_P-D Product feature CHAIN JF754601_LHBs_P-D of FT:mat_peptide JF754601_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK88). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVRLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754602_LHBs_P-D Product feature CHAIN JF754602_LHBs_P-D of FT:mat_peptide JF754602_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK83). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAIQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLIVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754603_LHBs_P-D Product feature CHAIN JF754603_LHBs_P-D of FT:mat_peptide JF754603_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK8). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQALQWNSTTFHNTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754604_LHBs_P-D Product feature CHAIN JF754604_LHBs_P-D of FT:mat_peptide JF754604_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK79). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754607_LHBs_P-D Product feature CHAIN JF754607_LHBs_P-D of FT:mat_peptide JF754607_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK67). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754609_LHBs_P-D Product feature CHAIN JF754609_LHBs_P-D of FT:mat_peptide JF754609_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK45). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILTPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754610_LHBs_P-D Product feature CHAIN JF754610_LHBs_P-D of FT:mat_peptide JF754610_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK157). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPGVRGLHHTAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754611_LHBs_P-D Product feature CHAIN JF754611_LHBs_P-D of FT:mat_peptide JF754611_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK152). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASPNRKTSRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
VTNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLHSILSPLLPLLPIFFCLWVYI
>gnl|hbvpro|JF754612_LHBs_P-D Product feature CHAIN JF754612_LHBs_P-D of FT:mat_peptide JF754612_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK148). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTTLSPFTPLLPIFFCLWVYI
>gnl|hbvpro|JF754614_LHBs_P-D Product feature CHAIN JF754614_LHBs_P-D of FT:mat_peptide JF754614_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVXGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754615_LHBs_P-D Product feature CHAIN JF754615_LHBs_P-D of FT:mat_peptide JF754615_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK141). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754617_LHBs_P-D Product feature CHAIN JF754617_LHBs_P-D of FT:mat_peptide JF754617_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK131). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGMGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNTINFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHASSILSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|JF754618_LHBs_P-D Product feature CHAIN JF754618_LHBs_P-D of FT:mat_peptide JF754618_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK129). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754619_LHBs_P-D Product feature CHAIN JF754619_LHBs_P-D of FT:mat_peptide JF754619_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK62). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754623_LHBs_P-D Product feature CHAIN JF754623_LHBs_P-D of FT:mat_peptide JF754623_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK171). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNLPAGGSSSGTVNPVPTTVSHISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFGGLSPTVWLSVIWMMWYWGPRLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JF754624_LHBs_P-D Product feature CHAIN JF754624_LHBs_P-D of FT:mat_peptide JF754624_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK28). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754626_LHBs_P-D Product feature CHAIN JF754626_LHBs_P-D of FT:mat_peptide JF754626_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK23). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPATTNRRSGRQPTPLSPPLRDTHPQAIQWNSRNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGRNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754627_LHBs_P-D Product feature CHAIN JF754627_LHBs_P-D of FT:mat_peptide JF754627_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK37). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMYWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754628_LHBs_P-D Product feature CHAIN JF754628_LHBs_P-D of FT:mat_peptide JF754628_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGILGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754629_LHBs_P-D Product feature CHAIN JF754629_LHBs_P-D of FT:mat_peptide JF754629_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK176). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
AMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FAKFLWEWASARFSWLSLLVPFVQWFVGHSPTAWLLAIWMMWYWGPSLLRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754631_LHBs_P-D Product feature CHAIN JF754631_LHBs_P-D of FT:mat_peptide JF754631_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK193). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQPRRQPTPQSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPILSIFSRIGDP
ALTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTGCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSVIWMMWYWGPSLYRTLSPFILLFPIFLCLWVYI
>gnl|hbvpro|JF754632_LHBs_P-D Product feature CHAIN JF754632_LHBs_P-D of FT:mat_peptide JF754632_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK186). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFLRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFIPLLPIFLCLWVYI
>gnl|hbvpro|JF754633_LHBs_P-D Product feature CHAIN JF754633_LHBs_P-D of FT:mat_peptide JF754633_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK128). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|JF754634_LHBs_P-D Product feature CHAIN JF754634_LHBs_P-D of FT:mat_peptide JF754634_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTXPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JF754635_LHBs_P-D Product feature CHAIN JF754635_LHBs_P-D of FT:mat_peptide JF754635_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK113). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTQVLTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040750_LHBs_P-D Product feature CHAIN JN040750_LHBs_P-D of FT:mat_peptide JN040750_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919078). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLHAGGSSSETVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSMGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040751_LHBs_P-D Product feature CHAIN JN040751_LHBs_P-D of FT:mat_peptide JN040751_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919047). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAH
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040753_LHBs_P-D Product feature CHAIN JN040753_LHBs_P-D of FT:mat_peptide JN040753_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919064). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTRRQTGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQNPRVKGLYIPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVISMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040755_LHBs_P-D Product feature CHAIN JN040755_LHBs_P-D of FT:mat_peptide JN040755_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919086). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040757_LHBs_P-D Product feature CHAIN JN040757_LHBs_P-D of FT:mat_peptide JN040757_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919056). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMLYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040758_LHBs_P-D Product feature CHAIN JN040758_LHBs_P-D of FT:mat_peptide JN040758_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919037). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDWWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040759_LHBs_P-D Product feature CHAIN JN040759_LHBs_P-D of FT:mat_peptide JN040759_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919063). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040761_LHBs_P-D Product feature CHAIN JN040761_LHBs_P-D of FT:mat_peptide JN040761_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919002). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040762_LHBs_P-D Product feature CHAIN JN040762_LHBs_P-D of FT:mat_peptide JN040762_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919007). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPRLSSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040765_LHBs_P-D Product feature CHAIN JN040765_LHBs_P-D of FT:mat_peptide JN040765_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919006). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040766_LHBs_P-D Product feature CHAIN JN040766_LHBs_P-D of FT:mat_peptide JN040766_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919046). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSRISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARSSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040767_LHBs_P-D Product feature CHAIN JN040767_LHBs_P-D of FT:mat_peptide JN040767_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919019). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLDSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040768_LHBs_P-D Product feature CHAIN JN040768_LHBs_P-D of FT:mat_peptide JN040768_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919051). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
APNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVLVSPTVWLLVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040769_LHBs_P-D Product feature CHAIN JN040769_LHBs_P-D of FT:mat_peptide JN040769_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919015). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
SPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTAWLLVIWMMWYWGPSLCSILSRFLPLLLTFFCLWVYI
>gnl|hbvpro|JN040770_LHBs_P-D Product feature CHAIN JN040770_LHBs_P-D of FT:mat_peptide JN040770_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919087). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNFTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040771_LHBs_P-D Product feature CHAIN JN040771_LHBs_P-D of FT:mat_peptide JN040771_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919013). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPDGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|JN040773_LHBs_P-D Product feature CHAIN JN040773_LHBs_P-D of FT:mat_peptide JN040773_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919084). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPACRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSTFSRIGDL
ALNMENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040774_LHBs_P-D Product feature CHAIN JN040774_LHBs_P-D of FT:mat_peptide JN040774_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919088). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGRSLFSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN040775_LHBs_P-D Product feature CHAIN JN040775_LHBs_P-D of FT:mat_peptide JN040775_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919049). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCAGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMIWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040777_LHBs_P-D Product feature CHAIN JN040777_LHBs_P-D of FT:mat_peptide JN040777_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919017). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040778_LHBs_P-D Product feature CHAIN JN040778_LHBs_P-D of FT:mat_peptide JN040778_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919038). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPGVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040779_LHBs_P-D Product feature CHAIN JN040779_LHBs_P-D of FT:mat_peptide JN040779_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919070). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVTGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
AMNMENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040781_LHBs_P-D Product feature CHAIN JN040781_LHBs_P-D of FT:mat_peptide JN040781_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919029). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040782_LHBs_P-D Product feature CHAIN JN040782_LHBs_P-D of FT:mat_peptide JN040782_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919041). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTVSRISSIFSRIGDP
ALNMENNTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGRSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN040783_LHBs_P-D Product feature CHAIN JN040783_LHBs_P-D of FT:mat_peptide JN040783_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919090). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGGSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNTTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040784_LHBs_P-D Product feature CHAIN JN040784_LHBs_P-D of FT:mat_peptide JN040784_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919030). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALKMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSLTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040785_LHBs_P-D Product feature CHAIN JN040785_LHBs_P-D of FT:mat_peptide JN040785_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919022). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQNLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040786_LHBs_P-D Product feature CHAIN JN040786_LHBs_P-D of FT:mat_peptide JN040786_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919035). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSLTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040787_LHBs_P-D Product feature CHAIN JN040787_LHBs_P-D of FT:mat_peptide JN040787_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919040). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMTPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040788_LHBs_P-D Product feature CHAIN JN040788_LHBs_P-D of FT:mat_peptide JN040788_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919024). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGSCRTCTTPARGTSMSPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYS
>gnl|hbvpro|JN040790_LHBs_P-D Product feature CHAIN JN040790_LHBs_P-D of FT:mat_peptide JN040790_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919054). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGAP
ALNMENITSGFLGPLLELQAGFFLLTRILTIPQNLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPSCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040791_LHBs_P-D Product feature CHAIN JN040791_LHBs_P-D of FT:mat_peptide JN040791_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919082). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040792_LHBs_P-D Product feature CHAIN JN040792_LHBs_P-D of FT:mat_peptide JN040792_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919079). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040793_LHBs_P-D Product feature CHAIN JN040793_LHBs_P-D of FT:mat_peptide JN040793_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919083). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040794_LHBs_P-D Product feature CHAIN JN040794_LHBs_P-D of FT:mat_peptide JN040794_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919075). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040795_LHBs_P-D Product feature CHAIN JN040795_LHBs_P-D of FT:mat_peptide JN040795_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919003). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMIWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040796_LHBs_P-D Product feature CHAIN JN040796_LHBs_P-D of FT:mat_peptide JN040796_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919018). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040797_LHBs_P-D Product feature CHAIN JN040797_LHBs_P-D of FT:mat_peptide JN040797_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919021). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040799_LHBs_P-D Product feature CHAIN JN040799_LHBs_P-D of FT:mat_peptide JN040799_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919080). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSKTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPYLPLLPIFFCLWVYI
>gnl|hbvpro|JN040800_LHBs_P-D Product feature CHAIN JN040800_LHBs_P-D of FT:mat_peptide JN040800_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919012). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTTPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040801_LHBs_P-D Product feature CHAIN JN040801_LHBs_P-D of FT:mat_peptide JN040801_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919042). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPATTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTTPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040802_LHBs_P-D Product feature CHAIN JN040802_LHBs_P-D of FT:mat_peptide JN040802_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919074). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDAWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN040805_LHBs_P-D Product feature CHAIN JN040805_LHBs_P-D of FT:mat_peptide JN040805_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919058). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPDFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTIVSPISSIFSRIGDP
ALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040806_LHBs_P-D Product feature CHAIN JN040806_LHBs_P-D of FT:mat_peptide JN040806_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919066). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040807_LHBs_P-D Product feature CHAIN JN040807_LHBs_P-D of FT:mat_peptide JN040807_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919034). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWG
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040808_LHBs_P-D Product feature CHAIN JN040808_LHBs_P-D of FT:mat_peptide JN040808_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919011). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLGQNSQCPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|JN040809_LHBs_P-D Product feature CHAIN JN040809_LHBs_P-D of FT:mat_peptide JN040809_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919014). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLHFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040810_LHBs_P-D Product feature CHAIN JN040810_LHBs_P-D of FT:mat_peptide JN040810_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919060). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGREPTPLTPPLRDTHPQSMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
AMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040811_LHBs_P-D Product feature CHAIN JN040811_LHBs_P-D of FT:mat_peptide JN040811_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919048). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPGSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIQQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040812_LHBs_P-D Product feature CHAIN JN040812_LHBs_P-D of FT:mat_peptide JN040812_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919027). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040813_LHBs_P-D Product feature CHAIN JN040813_LHBs_P-D of FT:mat_peptide JN040813_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919025). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040814_LHBs_P-D Product feature CHAIN JN040814_LHBs_P-D of FT:mat_peptide JN040814_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919032). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSKIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWGWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040815_LHBs_P-D Product feature CHAIN JN040815_LHBs_P-D of FT:mat_peptide JN040815_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919073). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRAKTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSRFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040818_LHBs_P-D Product feature CHAIN JN040818_LHBs_P-D of FT:mat_peptide JN040818_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919081). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQWDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLFTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040819_LHBs_P-D Product feature CHAIN JN040819_LHBs_P-D of FT:mat_peptide JN040819_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919067). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGACGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPTLSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|JN040820_LHBs_P-D Product feature CHAIN JN040820_LHBs_P-D of FT:mat_peptide JN040820_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919010). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWDWASARFSWLSLLVPFVQWFVGLSPIVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040821_LHBs_P-D Product feature CHAIN JN040821_LHBs_P-D of FT:mat_peptide JN040821_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919085). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNTTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040822_LHBs_P-D Product feature CHAIN JN040822_LHBs_P-D of FT:mat_peptide JN040822_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919044). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPVGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSFLVPFVQWFVGLSPTVWLSVILMMWYWGPRLYSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|JN040823_LHBs_P-D Product feature CHAIN JN040823_LHBs_P-D of FT:mat_peptide JN040823_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919005). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040824_LHBs_P-D Product feature CHAIN JN040824_LHBs_P-D of FT:mat_peptide JN040824_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919071). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040826_LHBs_P-D Product feature CHAIN JN040826_LHBs_P-D of FT:mat_peptide JN040826_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919055). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040827_LHBs_P-D Product feature CHAIN JN040827_LHBs_P-D of FT:mat_peptide JN040827_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919008). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040828_LHBs_P-D Product feature CHAIN JN040828_LHBs_P-D of FT:mat_peptide JN040828_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919069). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040829_LHBs_P-D Product feature CHAIN JN040829_LHBs_P-D of FT:mat_peptide JN040829_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919089). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN040830_LHBs_P-D Product feature CHAIN JN040830_LHBs_P-D of FT:mat_peptide JN040830_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919052). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257148_LHBs_P-D Product feature CHAIN JN257148_LHBs_P-D of FT:mat_peptide JN257148_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMF). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257149_LHBs_P-D Product feature CHAIN JN257149_LHBs_P-D of FT:mat_peptide JN257149_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSFN). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQXXRQPTPQSPPLRBTHPQAMQWNSTTFHQTLQDPRVXGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCXTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|JN257150_LHBs_P-D Product feature CHAIN JN257150_LHBs_P-D of FT:mat_peptide JN257150_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABS). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVXGLXFPAGGSSSGTVNPVPTTVSHISSIFSRIGDX
AXNMENITSGFLGPLLVLQAGFFLLTXILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257151_LHBs_P-D Product feature CHAIN JN257151_LHBs_P-D of FT:mat_peptide JN257151_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHHR). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257152_LHBs_P-D Product feature CHAIN JN257152_LHBs_P-D of FT:mat_peptide JN257152_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRJB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWSSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDX
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257153_LHBs_P-D Product feature CHAIN JN257153_LHBs_P-D of FT:mat_peptide JN257153_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=388 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPXTPPLRDTHPQAQWXXXXFHQTLQDPRVXGLYXPAGGSSSGTVNPVPTTXSHIXSIFSXXGDLA
PNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTCSHSPTSCPPTCPGYRWMCLR
RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAF
GKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257155_LHBs_P-D Product feature CHAIN JN257155_LHBs_P-D of FT:mat_peptide JN257155_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJHM1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257159_LHBs_P-D Product feature CHAIN JN257159_LHBs_P-D of FT:mat_peptide JN257159_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMRW). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRXGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYXGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARXSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257160_LHBs_P-D Product feature CHAIN JN257160_LHBs_P-D of FT:mat_peptide JN257160_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHATR1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGXTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQBPXVRGLYFPAGGSSSGTVNPVPTTVSXISSIFXRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPXVWLXVIWMMWYWGPNLYXILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257162_LHBs_P-D Product feature CHAIN JN257162_LHBs_P-D of FT:mat_peptide JN257162_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSDQ). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLXXILXPFXPLLPIFFCLWVYI
>gnl|hbvpro|JN257163_LHBs_P-D Product feature CHAIN JN257163_LHBs_P-D of FT:mat_peptide JN257163_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAZI). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGILPVCPLLPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257165_LHBs_P-D Product feature CHAIN JN257165_LHBs_P-D of FT:mat_peptide JN257165_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLXGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVQTTVSHISSIFSRIGDP
ALNMENITSGXLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLXRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257169_LHBs_P-D Product feature CHAIN JN257169_LHBs_P-D of FT:mat_peptide JN257169_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAFF). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257170_LHBs_P-D Product feature CHAIN JN257170_LHBs_P-D of FT:mat_peptide JN257170_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJWB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257171_LHBs_P-D Product feature CHAIN JN257171_LHBs_P-D of FT:mat_peptide JN257171_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKML). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257172_LHBs_P-D Product feature CHAIN JN257172_LHBs_P-D of FT:mat_peptide JN257172_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMYD1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGPGXTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257176_LHBs_P-D Product feature CHAIN JN257176_LHBs_P-D of FT:mat_peptide JN257176_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDANKVGAGAFGXGXTPPHGGLLGXSPQAQGILXTLPAN
PPPASTNRQSGRQPTPLSPPLRBTHPQAMQWNXTTFHQTLQDPRVRGLXFPAGGSSSGTVNPVPTTVSHXSSIFSRIGDX
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYXGMLPVCPXXPXSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257177_LHBs_P-D Product feature CHAIN JN257177_LHBs_P-D of FT:mat_peptide JN257177_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDANKVGAGAFGXGXTPPHGGLLGXSPQAQGILXTLPAN
PPPASTNRQSGRQPTPLSPPLRBTHPQAMQWNXTTFHQTLQDPRVRGLXFPAGGSSSGTVNPVPTTVSHXSSIFSRIGDX
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYXGMLPVCPXXPXSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257179_LHBs_P-D Product feature CHAIN JN257179_LHBs_P-D of FT:mat_peptide JN257179_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMJD1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257181_LHBs_P-D Product feature CHAIN JN257181_LHBs_P-D of FT:mat_peptide JN257181_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHNDA). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257182_LHBs_P-D Product feature CHAIN JN257182_LHBs_P-D of FT:mat_peptide JN257182_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMSL). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257183_LHBs_P-D Product feature CHAIN JN257183_LHBs_P-D of FT:mat_peptide JN257183_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKSH). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYXPAGGSSSGTVNPVPTTVSHISSILSRIGDX
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLXFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257185_LHBs_P-D Product feature CHAIN JN257185_LHBs_P-D of FT:mat_peptide JN257185_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHZYD). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257186_LHBs_P-D Product feature CHAIN JN257186_LHBs_P-D of FT:mat_peptide JN257186_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHDHM). Complete genome. [Hepadnaviridae] (length=390 residues).
GMGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPA
NPPPASTNRQSGRQPTPLSPPLRXTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTGD
PALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMC
LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSW
AFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVXWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257188_LHBs_P-D Product feature CHAIN JN257188_LHBs_P-D of FT:mat_peptide JN257188_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGILXTXPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTVSHISSIFSRIGXP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257190_LHBs_P-D Product feature CHAIN JN257190_LHBs_P-D of FT:mat_peptide JN257190_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHYHY). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWXWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFXCLWVYI
>gnl|hbvpro|JN257193_LHBs_P-D Product feature CHAIN JN257193_LHBs_P-D of FT:mat_peptide JN257193_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257195_LHBs_P-D Product feature CHAIN JN257195_LHBs_P-D of FT:mat_peptide JN257195_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=388 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPXTPPLRDTHPQAQWXXXXFHQTLQDPRVXGLYXPAGGSSSGTVNPVPTTXSHIXSIFSXXGDLA
PNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTCSHSPTSCPPTCPGYRWMCLR
RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAF
GKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257196_LHBs_P-D Product feature CHAIN JN257196_LHBs_P-D of FT:mat_peptide JN257196_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABR1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQXTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257199_LHBs_P-D Product feature CHAIN JN257199_LHBs_P-D of FT:mat_peptide JN257199_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSOD2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTIVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257200_LHBs_P-D Product feature CHAIN JN257200_LHBs_P-D of FT:mat_peptide JN257200_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMNM). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFQQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSSLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257201_LHBs_P-D Product feature CHAIN JN257201_LHBs_P-D of FT:mat_peptide JN257201_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFAD). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGMGFTPPHGGLLGWSPQAQGMLQTLPAS
PPPASTXRQSGRQPTPLSPPLRDTHPQAMQWGSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257202_LHBs_P-D Product feature CHAIN JN257202_LHBs_P-D of FT:mat_peptide JN257202_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSLI). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRRSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257203_LHBs_P-D Product feature CHAIN JN257203_LHBs_P-D of FT:mat_peptide JN257203_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJKF). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFCYLWVYI
>gnl|hbvpro|JN257205_LHBs_P-D Product feature CHAIN JN257205_LHBs_P-D of FT:mat_peptide JN257205_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRYD). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPTSTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN257209_LHBs_P-D Product feature CHAIN JN257209_LHBs_P-D of FT:mat_peptide JN257209_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMR2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN370949_LHBs_P-D Product feature CHAIN JN370949_LHBs_P-D of FT:mat_peptide JN370949_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NYX1). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=387 residues).
QNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPP
PASTNRQSGRLPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDPAL
NMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRR
FIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFG
KFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN370950_LHBs_P-D Product feature CHAIN JN370950_LHBs_P-D of FT:mat_peptide JN370950_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NYX2). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=387 residues).
QNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPP
PASTNRQSGRLPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDPAL
NMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRR
FIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFG
KFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN370951_LHBs_P-D Product feature CHAIN JN370951_LHBs_P-D of FT:mat_peptide JN370951_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NYX3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=387 residues).
QNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPP
PASTNRQSGRLPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDPAL
NMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRR
FIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFG
KFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN370952_LHBs_P-D Product feature CHAIN JN370952_LHBs_P-D of FT:mat_peptide JN370952_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NYX4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=387 residues).
QNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPP
PASTNRQSGRLPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDPAL
NMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRR
FIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFG
KFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN370953_LHBs_P-D Product feature CHAIN JN370953_LHBs_P-D of FT:mat_peptide JN370953_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NYX5). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=387 residues).
QNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPP
PASTNRQSGRLPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDPAL
NMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRR
FIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFG
KFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN370954_LHBs_P-D Product feature CHAIN JN370954_LHBs_P-D of FT:mat_peptide JN370954_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NYX7). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=387 residues).
QNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPP
PASTNRQSGRLPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDPAL
NMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRR
FIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPSDGNCTCIPIPSSWAFA
KFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604120_LHBs_P-D Product feature CHAIN JN604120_LHBs_P-D of FT:mat_peptide JN604120_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 476-6642-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPXANKVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVTWMMWYWGPSLYSTLSPFLPLLPIFFCLWXYI
>gnl|hbvpro|JN604139_LHBs_P-D Product feature CHAIN JN604139_LHBs_P-D of FT:mat_peptide JN604139_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 478-7582-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILHTLPAN
PPPAQTNRQSGRQPTPLSPPLRDSHPQAVQWNSTTFHQTLQNPRVKGLHPPAGGSSSGTVNPVPTTASPISSIFSRIGGL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FAKFLWEWASARFSWLSLLVQFVQWFVGLSPTAWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604152_LHBs_P-D Product feature CHAIN JN604152_LHBs_P-D of FT:mat_peptide JN604152_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 479-8250-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTXNPVPTTASPILSIFSKIGDL
ALNMENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLXFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGXSPTXWLSXIWMMWYWGPXLCSTLSPFXPLXPIFFCLWVYI
>gnl|hbvpro|JN604161_LHBs_P-D Product feature CHAIN JN604161_LHBs_P-D of FT:mat_peptide JN604161_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 477-1706-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPPSTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAXPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWAXARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXSILSPFLPLLPIFXCLWVYI
>gnl|hbvpro|JN604170_LHBs_P-D Product feature CHAIN JN604170_LHBs_P-D of FT:mat_peptide JN604170_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 477-9935-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMESITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604174_LHBs_P-D Product feature CHAIN JN604174_LHBs_P-D of FT:mat_peptide JN604174_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 478-0715-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604175_LHBs_P-D Product feature CHAIN JN604175_LHBs_P-D of FT:mat_peptide JN604175_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 478-2872-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGXTPPHGGLLGWSPQAQGIIQTLPAN
PPPAXTNRXXGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRXLYXPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604189_LHBs_P-D Product feature CHAIN JN604189_LHBs_P-D of FT:mat_peptide JN604189_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 479-3396-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSILSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604206_LHBs_P-D Product feature CHAIN JN604206_LHBs_P-D of FT:mat_peptide JN604206_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 476-5337-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSILSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604207_LHBs_P-D Product feature CHAIN JN604207_LHBs_P-D of FT:mat_peptide JN604207_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 476-5625-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQLGRQPTPLSPPLRSTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604238_LHBs_P-D Product feature CHAIN JN604238_LHBs_P-D of FT:mat_peptide JN604238_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 478-5785-2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIGDP
VRNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RHFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSLHPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|JN604239_LHBs_P-D Product feature CHAIN JN604239_LHBs_P-D of FT:mat_peptide JN604239_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 478-5845-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTN
PPPASTNRQSGRQPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSXTVNPVPTTVSHISSIFSRIGDL
AXNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGXSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYXILSPFLXLLPIFFCLWVYI
>gnl|hbvpro|JN604250_LHBs_P-D Product feature CHAIN JN604250_LHBs_P-D of FT:mat_peptide JN604250_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 479-2424-7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGILPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWDWASARFSWLKLLVPFVQWFVGLSPTVWLSVIWMMWYWGQSLYRILSPFLLLLPIFFCLWVYI
>gnl|hbvpro|JN604259_LHBs_P-D Product feature CHAIN JN604259_LHBs_P-D of FT:mat_peptide JN604259_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 477-1538-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAK
PPPATTTRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTAWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604263_LHBs_P-D Product feature CHAIN JN604263_LHBs_P-D of FT:mat_peptide JN604263_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 478-2854-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604265_LHBs_P-D Product feature CHAIN JN604265_LHBs_P-D of FT:mat_peptide JN604265_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 480-0137-5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604272_LHBs_P-D Product feature CHAIN JN604272_LHBs_P-D of FT:mat_peptide JN604272_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 476-9621-8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604275_LHBs_P-D Product feature CHAIN JN604275_LHBs_P-D of FT:mat_peptide JN604275_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 477-1046-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604278_LHBs_P-D Product feature CHAIN JN604278_LHBs_P-D of FT:mat_peptide JN604278_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 477-2774-0). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGALLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604295_LHBs_P-D Product feature CHAIN JN604295_LHBs_P-D of FT:mat_peptide JN604295_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 478-5530-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604301_LHBs_P-D Product feature CHAIN JN604301_LHBs_P-D of FT:mat_peptide JN604301_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 478-7936-9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWXWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604312_LHBs_P-D Product feature CHAIN JN604312_LHBs_P-D of FT:mat_peptide JN604312_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 479-6369-1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXL
RRFIICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604313_LHBs_P-D Product feature CHAIN JN604313_LHBs_P-D of FT:mat_peptide JN604313_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 479-6792-4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN604318_LHBs_P-D Product feature CHAIN JN604318_LHBs_P-D of FT:mat_peptide JN604318_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 480-0665-6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGYFLLTRILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARSSWLSLXVPFVQWFVGLSPTVWLSVIWXMWFWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642126_LHBs_P-D Product feature CHAIN JN642126_LHBs_P-D of FT:mat_peptide JN642126_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb9). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVSLGKNSQSPTSNHSQTSCPPTCPGYRWMCL
RHFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642129_LHBs_P-D Product feature CHAIN JN642129_LHBs_P-D of FT:mat_peptide JN642129_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLNSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642130_LHBs_P-D Product feature CHAIN JN642130_LHBs_P-D of FT:mat_peptide JN642130_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb13). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642131_LHBs_P-D Product feature CHAIN JN642131_LHBs_P-D of FT:mat_peptide JN642131_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb16). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPTTVSHISSIFSRSGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPASLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPRTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642132_LHBs_P-D Product feature CHAIN JN642132_LHBs_P-D of FT:mat_peptide JN642132_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb18). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642133_LHBs_P-D Product feature CHAIN JN642133_LHBs_P-D of FT:mat_peptide JN642133_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb21). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQSGRQSTPLSPPLRNTHPQAVQWNSTAFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTSLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSSYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642134_LHBs_P-D Product feature CHAIN JN642134_LHBs_P-D of FT:mat_peptide JN642134_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb22). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|JN642135_LHBs_P-D Product feature CHAIN JN642135_LHBs_P-D of FT:mat_peptide JN642135_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb24). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQSGRQPTPLTPPLRITHPHTMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLFVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642136_LHBs_P-D Product feature CHAIN JN642136_LHBs_P-D of FT:mat_peptide JN642136_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb25). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|JN642138_LHBs_P-D Product feature CHAIN JN642138_LHBs_P-D of FT:mat_peptide JN642138_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb28). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFVGGTTVCLGQNSQSPTSNHSPTSCPPTCPVYRWMCL
RHFIIILFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLTLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642140_LHBs_P-D Product feature CHAIN JN642140_LHBs_P-D of FT:mat_peptide JN642140_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb30). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFHFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPSLVSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642142_LHBs_P-D Product feature CHAIN JN642142_LHBs_P-D of FT:mat_peptide JN642142_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642143_LHBs_P-D Product feature CHAIN JN642143_LHBs_P-D of FT:mat_peptide JN642143_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb33). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPAN
PPPASTNRQSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642144_LHBs_P-D Product feature CHAIN JN642144_LHBs_P-D of FT:mat_peptide JN642144_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb34). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPAPTNRQSRRQPTPLSPPLRNTHPLAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGLNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLYLWVYI
>gnl|hbvpro|JN642145_LHBs_P-D Product feature CHAIN JN642145_LHBs_P-D of FT:mat_peptide JN642145_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb36). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLVVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642146_LHBs_P-D Product feature CHAIN JN642146_LHBs_P-D of FT:mat_peptide JN642146_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb38). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTN
QPPASTKRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642147_LHBs_P-D Product feature CHAIN JN642147_LHBs_P-D of FT:mat_peptide JN642147_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb39). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642148_LHBs_P-D Product feature CHAIN JN642148_LHBs_P-D of FT:mat_peptide JN642148_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb40). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642149_LHBs_P-D Product feature CHAIN JN642149_LHBs_P-D of FT:mat_peptide JN642149_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb41). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRRSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWSWGPRLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JN642150_LHBs_P-D Product feature CHAIN JN642150_LHBs_P-D of FT:mat_peptide JN642150_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb43). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPAPTTVSPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFVGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642151_LHBs_P-D Product feature CHAIN JN642151_LHBs_P-D of FT:mat_peptide JN642151_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb44). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLLLLPIFFCLWVYI
>gnl|hbvpro|JN642153_LHBs_P-D Product feature CHAIN JN642153_LHBs_P-D of FT:mat_peptide JN642153_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb47). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWSDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642154_LHBs_P-D Product feature CHAIN JN642154_LHBs_P-D of FT:mat_peptide JN642154_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb48). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSNSSTTGDP
AMNMEKIISEHLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILTPFLPLLPIFCYLWVYI
>gnl|hbvpro|JN642156_LHBs_P-D Product feature CHAIN JN642156_LHBs_P-D of FT:mat_peptide JN642156_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb50). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642157_LHBs_P-D Product feature CHAIN JN642157_LHBs_P-D of FT:mat_peptide JN642157_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb51). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642158_LHBs_P-D Product feature CHAIN JN642158_LHBs_P-D of FT:mat_peptide JN642158_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb57). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTYMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLCNILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642159_LHBs_P-D Product feature CHAIN JN642159_LHBs_P-D of FT:mat_peptide JN642159_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb52). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGMGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642161_LHBs_P-D Product feature CHAIN JN642161_LHBs_P-D of FT:mat_peptide JN642161_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb54). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCTTLRPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642163_LHBs_P-D Product feature CHAIN JN642163_LHBs_P-D of FT:mat_peptide JN642163_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb59). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTATTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPKLYSILSPFLLLLPIFFYLWVYI
>gnl|hbvpro|JN642164_LHBs_P-D Product feature CHAIN JN642164_LHBs_P-D of FT:mat_peptide JN642164_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb60). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQPLQDPKVSDQYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSTLTPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642165_LHBs_P-D Product feature CHAIN JN642165_LHBs_P-D of FT:mat_peptide JN642165_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb17). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642166_LHBs_P-D Product feature CHAIN JN642166_LHBs_P-D of FT:mat_peptide JN642166_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb35). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMESVTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN642167_LHBs_P-D Product feature CHAIN JN642167_LHBs_P-D of FT:mat_peptide JN642167_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb37). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664909_LHBs_P-D Product feature CHAIN JN664909_LHBs_P-D of FT:mat_peptide JN664909_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB36_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTGNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664910_LHBs_P-D Product feature CHAIN JN664910_LHBs_P-D of FT:mat_peptide JN664910_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB43_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664911_LHBs_P-D Product feature CHAIN JN664911_LHBs_P-D of FT:mat_peptide JN664911_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB47_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664912_LHBs_P-D Product feature CHAIN JN664912_LHBs_P-D of FT:mat_peptide JN664912_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB49_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTPNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCMTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664913_LHBs_P-D Product feature CHAIN JN664913_LHBs_P-D of FT:mat_peptide JN664913_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN01_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664914_LHBs_P-D Product feature CHAIN JN664914_LHBs_P-D of FT:mat_peptide JN664914_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN48_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664917_LHBs_P-D Product feature CHAIN JN664917_LHBs_P-D of FT:mat_peptide JN664917_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SKR_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQAPADPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664918_LHBs_P-D Product feature CHAIN JN664918_LHBs_P-D of FT:mat_peptide JN664918_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2198_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664919_LHBs_P-D Product feature CHAIN JN664919_LHBs_P-D of FT:mat_peptide JN664919_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2320_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664920_LHBs_P-D Product feature CHAIN JN664920_LHBs_P-D of FT:mat_peptide JN664920_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1903_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664921_LHBs_P-D Product feature CHAIN JN664921_LHBs_P-D of FT:mat_peptide JN664921_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN47_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664922_LHBs_P-D Product feature CHAIN JN664922_LHBs_P-D of FT:mat_peptide JN664922_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DH01_IC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGGCLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTGCLGQNLQSPTSNHSPTSCPPICPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664924_LHBs_P-D Product feature CHAIN JN664924_LHBs_P-D of FT:mat_peptide JN664924_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN32_CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGYSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPHAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCHGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664926_LHBs_P-D Product feature CHAIN JN664926_LHBs_P-D of FT:mat_peptide JN664926_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN63_CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYLPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664927_LHBs_P-D Product feature CHAIN JN664927_LHBs_P-D of FT:mat_peptide JN664927_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE20_CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664928_LHBs_P-D Product feature CHAIN JN664928_LHBs_P-D of FT:mat_peptide JN664928_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE27_CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPPSTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLYSLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPMLPIFFCLWVYI
>gnl|hbvpro|JN664930_LHBs_P-D Product feature CHAIN JN664930_LHBs_P-D of FT:mat_peptide JN664930_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEN9_CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTAYPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPHAHGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664931_LHBs_P-D Product feature CHAIN JN664931_LHBs_P-D of FT:mat_peptide JN664931_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB6_CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPAN
PPPASTTRQSGRQPTPLSPPLRITHPQAIQWNSTTFQQSLQDPKVRGLYFPAGGSSSGTVNPVPTTVSHTSSILSRIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIISLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664932_LHBs_P-D Product feature CHAIN JN664932_LHBs_P-D of FT:mat_peptide JN664932_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2235_CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCITTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|JN664936_LHBs_P-D Product feature CHAIN JN664936_LHBs_P-D of FT:mat_peptide JN664936_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate E3529_LC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASANRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664937_LHBs_P-D Product feature CHAIN JN664937_LHBs_P-D of FT:mat_peptide JN664937_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN45_LC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664938_LHBs_P-D Product feature CHAIN JN664938_LHBs_P-D of FT:mat_peptide JN664938_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN46_LC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664939_LHBs_P-D Product feature CHAIN JN664939_LHBs_P-D of FT:mat_peptide JN664939_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN71_LC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN664941_LHBs_P-D Product feature CHAIN JN664941_LHBs_P-D of FT:mat_peptide JN664941_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB21_LC). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTPNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN688678_LHBs_P-D Product feature CHAIN JN688678_LHBs_P-D of FT:mat_peptide JN688678_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV007). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRKSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN688679_LHBs_P-D Product feature CHAIN JN688679_LHBs_P-D of FT:mat_peptide JN688679_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV010). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDL
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN688683_LHBs_P-D Product feature CHAIN JN688683_LHBs_P-D of FT:mat_peptide JN688683_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV087). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN688685_LHBs_P-D Product feature CHAIN JN688685_LHBs_P-D of FT:mat_peptide JN688685_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV097). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=388 residues).
MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRDTHPQAQWTSSTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRTGDLA
LNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLR
RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAF
GKFLWEWASARFSWLSLLVPFVQWFVGSSPTVWLSVIWMMWYWGPRLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN688695_LHBs_P-D Product feature CHAIN JN688695_LHBs_P-D of FT:mat_peptide JN688695_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV128). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWXYI
>gnl|hbvpro|JN688708_LHBs_P-D Product feature CHAIN JN688708_LHBs_P-D of FT:mat_peptide JN688708_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV142). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN688710_LHBs_P-D Product feature CHAIN JN688710_LHBs_P-D of FT:mat_peptide JN688710_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV144). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGITPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQAGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSXLRPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN688711_LHBs_P-D Product feature CHAIN JN688711_LHBs_P-D of FT:mat_peptide JN688711_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV161). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGXTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRLIGLDVSAGGSSSGTVNPVPTTASPLSSIVSRIVNP
AMNMENFQSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN688712_LHBs_P-D Product feature CHAIN JN688712_LHBs_P-D of FT:mat_peptide JN688712_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV163). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWGWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRFLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN688713_LHBs_P-D Product feature CHAIN JN688713_LHBs_P-D of FT:mat_peptide JN688713_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV173). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792903_LHBs_P-D Product feature CHAIN JN792903_LHBs_P-D of FT:mat_peptide JN792903_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 310000127). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792904_LHBs_P-D Product feature CHAIN JN792904_LHBs_P-D of FT:mat_peptide JN792904_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002943). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792905_LHBs_P-D Product feature CHAIN JN792905_LHBs_P-D of FT:mat_peptide JN792905_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000345). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
LGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPNLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792906_LHBs_P-D Product feature CHAIN JN792906_LHBs_P-D of FT:mat_peptide JN792906_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002958). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTYPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGHSPTVWLSVIWMMWFWGPSLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792907_LHBs_P-D Product feature CHAIN JN792907_LHBs_P-D of FT:mat_peptide JN792907_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000473). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792908_LHBs_P-D Product feature CHAIN JN792908_LHBs_P-D of FT:mat_peptide JN792908_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002951). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTYPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792909_LHBs_P-D Product feature CHAIN JN792909_LHBs_P-D of FT:mat_peptide JN792909_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000479). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792910_LHBs_P-D Product feature CHAIN JN792910_LHBs_P-D of FT:mat_peptide JN792910_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 109001205). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792911_LHBs_P-D Product feature CHAIN JN792911_LHBs_P-D of FT:mat_peptide JN792911_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002952). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRITHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JN792912_LHBs_P-D Product feature CHAIN JN792912_LHBs_P-D of FT:mat_peptide JN792912_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 307000449). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVVLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|JQ687530_LHBs_P-D Product feature CHAIN JQ687530_LHBs_P-D of FT:mat_peptide JQ687530_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 200). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ687531_LHBs_P-D Product feature CHAIN JQ687531_LHBs_P-D of FT:mat_peptide JQ687531_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 205). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLMPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707476_LHBs_P-D Product feature CHAIN JQ707476_LHBs_P-D of FT:mat_peptide JQ707476_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707478_LHBs_P-D Product feature CHAIN JQ707478_LHBs_P-D of FT:mat_peptide JQ707478_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707479_LHBs_P-D Product feature CHAIN JQ707479_LHBs_P-D of FT:mat_peptide JQ707479_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C13). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707480_LHBs_P-D Product feature CHAIN JQ707480_LHBs_P-D of FT:mat_peptide JQ707480_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C14). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSERQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707481_LHBs_P-D Product feature CHAIN JQ707481_LHBs_P-D of FT:mat_peptide JQ707481_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C16). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707482_LHBs_P-D Product feature CHAIN JQ707482_LHBs_P-D of FT:mat_peptide JQ707482_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C17-2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707483_LHBs_P-D Product feature CHAIN JQ707483_LHBs_P-D of FT:mat_peptide JQ707483_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C18). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTNNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENIISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFYLWVYI
>gnl|hbvpro|JQ707485_LHBs_P-D Product feature CHAIN JQ707485_LHBs_P-D of FT:mat_peptide JQ707485_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C22). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707486_LHBs_P-D Product feature CHAIN JQ707486_LHBs_P-D of FT:mat_peptide JQ707486_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C24). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFYLWVYI
>gnl|hbvpro|JQ707487_LHBs_P-D Product feature CHAIN JQ707487_LHBs_P-D of FT:mat_peptide JQ707487_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C25). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707488_LHBs_P-D Product feature CHAIN JQ707488_LHBs_P-D of FT:mat_peptide JQ707488_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C26). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707489_LHBs_P-D Product feature CHAIN JQ707489_LHBs_P-D of FT:mat_peptide JQ707489_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C28). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707490_LHBs_P-D Product feature CHAIN JQ707490_LHBs_P-D of FT:mat_peptide JQ707490_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C29). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707493_LHBs_P-D Product feature CHAIN JQ707493_LHBs_P-D of FT:mat_peptide JQ707493_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C31). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGASTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCPWVYI
>gnl|hbvpro|JQ707494_LHBs_P-D Product feature CHAIN JQ707494_LHBs_P-D of FT:mat_peptide JQ707494_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707496_LHBs_P-D Product feature CHAIN JQ707496_LHBs_P-D of FT:mat_peptide JQ707496_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C34-2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707497_LHBs_P-D Product feature CHAIN JQ707497_LHBs_P-D of FT:mat_peptide JQ707497_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C36). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASALFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707499_LHBs_P-D Product feature CHAIN JQ707499_LHBs_P-D of FT:mat_peptide JQ707499_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C38). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707500_LHBs_P-D Product feature CHAIN JQ707500_LHBs_P-D of FT:mat_peptide JQ707500_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C40). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707502_LHBs_P-D Product feature CHAIN JQ707502_LHBs_P-D of FT:mat_peptide JQ707502_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C42). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707503_LHBs_P-D Product feature CHAIN JQ707503_LHBs_P-D of FT:mat_peptide JQ707503_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C43). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707505_LHBs_P-D Product feature CHAIN JQ707505_LHBs_P-D of FT:mat_peptide JQ707505_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C45). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707507_LHBs_P-D Product feature CHAIN JQ707507_LHBs_P-D of FT:mat_peptide JQ707507_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C48). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707508_LHBs_P-D Product feature CHAIN JQ707508_LHBs_P-D of FT:mat_peptide JQ707508_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707512_LHBs_P-D Product feature CHAIN JQ707512_LHBs_P-D of FT:mat_peptide JQ707512_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C1-22). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707513_LHBs_P-D Product feature CHAIN JQ707513_LHBs_P-D of FT:mat_peptide JQ707513_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C11). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707514_LHBs_P-D Product feature CHAIN JQ707514_LHBs_P-D of FT:mat_peptide JQ707514_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707515_LHBs_P-D Product feature CHAIN JQ707515_LHBs_P-D of FT:mat_peptide JQ707515_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C13). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PSPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707516_LHBs_P-D Product feature CHAIN JQ707516_LHBs_P-D of FT:mat_peptide JQ707516_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C15). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707517_LHBs_P-D Product feature CHAIN JQ707517_LHBs_P-D of FT:mat_peptide JQ707517_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C16). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707518_LHBs_P-D Product feature CHAIN JQ707518_LHBs_P-D of FT:mat_peptide JQ707518_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C17-3). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707519_LHBs_P-D Product feature CHAIN JQ707519_LHBs_P-D of FT:mat_peptide JQ707519_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C22). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707520_LHBs_P-D Product feature CHAIN JQ707520_LHBs_P-D of FT:mat_peptide JQ707520_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C24). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707521_LHBs_P-D Product feature CHAIN JQ707521_LHBs_P-D of FT:mat_peptide JQ707521_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707522_LHBs_P-D Product feature CHAIN JQ707522_LHBs_P-D of FT:mat_peptide JQ707522_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C35). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707523_LHBs_P-D Product feature CHAIN JQ707523_LHBs_P-D of FT:mat_peptide JQ707523_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C36). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707524_LHBs_P-D Product feature CHAIN JQ707524_LHBs_P-D of FT:mat_peptide JQ707524_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMEWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707525_LHBs_P-D Product feature CHAIN JQ707525_LHBs_P-D of FT:mat_peptide JQ707525_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C40). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMEWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707526_LHBs_P-D Product feature CHAIN JQ707526_LHBs_P-D of FT:mat_peptide JQ707526_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C43). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707527_LHBs_P-D Product feature CHAIN JQ707527_LHBs_P-D of FT:mat_peptide JQ707527_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C44). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFYLWVYI
>gnl|hbvpro|JQ707528_LHBs_P-D Product feature CHAIN JQ707528_LHBs_P-D of FT:mat_peptide JQ707528_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C45). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707529_LHBs_P-D Product feature CHAIN JQ707529_LHBs_P-D of FT:mat_peptide JQ707529_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C46). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRRMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707530_LHBs_P-D Product feature CHAIN JQ707530_LHBs_P-D of FT:mat_peptide JQ707530_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C9). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFSLWVYI
>gnl|hbvpro|JQ707682_LHBs_P-D Product feature CHAIN JQ707682_LHBs_P-D of FT:mat_peptide JQ707682_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_1-10). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707683_LHBs_P-D Product feature CHAIN JQ707683_LHBs_P-D of FT:mat_peptide JQ707683_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_10). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
VLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTIIAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707684_LHBs_P-D Product feature CHAIN JQ707684_LHBs_P-D of FT:mat_peptide JQ707684_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_11). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707685_LHBs_P-D Product feature CHAIN JQ707685_LHBs_P-D of FT:mat_peptide JQ707685_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707686_LHBs_P-D Product feature CHAIN JQ707686_LHBs_P-D of FT:mat_peptide JQ707686_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_14). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPDKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707687_LHBs_P-D Product feature CHAIN JQ707687_LHBs_P-D of FT:mat_peptide JQ707687_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_15). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707688_LHBs_P-D Product feature CHAIN JQ707688_LHBs_P-D of FT:mat_peptide JQ707688_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_16). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707689_LHBs_P-D Product feature CHAIN JQ707689_LHBs_P-D of FT:mat_peptide JQ707689_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_17). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTNARPCRTCTTTAQGTSMYPSCCCTKLSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707690_LHBs_P-D Product feature CHAIN JQ707690_LHBs_P-D of FT:mat_peptide JQ707690_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_20). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGFSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707691_LHBs_P-D Product feature CHAIN JQ707691_LHBs_P-D of FT:mat_peptide JQ707691_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_25). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707692_LHBs_P-D Product feature CHAIN JQ707692_LHBs_P-D of FT:mat_peptide JQ707692_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_26). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707693_LHBs_P-D Product feature CHAIN JQ707693_LHBs_P-D of FT:mat_peptide JQ707693_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_27). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RHFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707694_LHBs_P-D Product feature CHAIN JQ707694_LHBs_P-D of FT:mat_peptide JQ707694_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_28). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707695_LHBs_P-D Product feature CHAIN JQ707695_LHBs_P-D of FT:mat_peptide JQ707695_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_29). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707696_LHBs_P-D Product feature CHAIN JQ707696_LHBs_P-D of FT:mat_peptide JQ707696_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_3). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707697_LHBs_P-D Product feature CHAIN JQ707697_LHBs_P-D of FT:mat_peptide JQ707697_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_30). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
VLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707698_LHBs_P-D Product feature CHAIN JQ707698_LHBs_P-D of FT:mat_peptide JQ707698_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707699_LHBs_P-D Product feature CHAIN JQ707699_LHBs_P-D of FT:mat_peptide JQ707699_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_35). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
VLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707700_LHBs_P-D Product feature CHAIN JQ707700_LHBs_P-D of FT:mat_peptide JQ707700_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_36-11). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707701_LHBs_P-D Product feature CHAIN JQ707701_LHBs_P-D of FT:mat_peptide JQ707701_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_37). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707702_LHBs_P-D Product feature CHAIN JQ707702_LHBs_P-D of FT:mat_peptide JQ707702_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_43). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
VLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707703_LHBs_P-D Product feature CHAIN JQ707703_LHBs_P-D of FT:mat_peptide JQ707703_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_45). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVXPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707704_LHBs_P-D Product feature CHAIN JQ707704_LHBs_P-D of FT:mat_peptide JQ707704_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707705_LHBs_P-D Product feature CHAIN JQ707705_LHBs_P-D of FT:mat_peptide JQ707705_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_7). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ707706_LHBs_P-D Product feature CHAIN JQ707706_LHBs_P-D of FT:mat_peptide JQ707706_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_8-2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDL
VLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTITAQGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JQ927384_LHBs_P-D Product feature CHAIN JQ927384_LHBs_P-D of FT:mat_peptide JQ927384_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KM2109). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAIXWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX036333_LHBs_P-D Product feature CHAIN JX036333_LHBs_P-D of FT:mat_peptide JX036333_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y2-11). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX036334_LHBs_P-D Product feature CHAIN JX036334_LHBs_P-D of FT:mat_peptide JX036334_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y2-12). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLHDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYHWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FAKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMTWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090605_LHBs_P-D Product feature CHAIN JX090605_LHBs_P-D of FT:mat_peptide JX090605_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL105). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLALQAGFFLLTGILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090606_LHBs_P-D Product feature CHAIN JX090606_LHBs_P-D of FT:mat_peptide JX090606_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLSGWSPQAQGIIQTLPAN
PPPASTNRQSRRQPTPLSQPLRNTHPQAMKWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSNTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSLTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090607_LHBs_P-D Product feature CHAIN JX090607_LHBs_P-D of FT:mat_peptide JX090607_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL134). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLSILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090608_LHBs_P-D Product feature CHAIN JX090608_LHBs_P-D of FT:mat_peptide JX090608_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL135). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090609_LHBs_P-D Product feature CHAIN JX090609_LHBs_P-D of FT:mat_peptide JX090609_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL151). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGACGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTPRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLLAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQFPTSNHSLTSCPPTCPGYHWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDENCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090610_LHBs_P-D Product feature CHAIN JX090610_LHBs_P-D of FT:mat_peptide JX090610_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL161). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGSFGMGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ARNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCNILSRFIPLLPIFLCLWVYI
>gnl|hbvpro|JX090611_LHBs_P-D Product feature CHAIN JX090611_LHBs_P-D of FT:mat_peptide JX090611_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL162). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPMGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPLTCPGYRWMCL
RRFIIFLFILMLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPNLYRILSPFLLLLPIFFCLWVYI
>gnl|hbvpro|JX090612_LHBs_P-D Product feature CHAIN JX090612_LHBs_P-D of FT:mat_peptide JX090612_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL165). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090613_LHBs_P-D Product feature CHAIN JX090613_LHBs_P-D of FT:mat_peptide JX090613_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL197). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090615_LHBs_P-D Product feature CHAIN JX090615_LHBs_P-D of FT:mat_peptide JX090615_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL209). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAT
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVQTTASPSSSTFLRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090616_LHBs_P-D Product feature CHAIN JX090616_LHBs_P-D of FT:mat_peptide JX090616_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL213). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSVRNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLLPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|JX090617_LHBs_P-D Product feature CHAIN JX090617_LHBs_P-D of FT:mat_peptide JX090617_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL273). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090618_LHBs_P-D Product feature CHAIN JX090618_LHBs_P-D of FT:mat_peptide JX090618_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL326). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKXGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090619_LHBs_P-D Product feature CHAIN JX090619_LHBs_P-D of FT:mat_peptide JX090619_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL352). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPISTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090620_LHBs_P-D Product feature CHAIN JX090620_LHBs_P-D of FT:mat_peptide JX090620_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL369). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090621_LHBs_P-D Product feature CHAIN JX090621_LHBs_P-D of FT:mat_peptide JX090621_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL378). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRBTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVTWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090622_LHBs_P-D Product feature CHAIN JX090622_LHBs_P-D of FT:mat_peptide JX090622_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL396). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTMPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCWCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLVRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090623_LHBs_P-D Product feature CHAIN JX090623_LHBs_P-D of FT:mat_peptide JX090623_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL398). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFSLTRILTMPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFIQLICLILSLVLVDYQGKLPVCPIIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090624_LHBs_P-D Product feature CHAIN JX090624_LHBs_P-D of FT:mat_peptide JX090624_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL417). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGFRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLCTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090625_LHBs_P-D Product feature CHAIN JX090625_LHBs_P-D of FT:mat_peptide JX090625_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-AL480). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090626_LHBs_P-D Product feature CHAIN JX090626_LHBs_P-D of FT:mat_peptide JX090626_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU460). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090627_LHBs_P-D Product feature CHAIN JX090627_LHBs_P-D of FT:mat_peptide JX090627_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU461). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090628_LHBs_P-D Product feature CHAIN JX090628_LHBs_P-D of FT:mat_peptide JX090628_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU473). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090629_LHBs_P-D Product feature CHAIN JX090629_LHBs_P-D of FT:mat_peptide JX090629_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU261). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLEAGFFLLTRILTLPHSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090630_LHBs_P-D Product feature CHAIN JX090630_LHBs_P-D of FT:mat_peptide JX090630_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU272). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090631_LHBs_P-D Product feature CHAIN JX090631_LHBs_P-D of FT:mat_peptide JX090631_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU292). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090632_LHBs_P-D Product feature CHAIN JX090632_LHBs_P-D of FT:mat_peptide JX090632_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU302). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090633_LHBs_P-D Product feature CHAIN JX090633_LHBs_P-D of FT:mat_peptide JX090633_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KE-BEK10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090634_LHBs_P-D Product feature CHAIN JX090634_LHBs_P-D of FT:mat_peptide JX090634_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KE-BEK115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFQQTLQDPRVRGLYFPAGGSSTGTVNPVPTTVSHISSIFSRIADP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPISFCLWVYI
>gnl|hbvpro|JX090635_LHBs_P-D Product feature CHAIN JX090635_LHBs_P-D of FT:mat_peptide JX090635_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KE-BEK32). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSSSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
SPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVELSLIVWLSVIWMTWYWGRSLYHILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090636_LHBs_P-D Product feature CHAIN JX090636_LHBs_P-D of FT:mat_peptide JX090636_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KE-BEK93). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQARGILHTVPAN
PPPASTNRQSGRQPTPVSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGTCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090638_LHBs_P-D Product feature CHAIN JX090638_LHBs_P-D of FT:mat_peptide JX090638_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU509). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090639_LHBs_P-D Product feature CHAIN JX090639_LHBs_P-D of FT:mat_peptide JX090639_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU538). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090640_LHBs_P-D Product feature CHAIN JX090640_LHBs_P-D of FT:mat_peptide JX090640_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU546). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSSCGTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090641_LHBs_P-D Product feature CHAIN JX090641_LHBs_P-D of FT:mat_peptide JX090641_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU549). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLIVLQAAFFLLTRILTIPQSLDSWWNSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090642_LHBs_P-D Product feature CHAIN JX090642_LHBs_P-D of FT:mat_peptide JX090642_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU559). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090643_LHBs_P-D Product feature CHAIN JX090643_LHBs_P-D of FT:mat_peptide JX090643_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU560). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090644_LHBs_P-D Product feature CHAIN JX090644_LHBs_P-D of FT:mat_peptide JX090644_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU561). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLLAAFFLLTRILTTPQSLDSWWTSLNFLGGTTACLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090645_LHBs_P-D Product feature CHAIN JX090645_LHBs_P-D of FT:mat_peptide JX090645_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU566). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090646_LHBs_P-D Product feature CHAIN JX090646_LHBs_P-D of FT:mat_peptide JX090646_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU576). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090647_LHBs_P-D Product feature CHAIN JX090647_LHBs_P-D of FT:mat_peptide JX090647_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-PR144). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALKMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYIILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090649_LHBs_P-D Product feature CHAIN JX090649_LHBs_P-D of FT:mat_peptide JX090649_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-IR239). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090650_LHBs_P-D Product feature CHAIN JX090650_LHBs_P-D of FT:mat_peptide JX090650_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-IR97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090651_LHBs_P-D Product feature CHAIN JX090651_LHBs_P-D of FT:mat_peptide JX090651_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-IR119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090652_LHBs_P-D Product feature CHAIN JX090652_LHBs_P-D of FT:mat_peptide JX090652_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-IR125). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090653_LHBs_P-D Product feature CHAIN JX090653_LHBs_P-D of FT:mat_peptide JX090653_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-IR128). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090654_LHBs_P-D Product feature CHAIN JX090654_LHBs_P-D of FT:mat_peptide JX090654_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-IR165). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090655_LHBs_P-D Product feature CHAIN JX090655_LHBs_P-D of FT:mat_peptide JX090655_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-IR211). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090656_LHBs_P-D Product feature CHAIN JX090656_LHBs_P-D of FT:mat_peptide JX090656_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS130). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTDNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTRPAN
PPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFSPLLPIFFCLWVYI
>gnl|hbvpro|JX090657_LHBs_P-D Product feature CHAIN JX090657_LHBs_P-D of FT:mat_peptide JX090657_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS134). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAT
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRNGGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090658_LHBs_P-D Product feature CHAIN JX090658_LHBs_P-D of FT:mat_peptide JX090658_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS285). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGHSPTVWLLVIWMKWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090659_LHBs_P-D Product feature CHAIN JX090659_LHBs_P-D of FT:mat_peptide JX090659_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS287). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090660_LHBs_P-D Product feature CHAIN JX090660_LHBs_P-D of FT:mat_peptide JX090660_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS288). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090661_LHBs_P-D Product feature CHAIN JX090661_LHBs_P-D of FT:mat_peptide JX090661_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS302). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090662_LHBs_P-D Product feature CHAIN JX090662_LHBs_P-D of FT:mat_peptide JX090662_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS311). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090663_LHBs_P-D Product feature CHAIN JX090663_LHBs_P-D of FT:mat_peptide JX090663_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS334). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCPILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090665_LHBs_P-D Product feature CHAIN JX090665_LHBs_P-D of FT:mat_peptide JX090665_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS375). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLINILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090666_LHBs_P-D Product feature CHAIN JX090666_LHBs_P-D of FT:mat_peptide JX090666_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS413). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090667_LHBs_P-D Product feature CHAIN JX090667_LHBs_P-D of FT:mat_peptide JX090667_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS422). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDLAFRANTANPDWDSNPNKDTWPDANMVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGTCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090668_LHBs_P-D Product feature CHAIN JX090668_LHBs_P-D of FT:mat_peptide JX090668_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS440). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090670_LHBs_P-D Product feature CHAIN JX090670_LHBs_P-D of FT:mat_peptide JX090670_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS457). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQLGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQCPTSNHSPTSCPPICPGYRWMCL
RRFIICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090671_LHBs_P-D Product feature CHAIN JX090671_LHBs_P-D of FT:mat_peptide JX090671_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS464). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTAVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARLSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090672_LHBs_P-D Product feature CHAIN JX090672_LHBs_P-D of FT:mat_peptide JX090672_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS470). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090673_LHBs_P-D Product feature CHAIN JX090673_LHBs_P-D of FT:mat_peptide JX090673_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS479). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090674_LHBs_P-D Product feature CHAIN JX090674_LHBs_P-D of FT:mat_peptide JX090674_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-MS503). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090675_LHBs_P-D Product feature CHAIN JX090675_LHBs_P-D of FT:mat_peptide JX090675_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH160). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090676_LHBs_P-D Product feature CHAIN JX090676_LHBs_P-D of FT:mat_peptide JX090676_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH206). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX090677_LHBs_P-D Product feature CHAIN JX090677_LHBs_P-D of FT:mat_peptide JX090677_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH265). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLALLVYQGMLPVCPLIPGSSTTITGPCRTCTTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMICYWGPNLYNILSPFITLLPIFFCLWVYI
>gnl|hbvpro|JX090678_LHBs_P-D Product feature CHAIN JX090678_LHBs_P-D of FT:mat_peptide JX090678_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH295). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIGDL
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RHFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|JX090679_LHBs_P-D Product feature CHAIN JX090679_LHBs_P-D of FT:mat_peptide JX090679_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH63). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090680_LHBs_P-D Product feature CHAIN JX090680_LHBs_P-D of FT:mat_peptide JX090680_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-NUK101). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSRRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRLMCL
RRSIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLLSILNHFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090681_LHBs_P-D Product feature CHAIN JX090681_LHBs_P-D of FT:mat_peptide JX090681_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-NUK368). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPIKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090682_LHBs_P-D Product feature CHAIN JX090682_LHBs_P-D of FT:mat_peptide JX090682_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-NUK416). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQALPAN
PSPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQETSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090683_LHBs_P-D Product feature CHAIN JX090683_LHBs_P-D of FT:mat_peptide JX090683_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-NUK429). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVRLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090684_LHBs_P-D Product feature CHAIN JX090684_LHBs_P-D of FT:mat_peptide JX090684_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-NUK546). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090685_LHBs_P-D Product feature CHAIN JX090685_LHBs_P-D of FT:mat_peptide JX090685_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-NUK550). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPGANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMEYITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090686_LHBs_P-D Product feature CHAIN JX090686_LHBs_P-D of FT:mat_peptide JX090686_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-NUK629). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLDSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090687_LHBs_P-D Product feature CHAIN JX090687_LHBs_P-D of FT:mat_peptide JX090687_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I-NUK635). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090688_LHBs_P-D Product feature CHAIN JX090688_LHBs_P-D of FT:mat_peptide JX090688_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQVAQWNFTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090689_LHBs_P-D Product feature CHAIN JX090689_LHBs_P-D of FT:mat_peptide JX090689_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSHHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090690_LHBs_P-D Product feature CHAIN JX090690_LHBs_P-D of FT:mat_peptide JX090690_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH658). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILHTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSHFERTGDL
ARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIICLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTITAQGTSMYPSCCCTKPSYGNGTCIPIPSSWA
FGKFLWEWASSRFSWLSLLVPFVQWFVGLSPTVWLSIIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090693_LHBs_P-D Product feature CHAIN JX090693_LHBs_P-D of FT:mat_peptide JX090693_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-PUR417). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTGSPISSIFSRNGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090694_LHBs_P-D Product feature CHAIN JX090694_LHBs_P-D of FT:mat_peptide JX090694_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-PUR777). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090695_LHBs_P-D Product feature CHAIN JX090695_LHBs_P-D of FT:mat_peptide JX090695_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-PUR844). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090696_LHBs_P-D Product feature CHAIN JX090696_LHBs_P-D of FT:mat_peptide JX090696_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-PUR85). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWSDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090697_LHBs_P-D Product feature CHAIN JX090697_LHBs_P-D of FT:mat_peptide JX090697_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-PR945). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLICLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSIYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLLLLPIFFCLWVYI
>gnl|hbvpro|JX090698_LHBs_P-D Product feature CHAIN JX090698_LHBs_P-D of FT:mat_peptide JX090698_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-PR1122). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090699_LHBs_P-D Product feature CHAIN JX090699_LHBs_P-D of FT:mat_peptide JX090699_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-PR1174). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090700_LHBs_P-D Product feature CHAIN JX090700_LHBs_P-D of FT:mat_peptide JX090700_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH660). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLSTIWSPLLPLLPIFLCLWVYI
>gnl|hbvpro|JX090701_LHBs_P-D Product feature CHAIN JX090701_LHBs_P-D of FT:mat_peptide JX090701_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-TH29). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGMMLTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
LGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090702_LHBs_P-D Product feature CHAIN JX090702_LHBs_P-D of FT:mat_peptide JX090702_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-TH85). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090703_LHBs_P-D Product feature CHAIN JX090703_LHBs_P-D of FT:mat_peptide JX090703_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU120). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDWWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090704_LHBs_P-D Product feature CHAIN JX090704_LHBs_P-D of FT:mat_peptide JX090704_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU142). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090705_LHBs_P-D Product feature CHAIN JX090705_LHBs_P-D of FT:mat_peptide JX090705_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU155). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090706_LHBs_P-D Product feature CHAIN JX090706_LHBs_P-D of FT:mat_peptide JX090706_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU158). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090707_LHBs_P-D Product feature CHAIN JX090707_LHBs_P-D of FT:mat_peptide JX090707_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU208). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090708_LHBs_P-D Product feature CHAIN JX090708_LHBs_P-D of FT:mat_peptide JX090708_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU41). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090709_LHBs_P-D Product feature CHAIN JX090709_LHBs_P-D of FT:mat_peptide JX090709_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU83). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090710_LHBs_P-D Product feature CHAIN JX090710_LHBs_P-D of FT:mat_peptide JX090710_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KR-DU84). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090711_LHBs_P-D Product feature CHAIN JX090711_LHBs_P-D of FT:mat_peptide JX090711_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH429). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090712_LHBs_P-D Product feature CHAIN JX090712_LHBs_P-D of FT:mat_peptide JX090712_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH435). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGQGFTPPHGGLLGWSPQAQGIIHTLPAN
PPPTSTNRQSGRQPTPLSPPLRITHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLIFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFLLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPCLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090713_LHBs_P-D Product feature CHAIN JX090713_LHBs_P-D of FT:mat_peptide JX090713_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH475). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090715_LHBs_P-D Product feature CHAIN JX090715_LHBs_P-D of FT:mat_peptide JX090715_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH539). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLTLLPIFFCLWVYI
>gnl|hbvpro|JX090716_LHBs_P-D Product feature CHAIN JX090716_LHBs_P-D of FT:mat_peptide JX090716_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH637). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090717_LHBs_P-D Product feature CHAIN JX090717_LHBs_P-D of FT:mat_peptide JX090717_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH638). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090718_LHBs_P-D Product feature CHAIN JX090718_LHBs_P-D of FT:mat_peptide JX090718_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y-SH393). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090719_LHBs_P-D Product feature CHAIN JX090719_LHBs_P-D of FT:mat_peptide JX090719_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-ZH103). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGLNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090720_LHBs_P-D Product feature CHAIN JX090720_LHBs_P-D of FT:mat_peptide JX090720_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-ZH132). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSMGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMKWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090721_LHBs_P-D Product feature CHAIN JX090721_LHBs_P-D of FT:mat_peptide JX090721_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-ZH139). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCFGQNSQSPTSNHSPTSCPPTCPGYRWMCM
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMKRYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090723_LHBs_P-D Product feature CHAIN JX090723_LHBs_P-D of FT:mat_peptide JX090723_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-ZH38). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGIVNPVPTTVSPISSIFSRIGDL
ARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX090724_LHBs_P-D Product feature CHAIN JX090724_LHBs_P-D of FT:mat_peptide JX090724_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A-ZH8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTKRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX096954_LHBs_P-D Product feature CHAIN JX096954_LHBs_P-D of FT:mat_peptide JX096954_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1-3242). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX096955_LHBs_P-D Product feature CHAIN JX096955_LHBs_P-D of FT:mat_peptide JX096955_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2-3051). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTTNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTSAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX096956_LHBs_P-D Product feature CHAIN JX096956_LHBs_P-D of FT:mat_peptide JX096956_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5-6154). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX096957_LHBs_P-D Product feature CHAIN JX096957_LHBs_P-D of FT:mat_peptide JX096957_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6-2646). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX096958_LHBs_P-D Product feature CHAIN JX096958_LHBs_P-D of FT:mat_peptide JX096958_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7-1276). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX310726_LHBs_P-D Product feature CHAIN JX310726_LHBs_P-D of FT:mat_peptide JX310726_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPGANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPITASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLGLLDYQGILPVCPLIPGSSTTSTGPCKTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVELSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX310727_LHBs_P-D Product feature CHAIN JX310727_LHBs_P-D of FT:mat_peptide JX310727_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D13). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPAN
PPPASTTRQSGRQPTPPSPPLRNTHPQAIQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASPTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLAHLDYRGTLAVCPLIRNSSTTSTGQCTACTTTAPGTSMHPFCCCTKPSEGNCTCIPIPSSWA
FAKFLWEWASVHFSWLNSLVQYVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX310728_LHBs_P-D Product feature CHAIN JX310728_LHBs_P-D of FT:mat_peptide JX310728_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPLLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFSLVLLDCHGMLPVCPIIPGSSTTSAGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX310729_LHBs_P-D Product feature CHAIN JX310729_LHBs_P-D of FT:mat_peptide JX310729_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D21). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSLGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLHVCPLIPGSSTTSAGSCRTCTTTAQGTSMYPSCCCTKPSEGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX310733_LHBs_P-D Product feature CHAIN JX310733_LHBs_P-D of FT:mat_peptide JX310733_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D23_1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRIXTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSMGTCRGCTTPAPGTSMYPSCCCTKPSXRNCTCIPIPSSWA
FGRFLWXWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLXIFFCLWGYI
>gnl|hbvpro|JX310734_LHBs_P-D Product feature CHAIN JX310734_LHBs_P-D of FT:mat_peptide JX310734_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D23_3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=388 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGITPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNTTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDPA
MNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLR
RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCRTCTTPALGTSMYPSCCCTKILEKNCTCIPIPSSWAF
GRFLWEWASARFSWLSSLVPYVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFCCLWAYI
>gnl|hbvpro|JX310735_LHBs_P-D Product feature CHAIN JX310735_LHBs_P-D of FT:mat_peptide JX310735_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D23_4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANQDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFRKTLQDPRVRGLYFPAGGFSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGQCKTCTTLALGTSMYPSCCCTKPSDRNCTCIPIPSSWA
FGRFLWEWASARFSWLSSLVPCVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|JX470760_LHBs_P-D Product feature CHAIN JX470760_LHBs_P-D of FT:mat_peptide JX470760_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H-IDU6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRKTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSATTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIXIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX898689_LHBs_P-D Product feature CHAIN JX898689_LHBs_P-D of FT:mat_peptide JX898689_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P29). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDASKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX898691_LHBs_P-D Product feature CHAIN JX898691_LHBs_P-D of FT:mat_peptide JX898691_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P17). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX898692_LHBs_P-D Product feature CHAIN JX898692_LHBs_P-D of FT:mat_peptide JX898692_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P19). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX898694_LHBs_P-D Product feature CHAIN JX898694_LHBs_P-D of FT:mat_peptide JX898694_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P24). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPYCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|JX898697_LHBs_P-D Product feature CHAIN JX898697_LHBs_P-D of FT:mat_peptide JX898697_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC012652_LHBs_P-D Product feature CHAIN KC012652_LHBs_P-D of FT:mat_peptide KC012652_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRKTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSATTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIXIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875276_LHBs_P-D Product feature CHAIN KC875276_LHBs_P-D of FT:mat_peptide KC875276_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPRHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPAPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCAPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGFSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875277_LHBs_P-D Product feature CHAIN KC875277_LHBs_P-D of FT:mat_peptide KC875277_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV7). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLVGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQLNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875278_LHBs_P-D Product feature CHAIN KC875278_LHBs_P-D of FT:mat_peptide KC875278_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV38). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLVPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875279_LHBs_P-D Product feature CHAIN KC875279_LHBs_P-D of FT:mat_peptide KC875279_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV11). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGRLGWSPQAQGIIQTLRAN
PPPASTNRQSGRQPTPLSPPLRNTHPQTMQWNSTTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPFRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875280_LHBs_P-D Product feature CHAIN KC875280_LHBs_P-D of FT:mat_peptide KC875280_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV20). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTCHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGPSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875281_LHBs_P-D Product feature CHAIN KC875281_LHBs_P-D of FT:mat_peptide KC875281_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV32). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTLHQTLQDPRVRALYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875282_LHBs_P-D Product feature CHAIN KC875282_LHBs_P-D of FT:mat_peptide KC875282_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV13). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFKPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPHAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVRLDYQGMLPVCPLIPGSSTTSTGPCRTCMTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875283_LHBs_P-D Product feature CHAIN KC875283_LHBs_P-D of FT:mat_peptide KC875283_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV15). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFAPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875284_LHBs_P-D Product feature CHAIN KC875284_LHBs_P-D of FT:mat_peptide KC875284_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV28). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDRRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875285_LHBs_P-D Product feature CHAIN KC875285_LHBs_P-D of FT:mat_peptide KC875285_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV29). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRESGRQPTPLSPPLRKTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875286_LHBs_P-D Product feature CHAIN KC875286_LHBs_P-D of FT:mat_peptide KC875286_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV17). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875287_LHBs_P-D Product feature CHAIN KC875287_LHBs_P-D of FT:mat_peptide KC875287_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV18). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSTSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875288_LHBs_P-D Product feature CHAIN KC875288_LHBs_P-D of FT:mat_peptide KC875288_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV56). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875289_LHBs_P-D Product feature CHAIN KC875289_LHBs_P-D of FT:mat_peptide KC875289_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV55). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875290_LHBs_P-D Product feature CHAIN KC875290_LHBs_P-D of FT:mat_peptide KC875290_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV57). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSNLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875291_LHBs_P-D Product feature CHAIN KC875291_LHBs_P-D of FT:mat_peptide KC875291_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV58). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875292_LHBs_P-D Product feature CHAIN KC875292_LHBs_P-D of FT:mat_peptide KC875292_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV21). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875293_LHBs_P-D Product feature CHAIN KC875293_LHBs_P-D of FT:mat_peptide KC875293_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV69). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875294_LHBs_P-D Product feature CHAIN KC875294_LHBs_P-D of FT:mat_peptide KC875294_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV70). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875295_LHBs_P-D Product feature CHAIN KC875295_LHBs_P-D of FT:mat_peptide KC875295_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV81). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875296_LHBs_P-D Product feature CHAIN KC875296_LHBs_P-D of FT:mat_peptide KC875296_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV82). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875297_LHBs_P-D Product feature CHAIN KC875297_LHBs_P-D of FT:mat_peptide KC875297_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV84). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875298_LHBs_P-D Product feature CHAIN KC875298_LHBs_P-D of FT:mat_peptide KC875298_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV76). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=388 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYPAGGSSSGTVNPVPTTVSPISSIFSRIGDPA
LNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLR
RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAF
GKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875299_LHBs_P-D Product feature CHAIN KC875299_LHBs_P-D of FT:mat_peptide KC875299_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV85). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTLVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875300_LHBs_P-D Product feature CHAIN KC875300_LHBs_P-D of FT:mat_peptide KC875300_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV80). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875301_LHBs_P-D Product feature CHAIN KC875301_LHBs_P-D of FT:mat_peptide KC875301_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV89). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTPVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875302_LHBs_P-D Product feature CHAIN KC875302_LHBs_P-D of FT:mat_peptide KC875302_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV86). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCMTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875303_LHBs_P-D Product feature CHAIN KC875303_LHBs_P-D of FT:mat_peptide KC875303_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV92). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTVSPISSIFSRIGVP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCMTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875304_LHBs_P-D Product feature CHAIN KC875304_LHBs_P-D of FT:mat_peptide KC875304_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV91). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQTMQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPLVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875305_LHBs_P-D Product feature CHAIN KC875305_LHBs_P-D of FT:mat_peptide KC875305_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV41). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875306_LHBs_P-D Product feature CHAIN KC875306_LHBs_P-D of FT:mat_peptide KC875306_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV71). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875308_LHBs_P-D Product feature CHAIN KC875308_LHBs_P-D of FT:mat_peptide KC875308_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV72). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875309_LHBs_P-D Product feature CHAIN KC875309_LHBs_P-D of FT:mat_peptide KC875309_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV43). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875310_LHBs_P-D Product feature CHAIN KC875310_LHBs_P-D of FT:mat_peptide KC875310_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV9). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILKTLPAN
PPPASTNRQSGRQSTPLSPPLRNTHPQAMQWNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875311_LHBs_P-D Product feature CHAIN KC875311_LHBs_P-D of FT:mat_peptide KC875311_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV10). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCMTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875312_LHBs_P-D Product feature CHAIN KC875312_LHBs_P-D of FT:mat_peptide KC875312_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV22). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875313_LHBs_P-D Product feature CHAIN KC875313_LHBs_P-D of FT:mat_peptide KC875313_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV25). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWGPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMLWNSTTFHRTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875314_LHBs_P-D Product feature CHAIN KC875314_LHBs_P-D of FT:mat_peptide KC875314_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV2). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQGMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSCA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSRFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875315_LHBs_P-D Product feature CHAIN KC875315_LHBs_P-D of FT:mat_peptide KC875315_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV8). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRITHPQAMQWNSRTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875316_LHBs_P-D Product feature CHAIN KC875316_LHBs_P-D of FT:mat_peptide KC875316_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV16). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRYTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTANHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875317_LHBs_P-D Product feature CHAIN KC875317_LHBs_P-D of FT:mat_peptide KC875317_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV48). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875318_LHBs_P-D Product feature CHAIN KC875318_LHBs_P-D of FT:mat_peptide KC875318_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV40). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPEAMQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875319_LHBs_P-D Product feature CHAIN KC875319_LHBs_P-D of FT:mat_peptide KC875319_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV30). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875320_LHBs_P-D Product feature CHAIN KC875320_LHBs_P-D of FT:mat_peptide KC875320_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV31). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNSHPQAMQWNSTTFHQTLQDRRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875321_LHBs_P-D Product feature CHAIN KC875321_LHBs_P-D of FT:mat_peptide KC875321_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV19). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNNDTWPDANKVGAGPFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875322_LHBs_P-D Product feature CHAIN KC875322_LHBs_P-D of FT:mat_peptide KC875322_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV54). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875323_LHBs_P-D Product feature CHAIN KC875323_LHBs_P-D of FT:mat_peptide KC875323_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV53). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875324_LHBs_P-D Product feature CHAIN KC875324_LHBs_P-D of FT:mat_peptide KC875324_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV59). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHHTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVYLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875325_LHBs_P-D Product feature CHAIN KC875325_LHBs_P-D of FT:mat_peptide KC875325_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV60). Complete genome. [Hepadnaviridae] (length=389 residues).
MGENLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPLLRNTHPQAMQWNSTTLHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875326_LHBs_P-D Product feature CHAIN KC875326_LHBs_P-D of FT:mat_peptide KC875326_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV37). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLGPAFRANTANPDWDFNPNKDTWPDANKVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTDPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875328_LHBs_P-D Product feature CHAIN KC875328_LHBs_P-D of FT:mat_peptide KC875328_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV83). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLSPPLRNTHSQAMQWNSTTFHQTLQDSRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875329_LHBs_P-D Product feature CHAIN KC875329_LHBs_P-D of FT:mat_peptide KC875329_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV90). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875330_LHBs_P-D Product feature CHAIN KC875330_LHBs_P-D of FT:mat_peptide KC875330_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV87). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLSPPLRNTHPQGMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875331_LHBs_P-D Product feature CHAIN KC875331_LHBs_P-D of FT:mat_peptide KC875331_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV88). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTLPQPMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSICSRTGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875332_LHBs_P-D Product feature CHAIN KC875332_LHBs_P-D of FT:mat_peptide KC875332_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV42). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KC875333_LHBs_P-D Product feature CHAIN KC875333_LHBs_P-D of FT:mat_peptide KC875333_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV75). Complete genome. [Hepadnaviridae] (length=389 residues).
MGKNHSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLTPPLRNTHPHAMQWNSTTFHQTLQDPRVRGLYFPAGRSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875334_LHBs_P-D Product feature CHAIN KC875334_LHBs_P-D of FT:mat_peptide KC875334_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV47). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIPQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLRDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875335_LHBs_P-D Product feature CHAIN KC875335_LHBs_P-D of FT:mat_peptide KC875335_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV44). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTPPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875336_LHBs_P-D Product feature CHAIN KC875336_LHBs_P-D of FT:mat_peptide KC875336_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV45). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875337_LHBs_P-D Product feature CHAIN KC875337_LHBs_P-D of FT:mat_peptide KC875337_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV46). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875340_LHBs_P-D Product feature CHAIN KC875340_LHBs_P-D of FT:mat_peptide KC875340_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV34). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KC875342_LHBs_P-D Product feature CHAIN KC875342_LHBs_P-D of FT:mat_peptide KC875342_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV79). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQGLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF053178_LHBs_P-D Product feature CHAIN KF053178_LHBs_P-D of FT:mat_peptide KF053178_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MY62981). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRIGVP
AMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF061167_LHBs_P-D Product feature CHAIN KF061167_LHBs_P-D of FT:mat_peptide KF061167_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_1a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAH
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDRVPTTVSHISSIFSRIGDL
ALNMEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYXXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF061168_LHBs_P-D Product feature CHAIN KF061168_LHBs_P-D of FT:mat_peptide KF061168_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_3a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGXLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRXTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDRVPTTVSHISSIFSRIGDP
ALNMEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF061169_LHBs_P-D Product feature CHAIN KF061169_LHBs_P-D of FT:mat_peptide KF061169_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_7a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTXXPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAX
PPPASTXRQSGRQPTPLSPPLRXTHPQAMQWXXTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIGDL
ALNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYSXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF061170_LHBs_P-D Product feature CHAIN KF061170_LHBs_P-D of FT:mat_peptide KF061170_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_13a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAXRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSVFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170746_LHBs_P-D Product feature CHAIN KF170746_LHBs_P-D of FT:mat_peptide KF170746_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_010). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170747_LHBs_P-D Product feature CHAIN KF170747_LHBs_P-D of FT:mat_peptide KF170747_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_026). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170755_LHBs_P-D Product feature CHAIN KF170755_LHBs_P-D of FT:mat_peptide KF170755_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170756_LHBs_P-D Product feature CHAIN KF170756_LHBs_P-D of FT:mat_peptide KF170756_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_018). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDHRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170757_LHBs_P-D Product feature CHAIN KF170757_LHBs_P-D of FT:mat_peptide KF170757_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_020). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170758_LHBs_P-D Product feature CHAIN KF170758_LHBs_P-D of FT:mat_peptide KF170758_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_025). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170759_LHBs_P-D Product feature CHAIN KF170759_LHBs_P-D of FT:mat_peptide KF170759_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_036). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170760_LHBs_P-D Product feature CHAIN KF170760_LHBs_P-D of FT:mat_peptide KF170760_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_049). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSSLVPFVQWCVGLSPTVWLLVIWMMWYWGLSPYHILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170761_LHBs_P-D Product feature CHAIN KF170761_LHBs_P-D of FT:mat_peptide KF170761_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_050). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPPSTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASSISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWPLAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170763_LHBs_P-D Product feature CHAIN KF170763_LHBs_P-D of FT:mat_peptide KF170763_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_065). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170764_LHBs_P-D Product feature CHAIN KF170764_LHBs_P-D of FT:mat_peptide KF170764_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_071). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTISTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170765_LHBs_P-D Product feature CHAIN KF170765_LHBs_P-D of FT:mat_peptide KF170765_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_072). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNLQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170766_LHBs_P-D Product feature CHAIN KF170766_LHBs_P-D of FT:mat_peptide KF170766_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_080). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASANRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170767_LHBs_P-D Product feature CHAIN KF170767_LHBs_P-D of FT:mat_peptide KF170767_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_085). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDSWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170768_LHBs_P-D Product feature CHAIN KF170768_LHBs_P-D of FT:mat_peptide KF170768_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_090). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKVGAGAFGLGFTPPHGGLLGWSHQAQGILQTVPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAIQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSHISSAFSRIGAP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSSLGGTTACLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170770_LHBs_P-D Product feature CHAIN KF170770_LHBs_P-D of FT:mat_peptide KF170770_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_099). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIGDR
VPNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170771_LHBs_P-D Product feature CHAIN KF170771_LHBs_P-D of FT:mat_peptide KF170771_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_101). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYSLAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170772_LHBs_P-D Product feature CHAIN KF170772_LHBs_P-D of FT:mat_peptide KF170772_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_102). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170774_LHBs_P-D Product feature CHAIN KF170774_LHBs_P-D of FT:mat_peptide KF170774_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_107). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAHKVGAGAFGLGFTPPHGGLLGWSPQAQGITQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAIQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILNPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF170776_LHBs_P-D Product feature CHAIN KF170776_LHBs_P-D of FT:mat_peptide KF170776_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDAC_123). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTVSHISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF192830_LHBs_P-D Product feature CHAIN KF192830_LHBs_P-D of FT:mat_peptide KF192830_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP71). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF192831_LHBs_P-D Product feature CHAIN KF192831_LHBs_P-D of FT:mat_peptide KF192831_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP59). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF192832_LHBs_P-D Product feature CHAIN KF192832_LHBs_P-D of FT:mat_peptide KF192832_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP67). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF192834_LHBs_P-D Product feature CHAIN KF192834_LHBs_P-D of FT:mat_peptide KF192834_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP63). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCKTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471640_LHBs_P-D Product feature CHAIN KF471640_LHBs_P-D of FT:mat_peptide KF471640_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-86). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVKDLYFPAGGSSSGTVNPVPTTVSPISSILSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471641_LHBs_P-D Product feature CHAIN KF471641_LHBs_P-D of FT:mat_peptide KF471641_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-66). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQNLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KF471642_LHBs_P-D Product feature CHAIN KF471642_LHBs_P-D of FT:mat_peptide KF471642_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-65). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPILSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KF471644_LHBs_P-D Product feature CHAIN KF471644_LHBs_P-D of FT:mat_peptide KF471644_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-52). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFSLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVTWMMWCWGPNLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471646_LHBs_P-D Product feature CHAIN KF471646_LHBs_P-D of FT:mat_peptide KF471646_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-37). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471647_LHBs_P-D Product feature CHAIN KF471647_LHBs_P-D of FT:mat_peptide KF471647_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-35). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471649_LHBs_P-D Product feature CHAIN KF471649_LHBs_P-D of FT:mat_peptide KF471649_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-31). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471650_LHBs_P-D Product feature CHAIN KF471650_LHBs_P-D of FT:mat_peptide KF471650_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-25). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471651_LHBs_P-D Product feature CHAIN KF471651_LHBs_P-D of FT:mat_peptide KF471651_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471652_LHBs_P-D Product feature CHAIN KF471652_LHBs_P-D of FT:mat_peptide KF471652_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-20). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471654_LHBs_P-D Product feature CHAIN KF471654_LHBs_P-D of FT:mat_peptide KF471654_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-14). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIGVL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471655_LHBs_P-D Product feature CHAIN KF471655_LHBs_P-D of FT:mat_peptide KF471655_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-11). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPYLPLFPIFFCLWVYI
>gnl|hbvpro|KF471656_LHBs_P-D Product feature CHAIN KF471656_LHBs_P-D of FT:mat_peptide KF471656_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-8). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGPVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLREWASARFSWYSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471657_LHBs_P-D Product feature CHAIN KF471657_LHBs_P-D of FT:mat_peptide KF471657_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-7). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPYCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471658_LHBs_P-D Product feature CHAIN KF471658_LHBs_P-D of FT:mat_peptide KF471658_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG_4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF471659_LHBs_P-D Product feature CHAIN KF471659_LHBs_P-D of FT:mat_peptide KF471659_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-3). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTVSHTSSIFSRIGVP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFILLLPIFFCLWVYI
>gnl|hbvpro|KF471660_LHBs_P-D Product feature CHAIN KF471660_LHBs_P-D of FT:mat_peptide KF471660_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF476028_LHBs_P-D Product feature CHAIN KF476028_LHBs_P-D of FT:mat_peptide KF476028_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 421.15). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNEDTWPDANKVGAGAFGPGFTPPRGGLLGWSPQAQGILHTVPAK
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF476029_LHBs_P-D Product feature CHAIN KF476029_LHBs_P-D of FT:mat_peptide KF476029_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-209.3-C). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDADKVGAGAFGPGFTPPHGGLLGWSPQAQGILHTVPAK
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVHI
>gnl|hbvpro|KF476030_LHBs_P-D Product feature CHAIN KF476030_LHBs_P-D of FT:mat_peptide KF476030_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1201.4-O). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTASPLSSIFSRIGDP
ARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDSQGMLRVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQSFVGLSPTVWLSVIWMMWYWGPNLYSTLSPFLPLLPILLCLRVYI
>gnl|hbvpro|KF584160_LHBs_P-D Product feature CHAIN KF584160_LHBs_P-D of FT:mat_peptide KF584160_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M3). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTXNXDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTXPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTGCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF584161_LHBs_P-D Product feature CHAIN KF584161_LHBs_P-D of FT:mat_peptide KF584161_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF584162_LHBs_P-D Product feature CHAIN KF584162_LHBs_P-D of FT:mat_peptide KF584162_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1b). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSXISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF584163_LHBs_P-D Product feature CHAIN KF584163_LHBs_P-D of FT:mat_peptide KF584163_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2a). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGILXTLPEN
PXPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF584164_LHBs_P-D Product feature CHAIN KF584164_LHBs_P-D of FT:mat_peptide KF584164_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2b). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGILXTLPEN
PXPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF584165_LHBs_P-D Product feature CHAIN KF584165_LHBs_P-D of FT:mat_peptide KF584165_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Da). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGILQTXPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF584166_LHBs_P-D Product feature CHAIN KF584166_LHBs_P-D of FT:mat_peptide KF584166_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Db). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGILQTXPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF679989_LHBs_P-D Product feature CHAIN KF679989_LHBs_P-D of FT:mat_peptide KF679989_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-49). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
TPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF679990_LHBs_P-D Product feature CHAIN KF679990_LHBs_P-D of FT:mat_peptide KF679990_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-57). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRTGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWAPNLHNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|KF679992_LHBs_P-D Product feature CHAIN KF679992_LHBs_P-D of FT:mat_peptide KF679992_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-75). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTAYHLSSIFSRIGDP
ALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF679993_LHBs_P-D Product feature CHAIN KF679993_LHBs_P-D of FT:mat_peptide KF679993_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-76). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTAYHLSSIFSRIGDP
ALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF679994_LHBs_P-D Product feature CHAIN KF679994_LHBs_P-D of FT:mat_peptide KF679994_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-10). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLDLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF679995_LHBs_P-D Product feature CHAIN KF679995_LHBs_P-D of FT:mat_peptide KF679995_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-37). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF679996_LHBs_P-D Product feature CHAIN KF679996_LHBs_P-D of FT:mat_peptide KF679996_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-51). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF679997_LHBs_P-D Product feature CHAIN KF679997_LHBs_P-D of FT:mat_peptide KF679997_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-56). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KF679998_LHBs_P-D Product feature CHAIN KF679998_LHBs_P-D of FT:mat_peptide KF679998_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-63). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLQTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779209_LHBs_P-D Product feature CHAIN KF779209_LHBs_P-D of FT:mat_peptide KF779209_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5536). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779212_LHBs_P-D Product feature CHAIN KF779212_LHBs_P-D of FT:mat_peptide KF779212_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5739). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779214_LHBs_P-D Product feature CHAIN KF779214_LHBs_P-D of FT:mat_peptide KF779214_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5754). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779216_LHBs_P-D Product feature CHAIN KF779216_LHBs_P-D of FT:mat_peptide KF779216_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5770). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779217_LHBs_P-D Product feature CHAIN KF779217_LHBs_P-D of FT:mat_peptide KF779217_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPPVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLCVYI
>gnl|hbvpro|KF779218_LHBs_P-D Product feature CHAIN KF779218_LHBs_P-D of FT:mat_peptide KF779218_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5876). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779219_LHBs_P-D Product feature CHAIN KF779219_LHBs_P-D of FT:mat_peptide KF779219_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5909). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQVDPAFRANMGNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVRVSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779220_LHBs_P-D Product feature CHAIN KF779220_LHBs_P-D of FT:mat_peptide KF779220_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5910). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779222_LHBs_P-D Product feature CHAIN KF779222_LHBs_P-D of FT:mat_peptide KF779222_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5978). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLQLLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVRVSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779224_LHBs_P-D Product feature CHAIN KF779224_LHBs_P-D of FT:mat_peptide KF779224_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6026). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779225_LHBs_P-D Product feature CHAIN KF779225_LHBs_P-D of FT:mat_peptide KF779225_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6036). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANMGNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPNIWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779228_LHBs_P-D Product feature CHAIN KF779228_LHBs_P-D of FT:mat_peptide KF779228_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6067). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=390 residues).
MGVQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPA
NPPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGD
PALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMC
LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSW
AFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779229_LHBs_P-D Product feature CHAIN KF779229_LHBs_P-D of FT:mat_peptide KF779229_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6077). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=390 residues).
MGVQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPA
NPPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGD
PALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMC
LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSW
AFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779230_LHBs_P-D Product feature CHAIN KF779230_LHBs_P-D of FT:mat_peptide KF779230_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6078). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=390 residues).
MGVQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPA
NPPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLLSSIFSRIGD
PALNMENITSGLLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMC
LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSW
AFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779285_LHBs_P-D Product feature CHAIN KF779285_LHBs_P-D of FT:mat_peptide KF779285_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0596). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779288_LHBs_P-D Product feature CHAIN KF779288_LHBs_P-D of FT:mat_peptide KF779288_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0643). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779289_LHBs_P-D Product feature CHAIN KF779289_LHBs_P-D of FT:mat_peptide KF779289_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRVNTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSEALGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLPPSVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779292_LHBs_P-D Product feature CHAIN KF779292_LHBs_P-D of FT:mat_peptide KF779292_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0767). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779296_LHBs_P-D Product feature CHAIN KF779296_LHBs_P-D of FT:mat_peptide KF779296_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0869). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAHGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779301_LHBs_P-D Product feature CHAIN KF779301_LHBs_P-D of FT:mat_peptide KF779301_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT1003). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHVGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779302_LHBs_P-D Product feature CHAIN KF779302_LHBs_P-D of FT:mat_peptide KF779302_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT1009). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779303_LHBs_P-D Product feature CHAIN KF779303_LHBs_P-D of FT:mat_peptide KF779303_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT1018). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHVGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779318_LHBs_P-D Product feature CHAIN KF779318_LHBs_P-D of FT:mat_peptide KF779318_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PNF4312). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLLPIVCLSVIWMMGYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779340_LHBs_P-D Product feature CHAIN KF779340_LHBs_P-D of FT:mat_peptide KF779340_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PNF4854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGXLQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779341_LHBs_P-D Product feature CHAIN KF779341_LHBs_P-D of FT:mat_peptide KF779341_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PNF4864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779376_LHBs_P-D Product feature CHAIN KF779376_LHBs_P-D of FT:mat_peptide KF779376_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6029). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779377_LHBs_P-D Product feature CHAIN KF779377_LHBs_P-D of FT:mat_peptide KF779377_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGXLQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF779382_LHBs_P-D Product feature CHAIN KF779382_LHBs_P-D of FT:mat_peptide KF779382_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6295). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=390 residues).
MGETDLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPA
NPPPASTNRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGD
PALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMC
LRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSW
AFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KF922432_LHBs_P-D Product feature CHAIN KF922432_LHBs_P-D of FT:mat_peptide KF922432_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate N011). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPLAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ470889_LHBs_P-D Product feature CHAIN KJ470889_LHBs_P-D of FT:mat_peptide KJ470889_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8034). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGIXXTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCTGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGXSXYPSCCCXKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ470893_LHBs_P-D Product feature CHAIN KJ470893_LHBs_P-D of FT:mat_peptide KJ470893_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8118). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGLGFSPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ470894_LHBs_P-D Product feature CHAIN KJ470894_LHBs_P-D of FT:mat_peptide KJ470894_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8066). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ470895_LHBs_P-D Product feature CHAIN KJ470895_LHBs_P-D of FT:mat_peptide KJ470895_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8120). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLXFPAGGSSSGTVNPVPTTVSHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ470896_LHBs_P-D Product feature CHAIN KJ470896_LHBs_P-D of FT:mat_peptide KJ470896_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8122). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPAN
PPPASTNRQSGRQPTPXSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FXKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KJ647350_LHBs_P-D Product feature CHAIN KJ647350_LHBs_P-D of FT:mat_peptide KJ647350_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV197). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ647352_LHBs_P-D Product feature CHAIN KJ647352_LHBs_P-D of FT:mat_peptide KJ647352_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV219). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDFQGMLPVCPLIPGSSTTSVGPCQTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FEKFLWXWASARFSWLSLLVPFVQWCVGLSPTVWLLFIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ647353_LHBs_P-D Product feature CHAIN KJ647353_LHBs_P-D of FT:mat_peptide KJ647353_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV230). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLIFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCQTCMTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ647355_LHBs_P-D Product feature CHAIN KJ647355_LHBs_P-D of FT:mat_peptide KJ647355_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV247). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYQPAGGSSSGTVNPVPTTASHLSSIFSRIGGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCQTCTTPAQGTSMYPSCCCTKPSBGNCTCIPIPSSWA
FXKFLWXWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KJ843187_LHBs_P-D Product feature CHAIN KJ843187_LHBs_P-D of FT:mat_peptide KJ843187_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ag26). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSATTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108591_LHBs_P-D Product feature CHAIN KM108591_LHBs_P-D of FT:mat_peptide KM108591_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH001overtD1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108592_LHBs_P-D Product feature CHAIN KM108592_LHBs_P-D of FT:mat_peptide KM108592_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH007OBID2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDASKVGAGAFGLGFTPPHGGLLGWTPQAQGMIQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSTIPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLLIFFCLWEYI
>gnl|hbvpro|KM108593_LHBs_P-D Product feature CHAIN KM108593_LHBs_P-D of FT:mat_peptide KM108593_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH025overtD2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108594_LHBs_P-D Product feature CHAIN KM108594_LHBs_P-D of FT:mat_peptide KM108594_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH042OBID1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVRWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KM108595_LHBs_P-D Product feature CHAIN KM108595_LHBs_P-D of FT:mat_peptide KM108595_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH049overtD1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWA
FGRFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLATFLCLWVYI
>gnl|hbvpro|KM108596_LHBs_P-D Product feature CHAIN KM108596_LHBs_P-D of FT:mat_peptide KM108596_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH050overtD1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPAANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPLASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLNLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLLLLPIFFCLWASI
>gnl|hbvpro|KM108597_LHBs_P-D Product feature CHAIN KM108597_LHBs_P-D of FT:mat_peptide KM108597_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH052overtD6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTASPISSILSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108598_LHBs_P-D Product feature CHAIN KM108598_LHBs_P-D of FT:mat_peptide KM108598_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH058OBID6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTIHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTASHISSILSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108599_LHBs_P-D Product feature CHAIN KM108599_LHBs_P-D of FT:mat_peptide KM108599_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH061OBID6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLSFPAGGSSSGTVNPVPTTASPISSILSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVGLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
YGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108600_LHBs_P-D Product feature CHAIN KM108600_LHBs_P-D of FT:mat_peptide KM108600_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH065overtD1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVKPVPTTVSHISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108602_LHBs_P-D Product feature CHAIN KM108602_LHBs_P-D of FT:mat_peptide KM108602_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH123overtD1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPSASTNRQXGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISTIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108603_LHBs_P-D Product feature CHAIN KM108603_LHBs_P-D of FT:mat_peptide KM108603_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH153overtD1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPSASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSKIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108604_LHBs_P-D Product feature CHAIN KM108604_LHBs_P-D of FT:mat_peptide KM108604_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH194overtD6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTASPISSILSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108605_LHBs_P-D Product feature CHAIN KM108605_LHBs_P-D of FT:mat_peptide KM108605_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH087OBID1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108606_LHBs_P-D Product feature CHAIN KM108606_LHBs_P-D of FT:mat_peptide KM108606_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH005OBID1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM108607_LHBs_P-D Product feature CHAIN KM108607_LHBs_P-D of FT:mat_peptide KM108607_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SDH022OBID1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM212957_LHBs_P-D Product feature CHAIN KM212957_LHBs_P-D of FT:mat_peptide KM212957_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM519455_LHBs_P-D Product feature CHAIN KM519455_LHBs_P-D of FT:mat_peptide KM519455_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_WT_SA). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524338_LHBs_P-D Product feature CHAIN KM524338_LHBs_P-D of FT:mat_peptide KM524338_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV136_EP-CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPQGGLLGWNPGAQGIIQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGVP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLILLLLLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTPVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524339_LHBs_P-D Product feature CHAIN KM524339_LHBs_P-D of FT:mat_peptide KM524339_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV064_EP-CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALSMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524340_LHBs_P-D Product feature CHAIN KM524340_LHBs_P-D of FT:mat_peptide KM524340_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV094_EP-CHB). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=388 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPGLRWTSKTFHQALQDPRVRGLYLPAGGSTSGTVNPVPTTASPILSIFSKIGDPA
PNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLGQNSQSPTSNHSPTSCPPTCTGYRWMCLR
RFIIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAF
GKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524341_LHBs_P-D Product feature CHAIN KM524341_LHBs_P-D of FT:mat_peptide KM524341_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV128_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQDQGIIQTLPAN
PPPASTNSQSGRQPTPLSPPSRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524342_LHBs_P-D Product feature CHAIN KM524342_LHBs_P-D of FT:mat_peptide KM524342_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DR003_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524344_LHBs_P-D Product feature CHAIN KM524344_LHBs_P-D of FT:mat_peptide KM524344_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK070_EP-CHB). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCKTCTTPVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524345_LHBs_P-D Product feature CHAIN KM524345_LHBs_P-D of FT:mat_peptide KM524345_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK082_EP-CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTKNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524346_LHBs_P-D Product feature CHAIN KM524346_LHBs_P-D of FT:mat_peptide KM524346_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK096_EP-CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTRVGPCKTCTTTVQGTSMYPYCCCTKPSDGNCTCIPIPSSWA
FGKFLWVWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524347_LHBs_P-D Product feature CHAIN KM524347_LHBs_P-D of FT:mat_peptide KM524347_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK102_EP-CHB). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524349_LHBs_P-D Product feature CHAIN KM524349_LHBs_P-D of FT:mat_peptide KM524349_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-015_HIV-HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524350_LHBs_P-D Product feature CHAIN KM524350_LHBs_P-D of FT:mat_peptide KM524350_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-017_HIV-HBV). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQSMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524351_LHBs_P-D Product feature CHAIN KM524351_LHBs_P-D of FT:mat_peptide KM524351_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-020_HIV-HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGRSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTRVGPCKTCTTTVQGTSMYPYCCCTKPSDGNCTCIPIPSSWA
FGKFLWVWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524352_LHBs_P-D Product feature CHAIN KM524352_LHBs_P-D of FT:mat_peptide KM524352_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-025_HIV-HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524353_LHBs_P-D Product feature CHAIN KM524353_LHBs_P-D of FT:mat_peptide KM524353_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-031_HIV-HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524354_LHBs_P-D Product feature CHAIN KM524354_LHBs_P-D of FT:mat_peptide KM524354_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-058_HIV-HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTN
PPPASTNRQSGRQPTPLSPPLRKTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524355_LHBs_P-D Product feature CHAIN KM524355_LHBs_P-D of FT:mat_peptide KM524355_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-092_HIV-HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524356_LHBs_P-D Product feature CHAIN KM524356_LHBs_P-D of FT:mat_peptide KM524356_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-123_HIV-HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTFMFPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524358_LHBs_P-D Product feature CHAIN KM524358_LHBs_P-D of FT:mat_peptide KM524358_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV.I-057_HIV-HBV). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGVIPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM524361_LHBs_P-D Product feature CHAIN KM524361_LHBs_P-D of FT:mat_peptide KM524361_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV.I-112_HIV-HBV). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM577668_LHBs_P-D Product feature CHAIN KM577668_LHBs_P-D of FT:mat_peptide KM577668_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASSISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM577669_LHBs_P-D Product feature CHAIN KM577669_LHBs_P-D of FT:mat_peptide KM577669_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-7). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRLMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM577670_LHBs_P-D Product feature CHAIN KM577670_LHBs_P-D of FT:mat_peptide KM577670_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=385 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFTPPHGGLLGWSPQAQDILQTLPANPPPA
STNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVTPVPTTASPISSIFSRIGDPALNM
ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFI
IFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKF
LWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM577671_LHBs_P-D Product feature CHAIN KM577671_LHBs_P-D of FT:mat_peptide KM577671_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NIR-9). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWCVGLSPTVWLLVTWMMWYWGPSLSRTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM606744_LHBs_P-D Product feature CHAIN KM606744_LHBs_P-D of FT:mat_peptide KM606744_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba9). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM606745_LHBs_P-D Product feature CHAIN KM606745_LHBs_P-D of FT:mat_peptide KM606745_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM606752_LHBs_P-D Product feature CHAIN KM606752_LHBs_P-D of FT:mat_peptide KM606752_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba100). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALSMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM606753_LHBs_P-D Product feature CHAIN KM606753_LHBs_P-D of FT:mat_peptide KM606753_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba109). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM606754_LHBs_P-D Product feature CHAIN KM606754_LHBs_P-D of FT:mat_peptide KM606754_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba120). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTACHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KM606755_LHBs_P-D Product feature CHAIN KM606755_LHBs_P-D of FT:mat_peptide KM606755_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba139). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPHAMQWNSTTFPQTLQDPRVRGLYVPAGGSSSGTVNPVPTTASHISSIFSRTGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP090177_LHBs_P-D Product feature CHAIN KP090177_LHBs_P-D of FT:mat_peptide KP090177_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPITASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP090178_LHBs_P-D Product feature CHAIN KP090178_LHBs_P-D of FT:mat_peptide KP090178_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPITASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP090179_LHBs_P-D Product feature CHAIN KP090179_LHBs_P-D of FT:mat_peptide KP090179_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR6). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNPQSGRQPTPLSPPLRNTHPQDMGRNSTTFHQTLQDPRVRGLYFRVGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWVSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP090180_LHBs_P-D Product feature CHAIN KP090180_LHBs_P-D of FT:mat_peptide KP090180_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR14). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTK
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP090181_LHBs_P-D Product feature CHAIN KP090181_LHBs_P-D of FT:mat_peptide KP090181_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR40). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTSRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP143742_LHBs_P-D Product feature CHAIN KP143742_LHBs_P-D of FT:mat_peptide KP143742_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP143743_LHBs_P-D Product feature CHAIN KP143743_LHBs_P-D of FT:mat_peptide KP143743_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_48). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP143744_LHBs_P-D Product feature CHAIN KP143744_LHBs_P-D of FT:mat_peptide KP143744_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_67). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP143745_LHBs_P-D Product feature CHAIN KP143745_LHBs_P-D of FT:mat_peptide KP143745_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_176). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP165597_LHBs_P-D Product feature CHAIN KP165597_LHBs_P-D of FT:mat_peptide KP165597_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_195). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCIPIPSSWA
FGKFLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP165598_LHBs_P-D Product feature CHAIN KP165598_LHBs_P-D of FT:mat_peptide KP165598_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_244). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP165599_LHBs_P-D Product feature CHAIN KP165599_LHBs_P-D of FT:mat_peptide KP165599_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_255). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|KP165600_LHBs_P-D Product feature CHAIN KP165600_LHBs_P-D of FT:mat_peptide KP165600_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_263). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP165601_LHBs_P-D Product feature CHAIN KP165601_LHBs_P-D of FT:mat_peptide KP165601_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_265). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP165602_LHBs_P-D Product feature CHAIN KP165602_LHBs_P-D of FT:mat_peptide KP165602_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_270). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP165603_LHBs_P-D Product feature CHAIN KP165603_LHBs_P-D of FT:mat_peptide KP165603_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_294). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP165604_LHBs_P-D Product feature CHAIN KP165604_LHBs_P-D of FT:mat_peptide KP165604_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_344). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP165605_LHBs_P-D Product feature CHAIN KP165605_LHBs_P-D of FT:mat_peptide KP165605_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_398). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP168419_LHBs_P-D Product feature CHAIN KP168419_LHBs_P-D of FT:mat_peptide KP168419_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KN109). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAIQWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP184495_LHBs_P-D Product feature CHAIN KP184495_LHBs_P-D of FT:mat_peptide KP184495_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_405). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP184496_LHBs_P-D Product feature CHAIN KP184496_LHBs_P-D of FT:mat_peptide KP184496_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_408). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP184497_LHBs_P-D Product feature CHAIN KP184497_LHBs_P-D of FT:mat_peptide KP184497_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_477). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP184498_LHBs_P-D Product feature CHAIN KP184498_LHBs_P-D of FT:mat_peptide KP184498_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_495). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP184499_LHBs_P-D Product feature CHAIN KP184499_LHBs_P-D of FT:mat_peptide KP184499_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_541). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202936_LHBs_P-D Product feature CHAIN KP202936_LHBs_P-D of FT:mat_peptide KP202936_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASANRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202937_LHBs_P-D Product feature CHAIN KP202937_LHBs_P-D of FT:mat_peptide KP202937_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_546). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202938_LHBs_P-D Product feature CHAIN KP202938_LHBs_P-D of FT:mat_peptide KP202938_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_558). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202939_LHBs_P-D Product feature CHAIN KP202939_LHBs_P-D of FT:mat_peptide KP202939_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_562). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202940_LHBs_P-D Product feature CHAIN KP202940_LHBs_P-D of FT:mat_peptide KP202940_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_564). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202941_LHBs_P-D Product feature CHAIN KP202941_LHBs_P-D of FT:mat_peptide KP202941_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_783). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202942_LHBs_P-D Product feature CHAIN KP202942_LHBs_P-D of FT:mat_peptide KP202942_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_744). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202943_LHBs_P-D Product feature CHAIN KP202943_LHBs_P-D of FT:mat_peptide KP202943_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_785). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202944_LHBs_P-D Product feature CHAIN KP202944_LHBs_P-D of FT:mat_peptide KP202944_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_769). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP202945_LHBs_P-D Product feature CHAIN KP202945_LHBs_P-D of FT:mat_peptide KP202945_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_775). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP230541_LHBs_P-D Product feature CHAIN KP230541_LHBs_P-D of FT:mat_peptide KP230541_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia_758). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTIVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP322599_LHBs_P-D Product feature CHAIN KP322599_LHBs_P-D of FT:mat_peptide KP322599_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2811). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP322600_LHBs_P-D Product feature CHAIN KP322600_LHBs_P-D of FT:mat_peptide KP322600_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2812). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP322601_LHBs_P-D Product feature CHAIN KP322601_LHBs_P-D of FT:mat_peptide KP322601_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2813). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KP995100_LHBs_P-D Product feature CHAIN KP995100_LHBs_P-D of FT:mat_peptide KP995100_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 49-Cirrhosis). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHTSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTFMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KR139747_LHBs_P-D Product feature CHAIN KR139747_LHBs_P-D of FT:mat_peptide KR139747_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA20). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KR139748_LHBs_P-D Product feature CHAIN KR139748_LHBs_P-D of FT:mat_peptide KR139748_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA61). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KR905423_LHBs_P-D Product feature CHAIN KR905423_LHBs_P-D of FT:mat_peptide KR905423_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-36). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KR905424_LHBs_P-D Product feature CHAIN KR905424_LHBs_P-D of FT:mat_peptide KR905424_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-42). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT151620_LHBs_P-D Product feature CHAIN KT151620_LHBs_P-D of FT:mat_peptide KT151620_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSXQAQGIIQTLPAN
PPPASTNRQXGRQPTPLSPPLRNTHPQAMQWXXTTFHQTLQDPRVRGLSFPAGGSSSGAVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT347090_LHBs_P-D Product feature CHAIN KT347090_LHBs_P-D of FT:mat_peptide KT347090_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGMTMG). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILHTVPAK
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366465_LHBs_P-D Product feature CHAIN KT366465_LHBs_P-D of FT:mat_peptide KT366465_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.49). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQSQGIIQTSPAN
PPPASTNRQSGRHPTPLSPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPRSSTTSVGPCKTCMTTVQGTSMYPYCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366491_LHBs_P-D Product feature CHAIN KT366491_LHBs_P-D of FT:mat_peptide KT366491_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.38). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYTSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366494_LHBs_P-D Product feature CHAIN KT366494_LHBs_P-D of FT:mat_peptide KT366494_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.42). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLHVCPLIPGSSTTSEEPCRTCTTTVQGISLQPSCCCTKRSEGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366495_LHBs_P-D Product feature CHAIN KT366495_LHBs_P-D of FT:mat_peptide KT366495_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.45). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366496_LHBs_P-D Product feature CHAIN KT366496_LHBs_P-D of FT:mat_peptide KT366496_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.46). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366497_LHBs_P-D Product feature CHAIN KT366497_LHBs_P-D of FT:mat_peptide KT366497_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.48). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTAYHLSSIFSRIGDP
ALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366498_LHBs_P-D Product feature CHAIN KT366498_LHBs_P-D of FT:mat_peptide KT366498_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.7). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366499_LHBs_P-D Product feature CHAIN KT366499_LHBs_P-D of FT:mat_peptide KT366499_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.11). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDANCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366500_LHBs_P-D Product feature CHAIN KT366500_LHBs_P-D of FT:mat_peptide KT366500_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.18). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366501_LHBs_P-D Product feature CHAIN KT366501_LHBs_P-D of FT:mat_peptide KT366501_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.23). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366502_LHBs_P-D Product feature CHAIN KT366502_LHBs_P-D of FT:mat_peptide KT366502_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.27). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366506_LHBs_P-D Product feature CHAIN KT366506_LHBs_P-D of FT:mat_peptide KT366506_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.18). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366507_LHBs_P-D Product feature CHAIN KT366507_LHBs_P-D of FT:mat_peptide KT366507_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.24). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTAYHLSSIFSRIGDP
ALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366508_LHBs_P-D Product feature CHAIN KT366508_LHBs_P-D of FT:mat_peptide KT366508_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.25). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQNLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366509_LHBs_P-D Product feature CHAIN KT366509_LHBs_P-D of FT:mat_peptide KT366509_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.26). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366510_LHBs_P-D Product feature CHAIN KT366510_LHBs_P-D of FT:mat_peptide KT366510_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.36). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLQCLIFLLVLLDDHGVLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT366511_LHBs_P-D Product feature CHAIN KT366511_LHBs_P-D of FT:mat_peptide KT366511_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.37). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTPVQGTSIYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPPVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT749821_LHBs_P-D Product feature CHAIN KT749821_LHBs_P-D of FT:mat_peptide KT749821_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL20). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFARIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KT749827_LHBs_P-D Product feature CHAIN KT749827_LHBs_P-D of FT:mat_peptide KT749827_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL14). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGITQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTANPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT749828_LHBs_P-D Product feature CHAIN KT749828_LHBs_P-D of FT:mat_peptide KT749828_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL13). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWGSARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KT962021_LHBs_P-D Product feature CHAIN KT962021_LHBs_P-D of FT:mat_peptide KT962021_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia 569). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT962022_LHBs_P-D Product feature CHAIN KT962022_LHBs_P-D of FT:mat_peptide KT962022_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia 581). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT962023_LHBs_P-D Product feature CHAIN KT962023_LHBs_P-D of FT:mat_peptide KT962023_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia 584). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT962024_LHBs_P-D Product feature CHAIN KT962024_LHBs_P-D of FT:mat_peptide KT962024_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia 591). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT962025_LHBs_P-D Product feature CHAIN KT962025_LHBs_P-D of FT:mat_peptide KT962025_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Yakutia 767). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTIVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KT963508_LHBs_P-D Product feature CHAIN KT963508_LHBs_P-D of FT:mat_peptide KT963508_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668433_LHBs_P-D Product feature CHAIN KU668433_LHBs_P-D of FT:mat_peptide KU668433_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV071). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668434_LHBs_P-D Product feature CHAIN KU668434_LHBs_P-D of FT:mat_peptide KU668434_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV072). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668435_LHBs_P-D Product feature CHAIN KU668435_LHBs_P-D of FT:mat_peptide KU668435_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV102). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668436_LHBs_P-D Product feature CHAIN KU668436_LHBs_P-D of FT:mat_peptide KU668436_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV103). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDLRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668437_LHBs_P-D Product feature CHAIN KU668437_LHBs_P-D of FT:mat_peptide KU668437_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV108). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668438_LHBs_P-D Product feature CHAIN KU668438_LHBs_P-D of FT:mat_peptide KU668438_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV111). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668439_LHBs_P-D Product feature CHAIN KU668439_LHBs_P-D of FT:mat_peptide KU668439_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV124). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLLSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668441_LHBs_P-D Product feature CHAIN KU668441_LHBs_P-D of FT:mat_peptide KU668441_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV170). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668442_LHBs_P-D Product feature CHAIN KU668442_LHBs_P-D of FT:mat_peptide KU668442_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV175). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668444_LHBs_P-D Product feature CHAIN KU668444_LHBs_P-D of FT:mat_peptide KU668444_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV180). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTAYPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
AQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668445_LHBs_P-D Product feature CHAIN KU668445_LHBs_P-D of FT:mat_peptide KU668445_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV181). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668446_LHBs_P-D Product feature CHAIN KU668446_LHBs_P-D of FT:mat_peptide KU668446_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV183). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668447_LHBs_P-D Product feature CHAIN KU668447_LHBs_P-D of FT:mat_peptide KU668447_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV191). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668448_LHBs_P-D Product feature CHAIN KU668448_LHBs_P-D of FT:mat_peptide KU668448_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV192). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTACPDWDIDPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU668449_LHBs_P-D Product feature CHAIN KU668449_LHBs_P-D of FT:mat_peptide KU668449_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV207). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU736924_LHBs_P-D Product feature CHAIN KU736924_LHBs_P-D of FT:mat_peptide KU736924_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_14). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGXSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU736925_LHBs_P-D Product feature CHAIN KU736925_LHBs_P-D of FT:mat_peptide KU736925_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_15). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KU736926_LHBs_P-D Product feature CHAIN KU736926_LHBs_P-D of FT:mat_peptide KU736926_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_18). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGILQSLPTN
PPPASTNRQSGRQPTPLSPPLRBTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMXPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIXIPSSWA
FGKFLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KU736927_LHBs_P-D Product feature CHAIN KU736927_LHBs_P-D of FT:mat_peptide KU736927_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_20). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQSLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSSLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KX196208_LHBs_P-D Product feature CHAIN KX196208_LHBs_P-D of FT:mat_peptide KX196208_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL093). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSLFSRIGDP
ALNMENITSGFLGPLLVLPAGFFLLTRILTIPQRLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX196209_LHBs_P-D Product feature CHAIN KX196209_LHBs_P-D of FT:mat_peptide KX196209_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL094). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNVLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSNLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX196210_LHBs_P-D Product feature CHAIN KX196210_LHBs_P-D of FT:mat_peptide KX196210_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL095). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196211_LHBs_P-D Product feature CHAIN KX196211_LHBs_P-D of FT:mat_peptide KX196211_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL096). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX196212_LHBs_P-D Product feature CHAIN KX196212_LHBs_P-D of FT:mat_peptide KX196212_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL097). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSNLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX196213_LHBs_P-D Product feature CHAIN KX196213_LHBs_P-D of FT:mat_peptide KX196213_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL098). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLASWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196214_LHBs_P-D Product feature CHAIN KX196214_LHBs_P-D of FT:mat_peptide KX196214_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL099). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPRHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPAPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCAPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGFSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196215_LHBs_P-D Product feature CHAIN KX196215_LHBs_P-D of FT:mat_peptide KX196215_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0100). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLVGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQLNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNQSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196216_LHBs_P-D Product feature CHAIN KX196216_LHBs_P-D of FT:mat_peptide KX196216_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0101). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVPLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196217_LHBs_P-D Product feature CHAIN KX196217_LHBs_P-D of FT:mat_peptide KX196217_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0102). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNSHPQAMQWNSTTFHQTLQDRRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196218_LHBs_P-D Product feature CHAIN KX196218_LHBs_P-D of FT:mat_peptide KX196218_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0103). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTPPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196219_LHBs_P-D Product feature CHAIN KX196219_LHBs_P-D of FT:mat_peptide KX196219_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0104). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTVSPLSSIFSRIGDP
ALNMDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196220_LHBs_P-D Product feature CHAIN KX196220_LHBs_P-D of FT:mat_peptide KX196220_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0105). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196221_LHBs_P-D Product feature CHAIN KX196221_LHBs_P-D of FT:mat_peptide KX196221_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0106). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIPQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLRDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196222_LHBs_P-D Product feature CHAIN KX196222_LHBs_P-D of FT:mat_peptide KX196222_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0107). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNDSATSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196224_LHBs_P-D Product feature CHAIN KX196224_LHBs_P-D of FT:mat_peptide KX196224_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0109). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGLCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX196225_LHBs_P-D Product feature CHAIN KX196225_LHBs_P-D of FT:mat_peptide KX196225_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0110). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILNPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX196226_LHBs_P-D Product feature CHAIN KX196226_LHBs_P-D of FT:mat_peptide KX196226_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0111). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPNCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196227_LHBs_P-D Product feature CHAIN KX196227_LHBs_P-D of FT:mat_peptide KX196227_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0112). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIWGP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTALNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196228_LHBs_P-D Product feature CHAIN KX196228_LHBs_P-D of FT:mat_peptide KX196228_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0113). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAD
PPPASTNRQSGRQPTPLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVTPISSIFSRIGDP
ALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX196229_LHBs_P-D Product feature CHAIN KX196229_LHBs_P-D of FT:mat_peptide KX196229_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0114). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQGLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGRLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196230_LHBs_P-D Product feature CHAIN KX196230_LHBs_P-D of FT:mat_peptide KX196230_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0115). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTPPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196231_LHBs_P-D Product feature CHAIN KX196231_LHBs_P-D of FT:mat_peptide KX196231_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0116). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196232_LHBs_P-D Product feature CHAIN KX196232_LHBs_P-D of FT:mat_peptide KX196232_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0117). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196233_LHBs_P-D Product feature CHAIN KX196233_LHBs_P-D of FT:mat_peptide KX196233_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0118). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIPQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLRDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITAGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196234_LHBs_P-D Product feature CHAIN KX196234_LHBs_P-D of FT:mat_peptide KX196234_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0119). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX196236_LHBs_P-D Product feature CHAIN KX196236_LHBs_P-D of FT:mat_peptide KX196236_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0121). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|KX276856_LHBs_P-D Product feature CHAIN KX276856_LHBs_P-D of FT:mat_peptide KX276856_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFXLLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXXTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX276857_LHBs_P-D Product feature CHAIN KX276857_LHBs_P-D of FT:mat_peptide KX276857_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGMLHTVPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRIGVP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYXILSPFLXLLPIFFCLWVYI
>gnl|hbvpro|KX276975_LHBs_P-D Product feature CHAIN KX276975_LHBs_P-D of FT:mat_peptide KX276975_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 20). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPANGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX276998_LHBs_P-D Product feature CHAIN KX276998_LHBs_P-D of FT:mat_peptide KX276998_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 58). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPVSTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|KX276999_LHBs_P-D Product feature CHAIN KX276999_LHBs_P-D of FT:mat_peptide KX276999_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 59). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX357622_LHBs_P-D Product feature CHAIN KX357622_LHBs_P-D of FT:mat_peptide KX357622_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GD104ETH). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTHPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX357637_LHBs_P-D Product feature CHAIN KX357637_LHBs_P-D of FT:mat_peptide KX357637_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK20ETH). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQAGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDL
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX357638_LHBs_P-D Product feature CHAIN KX357638_LHBs_P-D of FT:mat_peptide KX357638_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AA95ETH). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQAGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX357639_LHBs_P-D Product feature CHAIN KX357639_LHBs_P-D of FT:mat_peptide KX357639_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GD82ETH). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGKIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|KX827290_LHBs_P-D Product feature CHAIN KX827290_LHBs_P-D of FT:mat_peptide KX827290_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno1.2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX827291_LHBs_P-D Product feature CHAIN KX827291_LHBs_P-D of FT:mat_peptide KX827291_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno2.2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX827292_LHBs_P-D Product feature CHAIN KX827292_LHBs_P-D of FT:mat_peptide KX827292_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno3.1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX827300_LHBs_P-D Product feature CHAIN KX827300_LHBs_P-D of FT:mat_peptide KX827300_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno21.2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KX827301_LHBs_P-D Product feature CHAIN KX827301_LHBs_P-D of FT:mat_peptide KX827301_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno30.4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KY382412_LHBs_P-D Product feature CHAIN KY382412_LHBs_P-D of FT:mat_peptide KY382412_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1_1896). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGILXTLPEN
PXPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KY382414_LHBs_P-D Product feature CHAIN KY382414_LHBs_P-D of FT:mat_peptide KY382414_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1_wt). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPEN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KY629630_LHBs_P-D Product feature CHAIN KY629630_LHBs_P-D of FT:mat_peptide KY629630_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TYM13097). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCXKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KY629633_LHBs_P-D Product feature CHAIN KY629633_LHBs_P-D of FT:mat_peptide KY629633_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KLMY14). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAY
PPPASTNRQSGRQPTPLXPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|KY629634_LHBs_P-D Product feature CHAIN KY629634_LHBs_P-D of FT:mat_peptide KY629634_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KLMY16). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|L27106_LHBs_P-D Product feature CHAIN L27106_LHBs_P-D of FT:mat_peptide L27106_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQSLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRDTHPQAMHWNYTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|LC365689_LHBs_P-D Product feature CHAIN LC365689_LHBs_P-D of FT:mat_peptide LC365689_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HB17-0791). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|LT992438_LHBs_P-D Product feature CHAIN LT992438_LHBs_P-D of FT:mat_peptide LT992438_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSSFLPLLXIFFCXWVYI
>gnl|hbvpro|LT992439_LHBs_P-D Product feature CHAIN LT992439_LHBs_P-D of FT:mat_peptide LT992439_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|LT992444_LHBs_P-D Product feature CHAIN LT992444_LHBs_P-D of FT:mat_peptide LT992444_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTKNPDWDFNPNKDPWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|LT992454_LHBs_P-D Product feature CHAIN LT992454_LHBs_P-D of FT:mat_peptide LT992454_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA222). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|M32138_LHBs_P-D Product feature CHAIN M32138_LHBs_P-D of FT:mat_peptide M32138_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-21). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPKLFTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF618339_LHBs_P-D Product feature CHAIN MF618339_LHBs_P-D of FT:mat_peptide MF618339_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV006). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF618340_LHBs_P-D Product feature CHAIN MF618340_LHBs_P-D of FT:mat_peptide MF618340_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV009). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF618341_LHBs_P-D Product feature CHAIN MF618341_LHBs_P-D of FT:mat_peptide MF618341_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV011). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF618342_LHBs_P-D Product feature CHAIN MF618342_LHBs_P-D of FT:mat_peptide MF618342_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV053). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPAATNRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIGDP
APNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF618343_LHBs_P-D Product feature CHAIN MF618343_LHBs_P-D of FT:mat_peptide MF618343_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV054). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGRFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF618348_LHBs_P-D Product feature CHAIN MF618348_LHBs_P-D of FT:mat_peptide MF618348_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV137). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF618349_LHBs_P-D Product feature CHAIN MF618349_LHBs_P-D of FT:mat_peptide MF618349_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV165). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTTRQSGMQPTPLPPPLRITLPQAMQWNSTAFHQVLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF925358_LHBs_P-D Product feature CHAIN MF925358_LHBs_P-D of FT:mat_peptide MF925358_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV01). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF925363_LHBs_P-D Product feature CHAIN MF925363_LHBs_P-D of FT:mat_peptide MF925363_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV07). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTNTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF925364_LHBs_P-D Product feature CHAIN MF925364_LHBs_P-D of FT:mat_peptide MF925364_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV08). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF925366_LHBs_P-D Product feature CHAIN MF925366_LHBs_P-D of FT:mat_peptide MF925366_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV10). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDCWPAANKVGVGSFGPGFTPPHGGLLGWSPQAQGILQTVPAA
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDP
APNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPGQNLQSPTSNHSPTSCPPICPGYRWMCL
RRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|MF925379_LHBs_P-D Product feature CHAIN MF925379_LHBs_P-D of FT:mat_peptide MF925379_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV23). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF925383_LHBs_P-D Product feature CHAIN MF925383_LHBs_P-D of FT:mat_peptide MF925383_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV27). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF925391_LHBs_P-D Product feature CHAIN MF925391_LHBs_P-D of FT:mat_peptide MF925391_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV35). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVSGLNFPAGGSSSGTVNPVPTTVSHISSILSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF925393_LHBs_P-D Product feature CHAIN MF925393_LHBs_P-D of FT:mat_peptide MF925393_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV38). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979154_LHBs_P-D Product feature CHAIN MF979154_LHBs_P-D of FT:mat_peptide MF979154_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTTRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979155_LHBs_P-D Product feature CHAIN MF979155_LHBs_P-D of FT:mat_peptide MF979155_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNFATFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPYILLLPIFFCIWVYI
>gnl|hbvpro|MF979156_LHBs_P-D Product feature CHAIN MF979156_LHBs_P-D of FT:mat_peptide MF979156_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGXSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCVWVYI
>gnl|hbvpro|MF979157_LHBs_P-D Product feature CHAIN MF979157_LHBs_P-D of FT:mat_peptide MF979157_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRRSGRXPTPLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDX
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWXVGLSPXVWLSVIWMMWYWGPRMYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979158_LHBs_P-D Product feature CHAIN MF979158_LHBs_P-D of FT:mat_peptide MF979158_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979160_LHBs_P-D Product feature CHAIN MF979160_LHBs_P-D of FT:mat_peptide MF979160_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979161_LHBs_P-D Product feature CHAIN MF979161_LHBs_P-D of FT:mat_peptide MF979161_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC15). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCVWVYI
>gnl|hbvpro|MF979162_LHBs_P-D Product feature CHAIN MF979162_LHBs_P-D of FT:mat_peptide MF979162_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC16). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSSQAQGILQTMPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979163_LHBs_P-D Product feature CHAIN MF979163_LHBs_P-D of FT:mat_peptide MF979163_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979164_LHBs_P-D Product feature CHAIN MF979164_LHBs_P-D of FT:mat_peptide MF979164_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC17). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979165_LHBs_P-D Product feature CHAIN MF979165_LHBs_P-D of FT:mat_peptide MF979165_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC18). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGXSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLTPPLRNTHPQALQWNYANFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTAWLSVIWMMWYWGPNLYSILSPYILLLPIFFCIWVYI
>gnl|hbvpro|MF979166_LHBs_P-D Product feature CHAIN MF979166_LHBs_P-D of FT:mat_peptide MF979166_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC19). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSATFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FAKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPYIPLLLIFFCIWVYI
>gnl|hbvpro|MF979167_LHBs_P-D Product feature CHAIN MF979167_LHBs_P-D of FT:mat_peptide MF979167_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC20). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPSSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTITGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979168_LHBs_P-D Product feature CHAIN MF979168_LHBs_P-D of FT:mat_peptide MF979168_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC21). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTTRRSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNLQSPTSNHSPTSCPPTCPGYRWMCL
RRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSAGNCTCIPIPSSWA
FGKFLWEWASGRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979170_LHBs_P-D Product feature CHAIN MF979170_LHBs_P-D of FT:mat_peptide MF979170_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC23). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MF979171_LHBs_P-D Product feature CHAIN MF979171_LHBs_P-D of FT:mat_peptide MF979171_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC24). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=387 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPMSPPLRDPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDPAL
NMENITSGLLGPLLVLQAGFFLLTRILTIPQSLXSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRR
FIIFLFILLLCLIFLLVLLDYQGMLHVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCWCTKPSDGNCTCIPIPSSWAFG
KFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCIWVYI
>gnl|hbvpro|MF979173_LHBs_P-D Product feature CHAIN MF979173_LHBs_P-D of FT:mat_peptide MF979173_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC33). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTVPAN
PPPASTTRRSRRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNLQSPTSNHSPTSCPPTCPGYRWMCL
RRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSAGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHSILSPYLPLLPIFFCLWVYI
>gnl|hbvpro|MF979174_LHBs_P-D Product feature CHAIN MF979174_LHBs_P-D of FT:mat_peptide MF979174_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC34). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSLTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPIAWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWXYI
>gnl|hbvpro|MF979175_LHBs_P-D Product feature CHAIN MF979175_LHBs_P-D of FT:mat_peptide MF979175_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC35). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTTRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCVWVYI
>gnl|hbvpro|MF979176_LHBs_P-D Product feature CHAIN MF979176_LHBs_P-D of FT:mat_peptide MF979176_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WC36). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSVTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCXWVYI
>gnl|hbvpro|MH932714_LHBs_P-D Product feature CHAIN MH932714_LHBs_P-D of FT:mat_peptide MH932714_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Hiroshima GtD CL2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYL
RRFIIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052947_LHBs_P-D Product feature CHAIN MK052947_LHBs_P-D of FT:mat_peptide MK052947_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-1). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLEWSPQAQGILQTLPTN
PPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFIGLSPTVWLSVIWMMWYWGPSLLSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052948_LHBs_P-D Product feature CHAIN MK052948_LHBs_P-D of FT:mat_peptide MK052948_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQARGILQTLPTN
PPPASASRRPVRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052949_LHBs_P-D Product feature CHAIN MK052949_LHBs_P-D of FT:mat_peptide MK052949_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-3). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPRAQGILQTLPTN
PPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFSLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQATSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPPVWLSVIWMMWYWGPSLLSTLSPFLPPLPIFFCLWVYI
>gnl|hbvpro|MK052950_LHBs_P-D Product feature CHAIN MK052950_LHBs_P-D of FT:mat_peptide MK052950_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTTRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFSLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLRPFLLLLPIFFCLWVYV
>gnl|hbvpro|MK052951_LHBs_P-D Product feature CHAIN MK052951_LHBs_P-D of FT:mat_peptide MK052951_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPTASTSRRPVRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLHFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLPPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052952_LHBs_P-D Product feature CHAIN MK052952_LHBs_P-D of FT:mat_peptide MK052952_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-6). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFLLLTRILTVPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCP
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIRMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052953_LHBs_P-D Product feature CHAIN MK052953_LHBs_P-D of FT:mat_peptide MK052953_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLRPFLLLLPIFFCLWVYI
>gnl|hbvpro|MK052954_LHBs_P-D Product feature CHAIN MK052954_LHBs_P-D of FT:mat_peptide MK052954_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPTASTSRRPVRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLLSTLRPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052955_LHBs_P-D Product feature CHAIN MK052955_LHBs_P-D of FT:mat_peptide MK052955_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-9). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTS
PPPASTSRRSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTRIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLLSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052956_LHBs_P-D Product feature CHAIN MK052956_LHBs_P-D of FT:mat_peptide MK052956_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-10). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTS
PPPASTSRRSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLLSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052958_LHBs_P-D Product feature CHAIN MK052958_LHBs_P-D of FT:mat_peptide MK052958_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-12). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTS
PPPASTSRRSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLLSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052959_LHBs_P-D Product feature CHAIN MK052959_LHBs_P-D of FT:mat_peptide MK052959_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-13). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTTRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFSLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLRPFLLLLPIFFCLWVYI
>gnl|hbvpro|MK052960_LHBs_P-D Product feature CHAIN MK052960_LHBs_P-D of FT:mat_peptide MK052960_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-14). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTS
PPPASTSRRSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLLSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052961_LHBs_P-D Product feature CHAIN MK052961_LHBs_P-D of FT:mat_peptide MK052961_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137-15). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTTRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNYSPTSCPPTCLGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052963_LHBs_P-D Product feature CHAIN MK052963_LHBs_P-D of FT:mat_peptide MK052963_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTSRRPGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052966_LHBs_P-D Product feature CHAIN MK052966_LHBs_P-D of FT:mat_peptide MK052966_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTGRRPGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052971_LHBs_P-D Product feature CHAIN MK052971_LHBs_P-D of FT:mat_peptide MK052971_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILETLPTN
PPPASTSRRPGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFTLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052972_LHBs_P-D Product feature CHAIN MK052972_LHBs_P-D of FT:mat_peptide MK052972_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-12). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDNWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPTN
PPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLSLLPIFFCLWVYI
>gnl|hbvpro|MK052973_LHBs_P-D Product feature CHAIN MK052973_LHBs_P-D of FT:mat_peptide MK052973_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-14). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTTRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|MK052974_LHBs_P-D Product feature CHAIN MK052974_LHBs_P-D of FT:mat_peptide MK052974_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTSRRSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLLLLPIFFCLWVYI
>gnl|hbvpro|MK052975_LHBs_P-D Product feature CHAIN MK052975_LHBs_P-D of FT:mat_peptide MK052975_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-17). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTN
PPPASTTRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|V01460_LHBs_P-D Product feature CHAIN V01460_LHBs_P-D of FT:mat_peptide V01460_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|X02496_LHBs_P-D Product feature CHAIN X02496_LHBs_P-D of FT:mat_peptide X02496_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILETLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|X65257_LHBs_P-D Product feature CHAIN X65257_LHBs_P-D of FT:mat_peptide X65257_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient C; HBsAg positiv;HBV subtype ayw). Non-functional genomic sequence. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|X65258_LHBs_P-D Product feature CHAIN X65258_LHBs_P-D of FT:mat_peptide X65258_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient CI; HBV subtype ayw). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPASRANTANPDWDFNPNKDTWPDANKDGAGAFGLGLTPPHGGLLGWSPQAQGILHTVPAN
PPPASTNRQTGRQPTPLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIGDP
VTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RGFIIFLFILLLCLIFLLVLLEYQGMLHVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKTSDGNCTCIPIPSSWA
FAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|X72702_LHBs_P-D Product feature CHAIN X72702_LHBs_P-D of FT:mat_peptide X72702_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient C1005). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|X80924_LHBs_P-D Product feature CHAIN X80924_LHBs_P-D of FT:mat_peptide X80924_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 4). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASTISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|X80926_LHBs_P-D Product feature CHAIN X80926_LHBs_P-D of FT:mat_peptide X80926_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 5). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASTISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|X97848_LHBs_P-D Product feature CHAIN X97848_LHBs_P-D of FT:mat_peptide X97848_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 2). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
VLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|X97849_LHBs_P-D Product feature CHAIN X97849_LHBs_P-D of FT:mat_peptide X97849_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 3). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|Y07587_LHBs_P-D Product feature CHAIN Y07587_LHBs_P-D of FT:mat_peptide Y07587_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|Z35716_LHBs_P-D Product feature CHAIN Z35716_LHBs_P-D of FT:mat_peptide Z35716_LHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate hb321). Complete genome. [Hepadnaviridae] (length=389 residues).
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDYNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAN
PPPASTNRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDP
ALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCL
RRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWA
FGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
© 1998-2019