HBVdb

Dataset for protein Pol of genotype D

[Download (right click)] [Alignment] [Repertoires]

1109 sequence(s)

>gnl|hbvpro|AB048701_Pol_P-D Product feature CHAIN AB048701_Pol_P-D of FT:mat_peptide AB048701_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFHTRHYLHTLWKAGILYKR
VSTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPSVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRTRVHPTA
RRPSGVEPSGSGHNANLASKSASCLYQSTVRTAAYPAVSTSENHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLCWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTLQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSWGSLPQDHIRHKIKECFRKLPVHRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLHLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB090268_Pol_P-D Product feature CHAIN AB090268_Pol_P-D of FT:mat_peptide AB090268_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTNNLASKSASCIYQSPVRKAVYPAVSTFERHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDPRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB090269_Pol_P-D Product feature CHAIN AB090269_Pol_P-D of FT:mat_peptide AB090269_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=836 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNENRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAEHGEESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGI
HPTARRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQ
FRNSKPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKF
AVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRISNHQRGTMQNLHDYCSRNLY
VSLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLF
TAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFT
QCGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHT
AELLAACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLRLPFR
PTTGRTSLYADSPSVPSHLPVRVHFALPLHVAWRPP
>gnl|hbvpro|AB090270_Pol_P-D Product feature CHAIN AB090270_Pol_P-D of FT:mat_peptide AB090270_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQRERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNTRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB104709_Pol_P-D Product feature CHAIN AB104709_Pol_P-D of FT:mat_peptide AB104709_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG64). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCFYQSPVRKAAYPSVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB104710_Pol_P-D Product feature CHAIN AB104710_Pol_P-D of FT:mat_peptide AB104710_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG105). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYQR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSGSIRAGIHPTA
RRPVGVEPSGSGHTTNPASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB104711_Pol_P-D Product feature CHAIN AB104711_Pol_P-D of FT:mat_peptide AB104711_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG104). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCFYQSPVRKAAYPSVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB104712_Pol_P-D Product feature CHAIN AB104712_Pol_P-D of FT:mat_peptide AB104712_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG75). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRSFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPAVSTFEKHTSSGHAVELHYLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCQQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB109475_Pol_P-D Product feature CHAIN AB109475_Pol_P-D of FT:mat_peptide AB109475_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSYGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB109476_Pol_P-D Product feature CHAIN AB109476_Pol_P-D of FT:mat_peptide AB109476_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB109477_Pol_P-D Product feature CHAIN AB109477_Pol_P-D of FT:mat_peptide AB109477_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB109478_Pol_P-D Product feature CHAIN AB109478_Pol_P-D of FT:mat_peptide AB109478_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNDNLASKSASCVYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB109479_Pol_P-D Product feature CHAIN AB109479_Pol_P-D of FT:mat_peptide AB109479_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGEHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFHHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB110075_Pol_P-D Product feature CHAIN AB110075_Pol_P-D of FT:mat_peptide AB110075_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB116266_Pol_P-D Product feature CHAIN AB116266_Pol_P-D of FT:mat_peptide AB116266_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSHQGHLARRQEGRSWSIRAGIHPTA
RRPFGDQPSGSGHNRNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGEEPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGKAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFRCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRRPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB119251_Pol_P-D Product feature CHAIN AB119251_Pol_P-D of FT:mat_peptide AB119251_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNLTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFERHASSSHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB119252_Pol_P-D Product feature CHAIN AB119252_Pol_P-D of FT:mat_peptide AB119252_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHTTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFERHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGEHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB119253_Pol_P-D Product feature CHAIN AB119253_Pol_P-D of FT:mat_peptide AB119253_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPYWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFERHASSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB119254_Pol_P-D Product feature CHAIN AB119254_Pol_P-D of FT:mat_peptide AB119254_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNLTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFWGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAADPTVTTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSGYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB119255_Pol_P-D Product feature CHAIN AB119255_Pol_P-D of FT:mat_peptide AB119255_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPSA
RRPFGVEPSGSGHDTNLASKSASCFYQSPVNQAAYPAVSTFERHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
QPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGEHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB119256_Pol_P-D Product feature CHAIN AB119256_Pol_P-D of FT:mat_peptide AB119256_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVKPSGSGHNTNHASISASCIYQSKVKKAAYPAVSTFERHSSPGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRETSFVYVPSALNPADDPSRGRLGLPRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB120308_Pol_P-D Product feature CHAIN AB120308_Pol_P-D of FT:mat_peptide AB120308_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHTTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFERHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDPRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB126581_Pol_P-D Product feature CHAIN AB126581_Pol_P-D of FT:mat_peptide AB126581_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU301). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RWPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLDDSWSRNLYVSLL
VLDQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKEWFRKLPVNRPIDCKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB188241_Pol_P-D Product feature CHAIN AB188241_Pol_P-D of FT:mat_peptide AB188241_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA25). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWETPFFP
KIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGLEPSGSGHNTILASKSASCIHQSPVRKATYPAVSTFEKHSSSGHAVEFNNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB188242_Pol_P-D Product feature CHAIN AB188242_Pol_P-D of FT:mat_peptide AB188242_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA38). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSVRAGIHPTA
RRPFGVEPSGSGHNDNLASKSASCIYQSQVRKAAYPAVSTFEKHSSSGHAVELHNFPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPTKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB188244_Pol_P-D Product feature CHAIN AB188244_Pol_P-D of FT:mat_peptide AB188244_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZ24). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNLTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELYNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVALM
LLYQTYGRKLHLYSHPIVLGFRKIPMGVGLSPFLXAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHRESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYIIGSYGTLPQDHIVQKIKHCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARHRPGLCQVFADATPTGWGLAMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205126_Pol_P-D Product feature CHAIN AB205126_Pol_P-D of FT:mat_peptide AB205126_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-IF714-1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGAFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205127_Pol_P-D Product feature CHAIN AB205127_Pol_P-D of FT:mat_peptide AB205127_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU313-2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
TIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTS
RRPFGVEPSGSGHNTNLASKSASCIDQSPVRKAAYPAVSTFEKHSSTGHAVELHNFPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVSLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB205128_Pol_P-D Product feature CHAIN AB205128_Pol_P-D of FT:mat_peptide AB205128_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU316-1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQGIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILPRPPVGSSLQSKHRTSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWFQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNLHNTAESRLVVDFSQFSRGKYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFLHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPPPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB210820_Pol_P-D Product feature CHAIN AB210820_Pol_P-D of FT:mat_peptide AB210820_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDESGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHASSGHAVELHNLPPNSARSQGERPVFPCWWLQFRKS
KPCSDYCLSNIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIFNHQRGTMQNLHDYCTRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCHGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB210821_Pol_P-D Product feature CHAIN AB210821_Pol_P-D of FT:mat_peptide AB210821_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGAFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB210822_Pol_P-D Product feature CHAIN AB210822_Pol_P-D of FT:mat_peptide AB210822_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGAFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB222709_Pol_P-D Product feature CHAIN AB222709_Pol_P-D of FT:mat_peptide AB222709_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV34). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHSTNLASKSASCFYQSPVKKAAYPSVSTFAKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSGIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB222710_Pol_P-D Product feature CHAIN AB222710_Pol_P-D of FT:mat_peptide AB222710_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6M). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=831 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYQR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHSTNLASKSASCFYQSPVKKAAYPSVSTFAKHSSSGTVELHNLPPNSARSQSERPVFPCWWLQFRNSK
PCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPNL
QSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDYCSRNLYVSLLL
LYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTN
FLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYP
ALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELLA
ACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGR
TSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB222711_Pol_P-D Product feature CHAIN AB222711_Pol_P-D of FT:mat_peptide AB222711_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNV24). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB222712_Pol_P-D Product feature CHAIN AB222712_Pol_P-D of FT:mat_peptide AB222712_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV61). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB222713_Pol_P-D Product feature CHAIN AB222713_Pol_P-D of FT:mat_peptide AB222713_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLPQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCNQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB246347_Pol_P-D Product feature CHAIN AB246347_Pol_P-D of FT:mat_peptide AB246347_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHHKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB246348_Pol_P-D Product feature CHAIN AB246348_Pol_P-D of FT:mat_peptide AB246348_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKYSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYISLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIMQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMTLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB267090_Pol_P-D Product feature CHAIN AB267090_Pol_P-D of FT:mat_peptide AB267090_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ehime 22-HS). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQPSGILSRPPVGSSLQSKLRKSRLGLQSQQGHLASRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB270539_Pol_P-D Product feature CHAIN AB270539_Pol_P-D of FT:mat_peptide AB270539_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL200F). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPAVSTFEKHASSGHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFMAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB270541_Pol_P-D Product feature CHAIN AB270541_Pol_P-D of FT:mat_peptide AB270541_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL47F). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVDIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFYGSSYPWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPIRKAADPSVSTFEKHSSSGHAVELHNFPPNSARSQSERPVSPCWWLQFRNS
KPCSDHCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKNXQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB270542_Pol_P-D Product feature CHAIN AB270542_Pol_P-D of FT:mat_peptide AB270542_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL12F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSVPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLXLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSDSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB270543_Pol_P-D Product feature CHAIN AB270543_Pol_P-D of FT:mat_peptide AB270543_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL209F). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB270546_Pol_P-D Product feature CHAIN AB270546_Pol_P-D of FT:mat_peptide AB270546_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL88F). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKYSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB270547_Pol_P-D Product feature CHAIN AB270547_Pol_P-D of FT:mat_peptide AB270547_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL295F). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGNMQNLHDPCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB270548_Pol_P-D Product feature CHAIN AB270548_Pol_P-D of FT:mat_peptide AB270548_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL207F). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDVIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSLRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDHCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB270550_Pol_P-D Product feature CHAIN AB270550_Pol_P-D of FT:mat_peptide AB270550_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL247F). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFERHSSSGHAVELHNLPTNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGXYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSTTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB330367_Pol_P-D Product feature CHAIN AB330367_Pol_P-D of FT:mat_peptide AB330367_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ14HBV). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSNVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETAHSASFCGSPYSWEQELQHGAESLHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVGEAAYSSVSAFESHSSSGHAVEFHDLPPNSARFQSKRPVFPCWWLQFRNS
KPCSDYCISHIVNLLEDWGPCAEHGEHHIRIPRTPTRVTGGVFLVDKNPNNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLPSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGHSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB330369_Pol_P-D Product feature CHAIN AB330369_Pol_P-D of FT:mat_peptide AB330369_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ5HBV). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSSVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB330370_Pol_P-D Product feature CHAIN AB330370_Pol_P-D of FT:mat_peptide AB330370_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ6HBV). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSSVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLVSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB471856_Pol_P-D Product feature CHAIN AB471856_Pol_P-D of FT:mat_peptide AB471856_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGAFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB471857_Pol_P-D Product feature CHAIN AB471857_Pol_P-D of FT:mat_peptide AB471857_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGAFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB493846_Pol_P-D Product feature CHAIN AB493846_Pol_P-D of FT:mat_peptide AB493846_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17UC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKYRKPRLGLQSQQGHLAGRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDHCLSLIVNLLEDWGPCAEHGEHYIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFMAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB555496_Pol_P-D Product feature CHAIN AB555496_Pol_P-D of FT:mat_peptide AB555496_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA31). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFWRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLYVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYFWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPAVSTFERNSSSGHAVELHKLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRGPANDTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB555497_Pol_P-D Product feature CHAIN AB555497_Pol_P-D of FT:mat_peptide AB555497_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA37). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFWRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPAVSTFERNSSSGHAVEIHELPANSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLLVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLNFMGYVIGCYGSLPQNHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB555500_Pol_P-D Product feature CHAIN AB555500_Pol_P-D of FT:mat_peptide AB555500_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA64). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDXEAGPLEEELPRLADEDLNRRVAEDLNLGTPNASIPWTHKVGNFTGLYSYNVPVFNPNWKTHSFP
NIHLHEDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKK
KTTRSASFWGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLAGRQQGRSRSIRAGIHPTS
RRPFGVEPSGSGHTTNLARKSASCLYQSPVRKAAYPAVSTFERHSSSSHAVELHELPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHNIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSAQHLESLFTAVT
NFLLSLGVHLNPDKTKRWGYCLNFMGYVIGSYGSLPQNHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB555501_Pol_P-D Product feature CHAIN AB555501_Pol_P-D of FT:mat_peptide AB555501_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA65). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPFSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSTSCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHKLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNNQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLMSLGIHINPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB583680_Pol_P-D Product feature CHAIN AB583680_Pol_P-D of FT:mat_peptide AB583680_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pkst7912). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFERHSSSGHEVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674405_Pol_P-D Product feature CHAIN AB674405_Pol_P-D of FT:mat_peptide AB674405_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraHCCA12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQWIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGIFSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARMSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYXIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674406_Pol_P-D Product feature CHAIN AB674406_Pol_P-D of FT:mat_peptide AB674406_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB23). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQMIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGQLARCQQGRSWSIRAGIHPTA
RRPFGVEPSGPGHTTNLASKSASCLYQSPVRKAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEDGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGSHRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIXLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674407_Pol_P-D Product feature CHAIN AB674407_Pol_P-D of FT:mat_peptide AB674407_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD35). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQNIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674408_Pol_P-D Product feature CHAIN AB674408_Pol_P-D of FT:mat_peptide AB674408_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD83). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSRHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVEQHNLPPNSARSQSERPVFPCWWLQFRNS
XPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674411_Pol_P-D Product feature CHAIN AB674411_Pol_P-D of FT:mat_peptide AB674411_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD84). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLVMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFYGSPYSWEQELQHGAESFHQQSSGIFSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNDQYGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLVFSYVDDVVLGAKSVQHLESLFTAVT
NFLLSVGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSQTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674415_Pol_P-D Product feature CHAIN AB674415_Pol_P-D of FT:mat_peptide AB674415_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC24). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=826 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVSIPXTHKVGNFTGLYSSTVPVFXPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLXTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTANLASKSASCLYQSPVRKAAHPSVSTFEKHPSSGHAVELHNLPPTSASSKLCWWLQFRNSKPCSDY
CLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPNLQSLTN
LLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYAARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLLLLYQTF
GRKLHLYSHPIIXGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVTNFLLSV
GIHLNPNKTKRWGXSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPL
YACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELLAACFAR
SRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLXRPLLRLPFRPTTGRTSLYA
DSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB674416_Pol_P-D Product feature CHAIN AB674416_Pol_P-D of FT:mat_peptide AB674416_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE19). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRVLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHRVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNXTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVREAAYPSHSTFERHSSSGYSVELHDLPPNSARSQSERPVFTCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIFNNQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCHGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB674419_Pol_P-D Product feature CHAIN AB674419_Pol_P-D of FT:mat_peptide AB674419_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC16). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLHHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQPQQGHLARRQQGRSWSIRAGIHPTA
RRPLGVEPSGSRHTTNLASKSASCLYQSTVRKAADPSVSTFEKHSSSGHTVEFHNLPPNSARSQSERPVFPCWWLQFRDS
KPCSDYCLSHIVNLLEDWGPCAEHGEHYIRIPRTPARVTGGVFLVDKNPHNAAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVS
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSKLNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674420_Pol_P-D Product feature CHAIN AB674420_Pol_P-D of FT:mat_peptide AB674420_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunLCD2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWRRHSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGLLARRQQGRSWSIRAGIHPTA
RRPVGVEPSGSRHNTNLASKSASGLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSEGPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQYGTMQNLHDSCSRHLYVSLM
LLYKTYGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHRESLYTAVT
NFLLSVGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674422_Pol_P-D Product feature CHAIN AB674422_Pol_P-D of FT:mat_peptide AB674422_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGXNRRVAEDLNLGNLNVSIPWXHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEXKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHITQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKLTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674423_Pol_P-D Product feature CHAIN AB674423_Pol_P-D of FT:mat_peptide AB674423_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD18). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRSVLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTHLASKSASCLYQSPVRTAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLIEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNNRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHINPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674424_Pol_P-D Product feature CHAIN AB674424_Pol_P-D of FT:mat_peptide AB674424_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE24). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQLFRRLLLLDPEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLVMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYRR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASGLYQSPDRKAAYPAVSTFERHPSSGHAVELHNLPPNSAKSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSTNSRIFNDQHGTMQNLHESCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNHHKTKRWGYSLHFMGYVIGSYGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKVFLYKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AB674425_Pol_P-D Product feature CHAIN AB674425_Pol_P-D of FT:mat_peptide AB674425_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE44). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGXNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWEAGILYKR
ETTHSASFCGSPYPWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSGLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTSEKHASSGRAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIINLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSYGSLPQDHIKHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLRKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674427_Pol_P-D Product feature CHAIN AB674427_Pol_P-D of FT:mat_peptide AB674427_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD54). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGXLYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASGLYQSPVRKAAYPAVSTFEKHSSSGHAVEXHNLSPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSASHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674428_Pol_P-D Product feature CHAIN AB674428_Pol_P-D of FT:mat_peptide AB674428_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB26). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPDVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQXRHYLHTLWKAGVLYQR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHTAA
RRPFGVEPSGSGHTTNLASKSTSCLHQSSVGKTAYSAVSTFERHSSSGHTVELHNFPPNFARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNDQHGTMQNLHESCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGALPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AB674431_Pol_P-D Product feature CHAIN AB674431_Pol_P-D of FT:mat_peptide AB674431_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC27). Complete genome. [Hepadnaviridae] (length=833 residues).
MPLSYHHFRRLVLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWRRRPSF
PNIHLHQDTINKCEQFVGPLTGNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYK
RETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPT
ARRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPAVSTFEKHTSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRN
SKPCSDYCLSHIVNLLEDWGPCAEHGEHHIKIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNXRVSWPKFAVP
NLQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSL
LLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAV
TNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
YPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAEL
LAACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTT
GRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF043594_Pol_P-D Product feature CHAIN AF043594_Pol_P-D of FT:mat_peptide AF043594_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1/91). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPYWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPDRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF121239_Pol_P-D Product feature CHAIN AF121239_Pol_P-D of FT:mat_peptide AF121239_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1303). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCFYQSPVRKAAYPSVSTFEKHPSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPSKTKRWGYSLHFMGYVIGCFGSLPQDHITQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF121240_Pol_C-D Product feature CHAIN AF121240_Pol_C-D of FT:mat_peptide AF121240_Pol_C-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/11066). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCFYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPSKTKRWGYSLHFMGYVIGCYGSLPQDHITQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF121241_Pol_P-D Product feature CHAIN AF121241_Pol_P-D of FT:mat_peptide AF121241_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1758). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCFYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPSKTKRWGYSLHFMGYVIGCYGSLPQDHITQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF121242_Pol_P-D Product feature CHAIN AF121242_Pol_P-D of FT:mat_peptide AF121242_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1218). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCFYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPQNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPSKTKRWGYSLHFMGYVIGCYGSLPQDHITQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF151735_Pol_P-D Product feature CHAIN AF151735_Pol_P-D of FT:mat_peptide AF151735_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTHRASKSASCLYQSPVRKAADPAVSTFEKHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPINRPVDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFPAPVPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AF280817_Pol_P-D Product feature CHAIN AF280817_Pol_P-D of FT:mat_peptide AF280817_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-D1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEYLVNHYFQTRHYLHTLWKAGILYKR
DTTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AJ131956_Pol_P-D Product feature CHAIN AJ131956_Pol_P-D of FT:mat_peptide AJ131956_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYIARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ344116_Pol_P-D Product feature CHAIN AJ344116_Pol_P-D of FT:mat_peptide AJ344116_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBsAg negative patient GX27). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYQR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNNRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICPVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFSFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627215_Pol_P-D Product feature CHAIN AJ627215_Pol_P-D of FT:mat_peptide AJ627215_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 06115). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGLPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSSSGHDTNLASKSASCIYQSSVRKAAYPAVSTFERHSSSGHAVEFHDLPPNSARSQGEGPVFPCWWLQFGNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARVSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLMSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSLTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPSTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627216_Pol_P-D Product feature CHAIN AJ627216_Pol_P-D of FT:mat_peptide AJ627216_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17707). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGLPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSSSGRDXNLASKSASCIYQSSVRKAAYPAVSTFERHSSSGHAVEFHDLPPNSARSQGEGPVFPCWWLQFGNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNXRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARVSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLXSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSLTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVXGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPSTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627218_Pol_P-D Product feature CHAIN AJ627218_Pol_P-D of FT:mat_peptide AJ627218_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 21116). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
DIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGLPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSSSGRDANLASKSASCIYQSSVRKAAYPAVSTFERHSSSGHAVEFHDLPPNSARSQGEGPVFPCWWLQFGNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARVSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSLTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPSTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627219_Pol_P-D Product feature CHAIN AJ627219_Pol_P-D of FT:mat_peptide AJ627219_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 24039). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
VSTHSASFCGSPYSWEQELQHGAESVHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPSGSGHTTIRASKSASCLYQSQVRQAAYPAVSTSERHSSSGHAVELHNLPSNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTLQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKKWGYSLNFMGYVIGCWGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627220_Pol_P-D Product feature CHAIN AJ627220_Pol_P-D of FT:mat_peptide AJ627220_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 29234). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHXTNLASKSASCIYQSPVSKAAYPAVSTFEKHASSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRKLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYIIGCHGSLPQEHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627222_Pol_P-D Product feature CHAIN AJ627222_Pol_P-D of FT:mat_peptide AJ627222_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 31228). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADXDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPCFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLEKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEHELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPLGVEPSGSGHNTNLASKSASCIHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVBLREDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSXYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627223_Pol_P-D Product feature CHAIN AJ627223_Pol_P-D of FT:mat_peptide AJ627223_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33720). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
NPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNFYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AJ627224_Pol_P-D Product feature CHAIN AJ627224_Pol_P-D of FT:mat_peptide AJ627224_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33852). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYSSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AM422939_Pol_P-D Product feature CHAIN AM422939_Pol_P-D of FT:mat_peptide AM422939_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate X28). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQPSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFERHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAQHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY090452_Pol_P-D Product feature CHAIN AY090452_Pol_P-D of FT:mat_peptide AY090452_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRSVLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGKLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHHKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPTNSARSQGERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRILNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQDHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RISLYASSPSVPSHLPDRVHFASPLHVTWRPP
>gnl|hbvpro|AY090453_Pol_P-D Product feature CHAIN AY090453_Pol_P-D of FT:mat_peptide AY090453_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLVRRQQGRSWSIRAGIHPTA
RRPFGVEPTGSGHNTNLASKSASCIYQSPVRKAAYPVVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY161150_Pol_P-D Product feature CHAIN AY161150_Pol_P-D of FT:mat_peptide AY161150_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLNKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRKLYSSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGATIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY161151_Pol_P-D Product feature CHAIN AY161151_Pol_P-D of FT:mat_peptide AY161151_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLNKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPEFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLTWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRKLYSSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGATIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY161152_Pol_P-D Product feature CHAIN AY161152_Pol_P-D of FT:mat_peptide AY161152_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLNKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRKLYSSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGATIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY161157_Pol_P-D Product feature CHAIN AY161157_Pol_P-D of FT:mat_peptide AY161157_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRPLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPS
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKNVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY161158_Pol_P-D Product feature CHAIN AY161158_Pol_P-D of FT:mat_peptide AY161158_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAIPS
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKNVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY233291_Pol_P-D Product feature CHAIN AY233291_Pol_P-D of FT:mat_peptide AY233291_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 179). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSTSFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILAFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY233292_Pol_P-D Product feature CHAIN AY233292_Pol_P-D of FT:mat_peptide AY233292_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 184). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFERHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYIARVSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPIYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGPFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY233294_Pol_P-D Product feature CHAIN AY233294_Pol_P-D of FT:mat_peptide AY233294_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 305). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFERHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYIARVSSNSRILNHQHGTLPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSTICSVVRKAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPIYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPYVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY233296_Pol_P-D Product feature CHAIN AY233296_Pol_P-D of FT:mat_peptide AY233296_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 185). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFERHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGPWPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY236160_Pol_P-D Product feature CHAIN AY236160_Pol_P-D of FT:mat_peptide AY236160_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1A). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARVYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSAVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSFIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSGVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLWSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLVFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGRAANWILRGTSFIYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY236162_Pol_P-D Product feature CHAIN AY236162_Pol_P-D of FT:mat_peptide AY236162_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 23A). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSSVRKAAYPSVSTFEKHSSSGHEVELHNLPPNSARSQSERPVSSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANVIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFHPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY236164_Pol_P-D Product feature CHAIN AY236164_Pol_P-D of FT:mat_peptide AY236164_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 30). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARVYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGLGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVEDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLWSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCRANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY661792_Pol_P-D Product feature CHAIN AY661792_Pol_P-D of FT:mat_peptide AY661792_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ayw). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTSSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFRVEPSGSGHTTNLASKSASYLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSHIFNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKCTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY661793_Pol_P-D Product feature CHAIN AY661793_Pol_P-D of FT:mat_peptide AY661793_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTSSFP
NIHLHQDIIKKCEQFVGQLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFRVEPSGSGHTTNLASKSASYLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSHIFNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCDGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKCTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY721605_Pol_P-D Product feature CHAIN AY721605_Pol_P-D of FT:mat_peptide AY721605_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AK1.1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCIYQSPVRKAAYPSVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLVGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY721606_Pol_P-D Product feature CHAIN AY721606_Pol_P-D of FT:mat_peptide AY721606_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AT1.2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQYGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSVGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGPQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY721607_Pol_P-D Product feature CHAIN AY721607_Pol_P-D of FT:mat_peptide AY721607_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HIY1.3). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTSNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHNSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRARLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLVGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY721609_Pol_P-D Product feature CHAIN AY721609_Pol_P-D of FT:mat_peptide AY721609_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AA1.5). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNQYFQTRHYLHTLWKVGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLTWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY721611_Pol_P-D Product feature CHAIN AY721611_Pol_P-D of FT:mat_peptide AY721611_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SK1.7). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIVKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPVGMEPSGSGHATHRASKSASCLHQSPVRKAAYPSVSTFERHSSSGHAVELRNLPRNSARSQSEKPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLTWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY741794_Pol_P-D Product feature CHAIN AY741794_Pol_P-D of FT:mat_peptide AY741794_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-50). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHAPSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSRPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY741795_Pol_P-D Product feature CHAIN AY741795_Pol_P-D of FT:mat_peptide AY741795_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-Hi). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQNLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHAPSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSRPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY741796_Pol_P-D Product feature CHAIN AY741796_Pol_P-D of FT:mat_peptide AY741796_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P3). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQNLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHAPSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLASNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSRPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY741797_Pol_P-D Product feature CHAIN AY741797_Pol_P-D of FT:mat_peptide AY741797_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-21). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGTPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPAVSTFEKHSSAGHAVELHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVA
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPPGWGLVIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|AY741798_Pol_P-D Product feature CHAIN AY741798_Pol_P-D of FT:mat_peptide AY741798_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P4). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAENLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYFHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELNNIPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGHHRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSCNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALYTAVV
NFLWSLGIHLNPGKTKRWGHSLHSMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLHLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|AY796030_Pol_P-D Product feature CHAIN AY796030_Pol_P-D of FT:mat_peptide AY796030_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FC1.9). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYPSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPDKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLPVAWRPP
>gnl|hbvpro|AY796031_Pol_P-D Product feature CHAIN AY796031_Pol_P-D of FT:mat_peptide AY796031_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RA1.10). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHPDIIKKCEQFVGPLTANEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFERHSSSGHAVEHHNFPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRDLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYSCIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGFFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY796032_Pol_P-D Product feature CHAIN AY796032_Pol_P-D of FT:mat_peptide AY796032_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NA1.11). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSTTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRPQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQTIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|AY945307_Pol_P-D Product feature CHAIN AY945307_Pol_P-D of FT:mat_peptide AY945307_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVEFHNFPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFGKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTSVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRLRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ111986_Pol_P-D Product feature CHAIN DQ111986_Pol_P-D of FT:mat_peptide DQ111986_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MBT181). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDXDAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDVIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRDGIHPTA
RRPFGVEPSGSGHTANLASKSASCLHQSPVRKAAYPSVSTFKKHSSSGHAVELHNLPSNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGKYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFAEATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ304547_Pol_P-D Product feature CHAIN DQ304547_Pol_P-D of FT:mat_peptide DQ304547_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRESRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSSVRKAAYPSVSTFEKHSSSGHEVELHNLPPNSARSQSERPVSSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVSRLSSNSRIFNHQHGIMQNLHDSCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANVIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFHPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ304548_Pol_P-D Product feature CHAIN DQ304548_Pol_P-D of FT:mat_peptide DQ304548_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELSRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFGGPLTVNEKRRLQLIMPARFYPKVTNNLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSSVRKAAYPSVSTFEKHSSSGHEVELHNLPPNSARSQSERPVSSCWWLQFRNS
KPCSDYCLSHIDNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDNNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFHPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ304549_Pol_P-D Product feature CHAIN DQ304549_Pol_P-D of FT:mat_peptide DQ304549_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELSRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSSVRKAAYPSVSTFEKHSSSGHEVELHNLPPNSARSQSERPVSSCWWLQLRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDNNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANVIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFHPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ304550_Pol_P-D Product feature CHAIN DQ304550_Pol_P-D of FT:mat_peptide DQ304550_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSSVRKAAYPSVSTFEKHSSSGHEVELHNLPPNSTRSQSERPVSSCWWLQFKNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDNNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANVIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFHPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ304551_Pol_P-D Product feature CHAIN DQ304551_Pol_P-D of FT:mat_peptide DQ304551_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQHRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSSVRKAAYPSVSTFEKHSSSGHEVELHNLPPNSTRSQSERPVSSCWWLQFKNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANVIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFHPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ315776_Pol_P-D Product feature CHAIN DQ315776_Pol_P-D of FT:mat_peptide DQ315776_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI00615). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ329356_Pol_P-D Product feature CHAIN DQ329356_Pol_P-D of FT:mat_peptide DQ329356_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRGGEDLNLGNLNVRIPWTHKVGSFTGLYSSTGPVFNPNWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILARPPVGSSLQSKHRKSRLGLQSKQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPVVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGNTRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGLGVVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGPLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRGHFASPLRVRWRPP
>gnl|hbvpro|DQ329357_Pol_P-D Product feature CHAIN DQ329357_Pol_P-D of FT:mat_peptide DQ329357_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRGGEDLNLGNLNVRIPWTHKVGSFTGLYSSTGPGFNPHWNTSSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILARPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPVVSTFEKHSSSGHAVELLNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGNTRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGLGVVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGPLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRGHFASPLRVRWRPP
>gnl|hbvpro|DQ336674_Pol_P-D Product feature CHAIN DQ336674_Pol_P-D of FT:mat_peptide DQ336674_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336675_Pol_P-D Product feature CHAIN DQ336675_Pol_P-D of FT:mat_peptide DQ336675_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336676_Pol_P-D Product feature CHAIN DQ336676_Pol_P-D of FT:mat_peptide DQ336676_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWVSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336677_Pol_P-D Product feature CHAIN DQ336677_Pol_P-D of FT:mat_peptide DQ336677_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWVSLDVSAAFYHIPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336678_Pol_P-D Product feature CHAIN DQ336678_Pol_P-D of FT:mat_peptide DQ336678_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336679_Pol_P-D Product feature CHAIN DQ336679_Pol_P-D of FT:mat_peptide DQ336679_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336680_Pol_P-D Product feature CHAIN DQ336680_Pol_P-D of FT:mat_peptide DQ336680_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=824 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPAGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCRYQSPVRKAAHSSVSTVEKHPSSGHAVELNNFPPNSAKSCWWLQFRNCKPCSDYCL
SHIVNLLEDWGPCAENGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNHRVSWPKFAVPNLQSLTNLL
SSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNPRIFNHQHGTMQNLHDSCSRNLYVSLLLLYQTFGR
KLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVTNFLLSVGI
HLNPHKTKRWGYSLHFMGYVIGSYGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYA
CIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELLAACFARSR
SGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTGRTSLYADS
PSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336681_Pol_P-D Product feature CHAIN DQ336681_Pol_P-D of FT:mat_peptide DQ336681_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=824 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCRYQSPVRKAAYPSVSTFEKHSSSGHAVELHNFPPNSARSCWWLQFRNSKPCSDYCL
SHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNYRVSWPKFAVPNLQSLTNLL
SSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLLLLYQTFGR
KLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNFLLSVGI
HLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYA
CIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELLAACFARSR
SGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRTSLYADS
PSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336682_Pol_P-D Product feature CHAIN DQ336682_Pol_P-D of FT:mat_peptide DQ336682_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=824 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPAGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCRYQSPVRKAAHSSVSTVEKHPSSGHAVELNNFPPNSAKSCWWLQFRNCKPCSDYCL
SHIVNLLEDWGPCAENGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNHRVSWPKFAVPNLQSLTNLL
SSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNPRIFNHQHGTMQNLHDSCSRNLYVSLLLLYQTFGR
KLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAKSVSHLESLFTAVTNFLLSVGI
HLNPHKTKRWGYSLHFMGYVIGSYGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYA
CIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELLAACFARSR
SGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLSLPFRPTTGRTSLYADS
PSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336683_Pol_P-D Product feature CHAIN DQ336683_Pol_P-D of FT:mat_peptide DQ336683_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=824 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPAGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCRYQSPVRKAAHPSVSTVEKHSSSGHAVELHNFPPNSAKSCWWLQFRNSKPCSDHCL
SHIVNLLEDWGPCAEDGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNHRVSWPKFAVPNLQSLTNLL
SSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNPRIFNHQHGTMQNLHDSCSRNLYVSLLLLYQTFGR
KLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVTNFLLSVGI
HLNPHKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYA
CIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELLAACFARSR
SGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTGRTSLYADS
PSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336684_Pol_P-D Product feature CHAIN DQ336684_Pol_P-D of FT:mat_peptide DQ336684_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=824 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPAGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCRYQSPVRKAAHSSVSTVEKHPSSGHAVELNNFPPNSAKSCWWLQFRNCKPCSDYCL
SHIVNLLEDWGPCAENGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNHRVSWPKFAVPNLQSLTNLL
SSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNPRIFNHQHGTMQNLHDSCSRNLYVSLLLLYQTFGR
KLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVTNFLLSVGI
HLNPHKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYA
CIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELLAACFARSR
SGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTGRTSLYADS
PSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336685_Pol_P-D Product feature CHAIN DQ336685_Pol_P-D of FT:mat_peptide DQ336685_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLLVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSFIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILDHQHGSLPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGIVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRPPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336686_Pol_P-D Product feature CHAIN DQ336686_Pol_P-D of FT:mat_peptide DQ336686_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWAHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVLAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILDHQHGTMPDLHDSCSRNLYVSFL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQPPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRPPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336687_Pol_P-D Product feature CHAIN DQ336687_Pol_P-D of FT:mat_peptide DQ336687_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVLAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILDHQHGTMPDLHDSCSRNLYVSFL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQPPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRPPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336688_Pol_P-D Product feature CHAIN DQ336688_Pol_P-D of FT:mat_peptide DQ336688_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFAGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRLPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSLRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVLAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILDHQHGTMPDLHDSCSRNLYVSFL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQPPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRPPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336689_Pol_P-D Product feature CHAIN DQ336689_Pol_P-D of FT:mat_peptide DQ336689_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGNLNVSTPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSFIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILDNQHGTMPDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRPPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336690_Pol_P-D Product feature CHAIN DQ336690_Pol_P-D of FT:mat_peptide DQ336690_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNTTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQVLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAWVHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSFIVNLLEDGDPCTEHGEHHIKTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLGSLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYQAFLCKQYLNLYPVARQRPGLCQVLADATPTGWGLAMGHLRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ336691_Pol_P-D Product feature CHAIN DQ336691_Pol_P-D of FT:mat_peptide DQ336691_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=826 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKPPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSRHTTNFASKSASCLQQMSVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSFIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFPQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWVSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVGLGAKSVQHLESLFTAVT
NFLWPLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRPPYRPTTG
RTSLYADSPSVPSHLPESLSSSFSPL
>gnl|hbvpro|DQ336692_Pol_P-D Product feature CHAIN DQ336692_Pol_P-D of FT:mat_peptide DQ336692_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTGPVFNPHWKTPSFP
YIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSQPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVLAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILDHQHGTMPDLHDSCSRNLYVSFL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQPPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRPPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ399006_Pol_P-D Product feature CHAIN DQ399006_Pol_P-D of FT:mat_peptide DQ399006_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate G1). Complete genome. [Hepadnaviridae] (length=835 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQARHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHMARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPADSTFERHSSSGHAVEFHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQYDQYGTMQNLHDYCSRNLYV
SLLLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFT
AVTNFLLSLGVHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIRQKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQ
CGYPALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFSAPLPIHTA
ELLAACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSSLNPADDPSRGRLGLYRPLLRLPFRP
TTGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ464168_Pol_P-D Product feature CHAIN DQ464168_Pol_P-D of FT:mat_peptide DQ464168_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWAHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKSRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSSHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGLEPSGSRHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRTS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSSLSWLSLGVSAAFCQLPLQPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ464169_Pol_P-D Product feature CHAIN DQ464169_Pol_P-D of FT:mat_peptide DQ464169_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKEGDFTGLYSSTVPGFNPHWKTPSFL
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSGLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSRHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRNPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWRKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLDVAWRPP
>gnl|hbvpro|DQ464170_Pol_P-D Product feature CHAIN DQ464170_Pol_P-D of FT:mat_peptide DQ464170_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNGRIPWTHKVGNFTGLYSSTDPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFNQQSFGILSAPPVGSSLQIKHRKSRLGLQSQQEHLARRQQGRSWSIRAWVHPTA
RRPFGVGPSGSRHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPKTPSRVTGGVFLVDKNPHNTAESRLMVDFSQFSRGNYRVSWRKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ464172_Pol_P-D Product feature CHAIN DQ464172_Pol_P-D of FT:mat_peptide DQ464172_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLQEELPHLADEGLNRRVAEDLNLRNLTVSYSWTHKVRSFTGLYSSTVPVFNPHWKTPSFP
NIHLPQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSALFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNSASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWVSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLWSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ464173_Pol_P-D Product feature CHAIN DQ464173_Pol_P-D of FT:mat_peptide DQ464173_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKEGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSFIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLWSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ464174_Pol_P-D Product feature CHAIN DQ464174_Pol_P-D of FT:mat_peptide DQ464174_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGSMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQRGY
PALMPLYACIHSKQAFTFLPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHLRMRGTFLAPLPIHTAELP
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ464175_Pol_P-D Product feature CHAIN DQ464175_Pol_P-D of FT:mat_peptide DQ464175_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLVSLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRATTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ464176_Pol_P-D Product feature CHAIN DQ464176_Pol_P-D of FT:mat_peptide DQ464176_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=833 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARYYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLLQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTVVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLSFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
TACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLPNHAQHHA
>gnl|hbvpro|DQ464177_Pol_P-D Product feature CHAIN DQ464177_Pol_P-D of FT:mat_peptide DQ464177_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=833 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSFIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTVVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPFLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLPNHAQHHA
>gnl|hbvpro|DQ464178_Pol_P-D Product feature CHAIN DQ464178_Pol_P-D of FT:mat_peptide DQ464178_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNATKYLPLDKGIKPHYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRNSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARWSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLVSLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQACTISPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ464181_Pol_P-D Product feature CHAIN DQ464181_Pol_P-D of FT:mat_peptide DQ464181_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S3). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=830 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSSVRKAAYPSDSTFEKHPSSGHAVELNNLPPNSARSRSEAVTCWWLQFRNSKP
CSDYCLSNIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWRKFAVPNLQ
SLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLLLL
YQTFGRKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNF
LLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGYPA
LMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELLAA
CFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTGRT
SLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ464182_Pol_P-D Product feature CHAIN DQ464182_Pol_P-D of FT:mat_peptide DQ464182_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S4). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNLRVAEDLNLGNLNGSIPWTHKVGTFTGLYSSTVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGQLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASCFYQSPVRKAAYSSVSTFERHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRDVARLSSNSRILNHQHGTMQNLHDFCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ486021_Pol_P-D Product feature CHAIN DQ486021_Pol_P-D of FT:mat_peptide DQ486021_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT13). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSFIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAVSRLVEDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLALGIHLNPNKTKGWGYSLNFMGIVIGSYGSLPQEHIVQKIKECGRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ486022_Pol_P-D Product feature CHAIN DQ486022_Pol_P-D of FT:mat_peptide DQ486022_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT11). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARVYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRSFGVEPSGLGHATNFASKSASCLHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCTEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVEDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPASMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLWSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCRANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|DQ486025_Pol_P-D Product feature CHAIN DQ486025_Pol_P-D of FT:mat_peptide DQ486025_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTEPIFNPHWKTPSFP
NIHLHQDIIRKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSFQSKHCKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTHCASKSASCLHQSPVRKAAYPALSTAEKHSSSGRAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVEDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPNLHDSCSRNLYVSLL
LLYQTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF103275_Pol_P-D Product feature CHAIN EF103275_Pol_P-D of FT:mat_peptide EF103275_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran11). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTSVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|EF103276_Pol_P-D Product feature CHAIN EF103276_Pol_P-D of FT:mat_peptide EF103276_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran22). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNSYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRTPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAATPSVSTFEKHSSSGHAVEPHNLPPNSARSQSERPIFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPTIAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDVVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVRSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF103277_Pol_P-D Product feature CHAIN EF103277_Pol_P-D of FT:mat_peptide EF103277_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran33). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCIYQSPVRKAAYPAVSTFEKHASSGHAVELSKLPPNFARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVCAAFNHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF103279_Pol_P-D Product feature CHAIN EF103279_Pol_P-D of FT:mat_peptide EF103279_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran99). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAADPSVSTFEKHSSSGHAVKFHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSAVLSRKYTSFPWLVGCAANGILRGTSFVYVPWALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EF103280_Pol_P-D Product feature CHAIN EF103280_Pol_P-D of FT:mat_peptide EF103280_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran100). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWTIPGGIHPTA
RRPFGGEPSGSGHTTNLANESSSCLYQSSLRKGADPSVSTFERHSCSGHAVKLHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVALSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVLADATPTGWSMVIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILATDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSAPNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPFHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EF103281_Pol_P-D Product feature CHAIN EF103281_Pol_P-D of FT:mat_peptide EF103281_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKQCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVEFHNFPPNSARSQRGRPVFPCWGLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVALSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGATILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU155893_Pol_P-D Product feature CHAIN EU155893_Pol_P-D of FT:mat_peptide EU155893_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPNWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESIHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHMARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVTKAAYPAVSTFEKHSSSGHAMEFQNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAKSRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNFRILNHQHGTLPTLHNNCSRNLYVCLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGGYGALPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVEWRPP
>gnl|hbvpro|EU414135_Pol_P-D Product feature CHAIN EU414135_Pol_P-D of FT:mat_peptide EU414135_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFXGXLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGXEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSAXSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGXXGSLPQDHIIQKIKECFRKLPVBRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU414136_Pol_P-D Product feature CHAIN EU414136_Pol_P-D of FT:mat_peptide EU414136_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPYFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNITKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKXGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPFRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU414138_Pol_P-D Product feature CHAIN EU414138_Pol_P-D of FT:mat_peptide EU414138_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSXXVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLAGRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTVEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGXXGSLPQDHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU414139_Pol_P-D Product feature CHAIN EU414139_Pol_P-D of FT:mat_peptide EU414139_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEEXPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTLPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVREATYPAVSTFEKHSSSGHAVEXHNFPSNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGXXGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU414140_Pol_P-D Product feature CHAIN EU414140_Pol_P-D of FT:mat_peptide EU414140_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRTASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNXRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIXNHQXGTXXNLHDXCSRNLYVSLX
LLXXTFGRKLHLYSHPIIXGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLDPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU414141_Pol_P-D Product feature CHAIN EU414141_Pol_P-D of FT:mat_peptide EU414141_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHNTNXASKSASCLHQSPVRKAAYPAVSTFAKHSSSGHAVELHNLPSNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGXXGSLPQEHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLIRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU414142_Pol_P-D Product feature CHAIN EU414142_Pol_P-D of FT:mat_peptide EU414142_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPXT
RRPFGVEPSGSGHNTNFASKSASCLHQSPVRKAAYPADSTFAKHSSSGHAVELHNLPSNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRXPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVXHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGXXGSLPQEHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFXAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|EU414143_Pol_P-D Product feature CHAIN EU414143_Pol_P-D of FT:mat_peptide EU414143_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRXAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKYRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTP
RRPFGVEPSGSGHATNFASKSTSCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLALIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPATMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPHLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594382_Pol_P-D Product feature CHAIN EU594382_Pol_P-D of FT:mat_peptide EU594382_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSQHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHNTNFASKSASCLHQSPVRKAAYPVVSTFAKHSSSGHAVELHNLPSNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVVRQRPGLCQVFADATPTGWGLAMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594396_Pol_P-D Product feature CHAIN EU594396_Pol_P-D of FT:mat_peptide EU594396_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPDRKAAYPSVSTFEKHSSSGHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594397_Pol_P-D Product feature CHAIN EU594397_Pol_P-D of FT:mat_peptide EU594397_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYIIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594398_Pol_P-D Product feature CHAIN EU594398_Pol_P-D of FT:mat_peptide EU594398_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDCCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594399_Pol_P-D Product feature CHAIN EU594399_Pol_P-D of FT:mat_peptide EU594399_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSTRSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594400_Pol_P-D Product feature CHAIN EU594400_Pol_P-D of FT:mat_peptide EU594400_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPLRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594401_Pol_P-D Product feature CHAIN EU594401_Pol_P-D of FT:mat_peptide EU594401_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594402_Pol_P-D Product feature CHAIN EU594402_Pol_P-D of FT:mat_peptide EU594402_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFKNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594403_Pol_P-D Product feature CHAIN EU594403_Pol_P-D of FT:mat_peptide EU594403_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594404_Pol_P-D Product feature CHAIN EU594404_Pol_P-D of FT:mat_peptide EU594404_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSTSCIHQSPVRKAAYPAVSTFEKHPPSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGXYGSLPQTHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594405_Pol_P-D Product feature CHAIN EU594405_Pol_P-D of FT:mat_peptide EU594405_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594407_Pol_P-D Product feature CHAIN EU594407_Pol_P-D of FT:mat_peptide EU594407_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594408_Pol_P-D Product feature CHAIN EU594408_Pol_P-D of FT:mat_peptide EU594408_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVLPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594409_Pol_P-D Product feature CHAIN EU594409_Pol_P-D of FT:mat_peptide EU594409_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594410_Pol_P-D Product feature CHAIN EU594410_Pol_P-D of FT:mat_peptide EU594410_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594413_Pol_P-D Product feature CHAIN EU594413_Pol_P-D of FT:mat_peptide EU594413_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594414_Pol_P-D Product feature CHAIN EU594414_Pol_P-D of FT:mat_peptide EU594414_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLTPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594415_Pol_P-D Product feature CHAIN EU594415_Pol_P-D of FT:mat_peptide EU594415_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHDLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594416_Pol_P-D Product feature CHAIN EU594416_Pol_P-D of FT:mat_peptide EU594416_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCVEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQRGTMQNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQARQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594417_Pol_P-D Product feature CHAIN EU594417_Pol_P-D of FT:mat_peptide EU594417_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594418_Pol_P-D Product feature CHAIN EU594418_Pol_P-D of FT:mat_peptide EU594418_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLAGRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594419_Pol_P-D Product feature CHAIN EU594419_Pol_P-D of FT:mat_peptide EU594419_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHSTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594420_Pol_P-D Product feature CHAIN EU594420_Pol_P-D of FT:mat_peptide EU594420_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHSTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594421_Pol_P-D Product feature CHAIN EU594421_Pol_P-D of FT:mat_peptide EU594421_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHDLPPNSTRSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594422_Pol_P-D Product feature CHAIN EU594422_Pol_P-D of FT:mat_peptide EU594422_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHSTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFERHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPGRVHFASPLHVAWRPP
>gnl|hbvpro|EU594423_Pol_P-D Product feature CHAIN EU594423_Pol_P-D of FT:mat_peptide EU594423_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHSTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594424_Pol_P-D Product feature CHAIN EU594424_Pol_P-D of FT:mat_peptide EU594424_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQAHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594425_Pol_P-D Product feature CHAIN EU594425_Pol_P-D of FT:mat_peptide EU594425_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHMARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPIFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSXLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGASILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594426_Pol_P-D Product feature CHAIN EU594426_Pol_P-D of FT:mat_peptide EU594426_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSTRSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPFHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594427_Pol_P-D Product feature CHAIN EU594427_Pol_P-D of FT:mat_peptide EU594427_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594428_Pol_P-D Product feature CHAIN EU594428_Pol_P-D of FT:mat_peptide EU594428_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNRASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594429_Pol_P-D Product feature CHAIN EU594429_Pol_P-D of FT:mat_peptide EU594429_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLRLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHYLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCVEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594430_Pol_P-D Product feature CHAIN EU594430_Pol_P-D of FT:mat_peptide EU594430_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594431_Pol_P-D Product feature CHAIN EU594431_Pol_P-D of FT:mat_peptide EU594431_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLRLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHYLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCVEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594432_Pol_P-D Product feature CHAIN EU594432_Pol_P-D of FT:mat_peptide EU594432_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLRLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHYLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594433_Pol_P-D Product feature CHAIN EU594433_Pol_P-D of FT:mat_peptide EU594433_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIHQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGNMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU594434_Pol_P-D Product feature CHAIN EU594434_Pol_P-D of FT:mat_peptide EU594434_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPSVGSSLQSKYSKSRLGLQSQQGHLARRQQGRSWSIRSGFHPTP
RRPFGVEPSGSGHATHFAGESTSCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVLPCWWLQFRNS
KPCSDHCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRTLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787436_Pol_P-D Product feature CHAIN EU787436_Pol_P-D of FT:mat_peptide EU787436_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 165). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHKQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787437_Pol_P-D Product feature CHAIN EU787437_Pol_P-D of FT:mat_peptide EU787437_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSQRPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGILQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787438_Pol_P-D Product feature CHAIN EU787438_Pol_P-D of FT:mat_peptide EU787438_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=831 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKSTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGQLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGNTTNHPNTSASCLHQSSVRKAAYPSVSTFEKHSSSGPVEFHNLPPNSARSQSERPDFPCWWLQFRNSK
PCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPNL
QSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLLL
LYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTN
FLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYP
ALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFQAPLPIHTAELLA
ACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGR
TSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787440_Pol_P-D Product feature CHAIN EU787440_Pol_P-D of FT:mat_peptide EU787440_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W17). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSQRPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGPFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787441_Pol_P-D Product feature CHAIN EU787441_Pol_P-D of FT:mat_peptide EU787441_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQNIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSFQSKHRKSRLGLQSQQGHLARRQQGRRWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERLVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787442_Pol_P-D Product feature CHAIN EU787442_Pol_P-D of FT:mat_peptide EU787442_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W37). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSQVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSQRPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIKKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787443_Pol_P-D Product feature CHAIN EU787443_Pol_P-D of FT:mat_peptide EU787443_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate w40). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPNWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLQPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787445_Pol_P-D Product feature CHAIN EU787445_Pol_P-D of FT:mat_peptide EU787445_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W51). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVYHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVYWPKLAVPN
LQSLTSIKSSNLSWLSLDVYAAFYHLPLHPAAMPHLLVGSYGLSRYVARLSSNSRIFNHQHGTLQNMHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787446_Pol_P-D Product feature CHAIN EU787446_Pol_P-D of FT:mat_peptide EU787446_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W75). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNITKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU787447_Pol_P-D Product feature CHAIN EU787447_Pol_P-D of FT:mat_peptide EU787447_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W46). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRESWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU919197_Pol_P-D Product feature CHAIN EU919197_Pol_P-D of FT:mat_peptide EU919197_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJU). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFFPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGMEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLLFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU921418_Pol_P-D Product feature CHAIN EU921418_Pol_P-D of FT:mat_peptide EU921418_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.165.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHSLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESLHQQSSGILSRPPVGSSLQSKYRKPRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPADSTFERHSSSGHAVELHNLPPNSARSQSERPIFPCWWLQFRNS
KPCSDHCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKECFKKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU921419_Pol_P-D Product feature CHAIN EU921419_Pol_P-D of FT:mat_peptide EU921419_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.252.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKYRKPRLGLQSQQGHLAGRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPAVSAFEKHTSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDHCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMSNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939680_Pol_P-D Product feature CHAIN EU939680_Pol_P-D of FT:mat_peptide EU939680_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C186). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGTLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPAT
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQSFGQKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCHGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|EU939681_Pol_P-D Product feature CHAIN EU939681_Pol_P-D of FT:mat_peptide EU939681_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESLHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRRWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFERHASSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349205_Pol_P-D Product feature CHAIN FJ349205_Pol_P-D of FT:mat_peptide FJ349205_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H5). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHPDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYSHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGFQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNFPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349206_Pol_P-D Product feature CHAIN FJ349206_Pol_P-D of FT:mat_peptide FJ349206_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLHLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPVGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSAFEKHSSSGHAVELHNFPPNSARSQGERPVSPCWWLQFRNS
KPCSDYCLSHIVNLREDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349208_Pol_P-D Product feature CHAIN FJ349208_Pol_P-D of FT:mat_peptide FJ349208_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H25). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWEAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSPGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNFPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIRECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349209_Pol_P-D Product feature CHAIN FJ349209_Pol_P-D of FT:mat_peptide FJ349209_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H29). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349213_Pol_P-D Product feature CHAIN FJ349213_Pol_P-D of FT:mat_peptide FJ349213_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H59). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDNDTGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRSPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGFHPTA
RRTLGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFERHASSGHAVELHNLPPNSARSQSERPVLPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVDHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVRKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ349214_Pol_P-D Product feature CHAIN FJ349214_Pol_P-D of FT:mat_peptide FJ349214_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H61). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFAGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGQLARRQQGRSWSIRAGFHSTA
RRSFGVEPSGSGHTTNFASKSASCLHQSPVRKAADPAVSTFEKHSSSCHAVEFHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDNCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIQKIKECFRKLPTNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLRKQYLNLYPVARQRAGLCQGFGDATPTGWGLVMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349215_Pol_P-D Product feature CHAIN FJ349215_Pol_P-D of FT:mat_peptide FJ349215_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H82). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RWPFGVEASGSGHTTNLAYKSASCLYQSSARKAAYHSVSTFEKHASSGNEVELHNLPPNSARSQSERPESPCWWLQFRNR
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARDTGGVFLVDKNPHNNAQSRLVVDFSQFSRGNYRVCCPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349216_Pol_P-D Product feature CHAIN FJ349216_Pol_P-D of FT:mat_peptide FJ349216_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H113). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRLVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349218_Pol_P-D Product feature CHAIN FJ349218_Pol_P-D of FT:mat_peptide FJ349218_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H135). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGVHPTS
RRPFGVEPSGSGHNTNPASKSASCSYQSPVRKAAYPAVSTFEKHSSSGHAVELHNFPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPARVHFASPLHVAWRPP
>gnl|hbvpro|FJ349219_Pol_P-D Product feature CHAIN FJ349219_Pol_P-D of FT:mat_peptide FJ349219_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H138). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLQPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPSTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349220_Pol_P-D Product feature CHAIN FJ349220_Pol_P-D of FT:mat_peptide FJ349220_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H144). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKKCEQFVGPLTVNEKRRLRLIMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349228_Pol_P-D Product feature CHAIN FJ349228_Pol_P-D of FT:mat_peptide FJ349228_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C11). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPTFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNIPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349229_Pol_P-D Product feature CHAIN FJ349229_Pol_P-D of FT:mat_peptide FJ349229_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C26). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYTWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKYRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSSFEKPSSWGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
QPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIVQKIKECFRKLPVHRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349230_Pol_P-D Product feature CHAIN FJ349230_Pol_P-D of FT:mat_peptide FJ349230_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C7). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYTWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKYRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSSFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSYLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349231_Pol_P-D Product feature CHAIN FJ349231_Pol_P-D of FT:mat_peptide FJ349231_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C22). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTDLASKSASCLDQSPVRKATYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349232_Pol_P-D Product feature CHAIN FJ349232_Pol_P-D of FT:mat_peptide FJ349232_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C51). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLAKRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSTSCLHQSPVRKAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDFCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQYKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349233_Pol_P-D Product feature CHAIN FJ349233_Pol_P-D of FT:mat_peptide FJ349233_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C54). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIITKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVKKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349234_Pol_P-D Product feature CHAIN FJ349234_Pol_P-D of FT:mat_peptide FJ349234_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C82). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLHLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSIQSKHRKSRLGLQSQQGHLARRQQGRSWSLRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLSPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSAGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ349235_Pol_P-D Product feature CHAIN FJ349235_Pol_P-D of FT:mat_peptide FJ349235_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C90). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLPQDIIRKCEQFVGPLTVNEKRRLRLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTSEKHPSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPKTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ386590_Pol_P-D Product feature CHAIN FJ386590_Pol_P-D of FT:mat_peptide FJ386590_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1841). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHATNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562309_Pol_P-D Product feature CHAIN FJ562309_Pol_P-D of FT:mat_peptide FJ562309_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I200). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLVMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWTIRAGVHSTT
RQSFGVEPSGSGHIDNSTSSASSCLHQSAVRKTAYSHLSTSKRQSSSGHAVELHNLPPNSAKSRSERPVFPCWWLQFRNS
KTCSHYCLSHIXNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQHKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ562338_Pol_P-D Product feature CHAIN FJ562338_Pol_P-D of FT:mat_peptide FJ562338_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I192). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPVGVEPSGSGHITNFASKSASCLHQSPVRKAAYPTVSTFERHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRILNHQHGTMQNLHDFCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFGKLPVNRPIDWEVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|FJ692506_Pol_P-D Product feature CHAIN FJ692506_Pol_P-D of FT:mat_peptide FJ692506_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50157). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLRQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQALQHGAESFHQQSSGILSRPPVGSSLQSKYRKSRLGLQSQQGHLARRQQGRGWSIRAGVHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPTNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692507_Pol_P-D Product feature CHAIN FJ692507_Pol_P-D of FT:mat_peptide FJ692507_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50158). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLRQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQALQHGAESFHQQSSGILSRPPVGSSLQSKYRKSRLGLQSQQGHLARRQQGRGWSIRAGVHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPTNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692532_Pol_P-D Product feature CHAIN FJ692532_Pol_P-D of FT:mat_peptide FJ692532_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50053). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPXLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
VSTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRTAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTLQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKKWGYSLNFMGYVIGCWGSLPQDHIIHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVLGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ692533_Pol_P-D Product feature CHAIN FJ692533_Pol_P-D of FT:mat_peptide FJ692533_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50064). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
VSTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRTAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTLQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKKWGYSLNFMGYVIGCWGSLPQDHIIHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ899792_Pol_P-D Product feature CHAIN FJ899792_Pol_P-D of FT:mat_peptide FJ899792_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146-1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESLHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRRWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFERHASSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGERHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHRHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904395_Pol_P-D Product feature CHAIN FJ904395_Pol_P-D of FT:mat_peptide FJ904395_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A10a). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTXNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSGSIRAGVHPTS
RRSFGVEPSGSGHNTNLASKSASCLHQSXVRKAADPAVSTFERHSSSSHAVELHNLPPNSARSQSERPVLPCWWLQFRNN
KPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLM
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGANSAQHLESLFTAVT
NFLLSLGIHLNTNKTKRWGYSLHFMGYVIGCWGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLCLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904399_Pol_P-D Product feature CHAIN FJ904399_Pol_P-D of FT:mat_peptide FJ904399_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A18). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLAXEGXNRRVAEDLNLGNLNVSIPWTHKVGNLTGLYSXTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHMARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRVPLPIHTAELL
AACFARSRSGAHILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904402_Pol_P-D Product feature CHAIN FJ904402_Pol_P-D of FT:mat_peptide FJ904402_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A26). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGVNRRVAEDLNLGNXNVSIPWTHKVGNFAGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904410_Pol_P-D Product feature CHAIN FJ904410_Pol_P-D of FT:mat_peptide FJ904410_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A54b). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGQFTGLYSSTEPVFNPHWKTPSFP
NIHLHQDIIXRCEQFVGPLTINEKRRLKLIMPARFYPNFTKYLPLDKGIKSYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHNTNLASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLAWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNTNKTKRWGYSLHFMGYVIGSWGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLCLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904412_Pol_P-D Product feature CHAIN FJ904412_Pol_P-D of FT:mat_peptide FJ904412_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A56). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSSSGHTTNLASKSASFLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904415_Pol_P-D Product feature CHAIN FJ904415_Pol_P-D of FT:mat_peptide FJ904415_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A63). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRSILLLDDEAGPLEEELPRVAVEGVNRRVAEDLNLGNLNVSIRWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYSSVSTFEKHSSSGHAVELHNLPPNSAGSKSERPVFPCWWLQFRNS
KPCSDYCLSHIINLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFHPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904418_Pol_P-D Product feature CHAIN FJ904418_Pol_P-D of FT:mat_peptide FJ904418_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A69a). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKPPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRTFGVEPSSSGHATNLASKSTSCLYQSPVRKAAHTSDSTFEKHSSSGHAVELHTLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904419_Pol_P-D Product feature CHAIN FJ904419_Pol_P-D of FT:mat_peptide FJ904419_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A70). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNLTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTINEKRRLKLIMPARFYPKRTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARCQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHNSNLASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVSGGVFLVDKNPHNAAESRLVVDFSQFSRGDYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVS
NFLLSLGIHLNTNKTKRWGYSLHFMGYVIGCWGSLPQDHIIHKIKECFRKLPVNRPIDWKVCQRLVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLCLPFRPTTG
RTSLYAASPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904420_Pol_P-D Product feature CHAIN FJ904420_Pol_P-D of FT:mat_peptide FJ904420_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71a). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYSSVSTFEKHSSSGHAVELHNLPPNSAXSXSERPVFPCWWLQFRNS
KPCSDYCLSHIINLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFHPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904421_Pol_P-D Product feature CHAIN FJ904421_Pol_P-D of FT:mat_peptide FJ904421_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71b). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYSSVSTFEKHSSSGHAVELHNLPPNSAXSXSERPVFPCWWLQFRNS
KPCSDYCLSHIINLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFHPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904422_Pol_P-D Product feature CHAIN FJ904422_Pol_P-D of FT:mat_peptide FJ904422_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A76). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTINEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTVERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTXQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLCLPYRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904424_Pol_P-D Product feature CHAIN FJ904424_Pol_P-D of FT:mat_peptide FJ904424_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A79a). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGHFTGFYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYRR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRSPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHTTNLASKSASCFYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPGTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDTCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904426_Pol_P-D Product feature CHAIN FJ904426_Pol_P-D of FT:mat_peptide FJ904426_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B4). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNASIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPSS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSSHAVELHNLSPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIINLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904427_Pol_P-D Product feature CHAIN FJ904427_Pol_P-D of FT:mat_peptide FJ904427_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHIVNHYYQTRHYLHTLWEAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSVQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASGLYQSPVRKAAYPSVSTFEKHSSSSHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDHCISHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVPWPKFAVPD
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGKKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904429_Pol_P-D Product feature CHAIN FJ904429_Pol_P-D of FT:mat_peptide FJ904429_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=827 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRARIHPTT
RRPFGVEPSGSGHTKSASCLYQSPVRKAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNSKPCSD
YCLSNIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNAAESRLVVDFSQFSRGNYRVSWPKFAVPNLQSLT
NLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIFNHQHGTMQNLHDSCSRNLYVSLLLLYKT
FGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNFLLS
LGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALKP
LYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPSLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELLAACFA
RSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRTSLY
ADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904431_Pol_P-D Product feature CHAIN FJ904431_Pol_P-D of FT:mat_peptide FJ904431_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B12). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDSIPWTHKVGNLAGLXSSTVPVINPXWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSESTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLXSLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904432_Pol_P-D Product feature CHAIN FJ904432_Pol_P-D of FT:mat_peptide FJ904432_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B14). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGNHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904433_Pol_C-D Product feature CHAIN FJ904433_Pol_C-D of FT:mat_peptide FJ904433_Pol_C-D of [Viruses] Hepatitis B Virus genotype D (isolate B15). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNXNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTANEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ESTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHHKSRLGLQSQQGPLARRQQGRSGSIRAGVHPTA
RRPFGVEPAGSRHNTNLASKSASCFYQSPVRKAAYPAVSTSERHSSSSHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCADHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSIQHLESLFTAVT
NFLLSLGIHLNTNKTKRWGYSLHFMGYVIGCWGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQYKQAFTFSPTCKAFQCKQYMNLYPDARQRPGLCQVFADATPTGWGLVMGHQRLRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVSRPLLCLPFRPTTG
RISLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904435_Pol_P-D Product feature CHAIN FJ904435_Pol_P-D of FT:mat_peptide FJ904435_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B27). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDVIKRCEQFVGPLTINEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHNTNLASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNTNKTKRWGYSLHFMGYVIGCWGSLPQDHIIHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLAIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRPLLCLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904438_Pol_P-D Product feature CHAIN FJ904438_Pol_P-D of FT:mat_peptide FJ904438_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSNVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLKLIMPARFYPNCTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPSGSGHNTNLASKSASCLHQSPVRKAAXTAVSTYKRHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCGEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGIHLNTNKTKRWGYSLHFMGYVIGSWGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANVIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLCLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904439_Pol_P-D Product feature CHAIN FJ904439_Pol_P-D of FT:mat_peptide FJ904439_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B34). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLKLIMPARFYPKFTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPSVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRAGVHTTP
RRPFGVEPSGSGHNTNLASKSASCLHQSPVRKAAYSAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPGTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNTNKTKRWGYSLHFMGYVIGSWGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLCLRFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904443_Pol_P-D Product feature CHAIN FJ904443_Pol_P-D of FT:mat_peptide FJ904443_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B46). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIMQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904445_Pol_P-D Product feature CHAIN FJ904445_Pol_P-D of FT:mat_peptide FJ904445_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B62). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGTFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSSSGHTTNLASKSASCFYQSPVRKATYPSVSTFEKHSSSGHAVEFHNLPPNSARSQSEGPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|FJ904446_Pol_P-D Product feature CHAIN FJ904446_Pol_P-D of FT:mat_peptide FJ904446_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B64a). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSTYSWEQELQHGAESFHQQSSGILSRSPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPAKKAAYTSVSTFERHSSSGHAVEHHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPSLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ167301_Pol_P-D Product feature CHAIN GQ167301_Pol_P-D of FT:mat_peptide GQ167301_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM452). Complete genome. [Hepadnaviridae] (length=834 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPCFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRDYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCFYQSPDGKAAYPSVSTFERHSSSGRAVELHNFPTNSARSQSERPESPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSGNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWAWRPP
>gnl|hbvpro|GQ167302_Pol_P-D Product feature CHAIN GQ167302_Pol_P-D of FT:mat_peptide GQ167302_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4521). Complete genome. [Hepadnaviridae] (length=834 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPCFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLVMPARFYPKVTKYLPWDKGIKPYYPEHLVYHYFQTRDYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCFYQSPDGKAAYPSVSTFERHSSSGRAVELHNFPTNSARSQSERPESPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSGNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYTDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWALVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWAWRPP
>gnl|hbvpro|GQ183448_Pol_P-D Product feature CHAIN GQ183448_Pol_P-D of FT:mat_peptide GQ183448_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4629). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGILNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRPYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGPFRALLPIHTEELL
AACFARSRSGANILGTDNSVVLSRNYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183449_Pol_P-D Product feature CHAIN GQ183449_Pol_P-D of FT:mat_peptide GQ183449_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4591). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183450_Pol_P-D Product feature CHAIN GQ183450_Pol_P-D of FT:mat_peptide GQ183450_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4589). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183451_Pol_P-D Product feature CHAIN GQ183451_Pol_P-D of FT:mat_peptide GQ183451_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4588). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183452_Pol_P-D Product feature CHAIN GQ183452_Pol_P-D of FT:mat_peptide GQ183452_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4590). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVHLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183453_Pol_P-D Product feature CHAIN GQ183453_Pol_P-D of FT:mat_peptide GQ183453_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4574). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183454_Pol_P-D Product feature CHAIN GQ183454_Pol_P-D of FT:mat_peptide GQ183454_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4582). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183455_Pol_P-D Product feature CHAIN GQ183455_Pol_P-D of FT:mat_peptide GQ183455_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4573). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183456_Pol_P-D Product feature CHAIN GQ183456_Pol_P-D of FT:mat_peptide GQ183456_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4572). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183457_Pol_P-D Product feature CHAIN GQ183457_Pol_P-D of FT:mat_peptide GQ183457_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4583). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANLLGTDNSVVLSRKYTSFPWLIGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183458_Pol_P-D Product feature CHAIN GQ183458_Pol_P-D of FT:mat_peptide GQ183458_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4587). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKNLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
DTTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183459_Pol_P-D Product feature CHAIN GQ183459_Pol_P-D of FT:mat_peptide GQ183459_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4585). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183460_Pol_P-D Product feature CHAIN GQ183460_Pol_P-D of FT:mat_peptide GQ183460_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4584). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIVQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183461_Pol_P-D Product feature CHAIN GQ183461_Pol_P-D of FT:mat_peptide GQ183461_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4586). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKNLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183462_Pol_P-D Product feature CHAIN GQ183462_Pol_P-D of FT:mat_peptide GQ183462_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4567). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183463_Pol_P-D Product feature CHAIN GQ183463_Pol_P-D of FT:mat_peptide GQ183463_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4613). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
IIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183464_Pol_P-D Product feature CHAIN GQ183464_Pol_P-D of FT:mat_peptide GQ183464_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4703). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183465_Pol_P-D Product feature CHAIN GQ183465_Pol_P-D of FT:mat_peptide GQ183465_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4614). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQRRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183466_Pol_P-D Product feature CHAIN GQ183466_Pol_P-D of FT:mat_peptide GQ183466_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4577). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183467_Pol_P-D Product feature CHAIN GQ183467_Pol_P-D of FT:mat_peptide GQ183467_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4705). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVCAARHHITLPLAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183468_Pol_P-D Product feature CHAIN GQ183468_Pol_P-D of FT:mat_peptide GQ183468_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4632). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHHTKESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183469_Pol_P-D Product feature CHAIN GQ183469_Pol_P-D of FT:mat_peptide GQ183469_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4602). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIVQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183470_Pol_P-D Product feature CHAIN GQ183470_Pol_P-D of FT:mat_peptide GQ183470_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4639). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKATYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLWQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183471_Pol_P-D Product feature CHAIN GQ183471_Pol_P-D of FT:mat_peptide GQ183471_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4610). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLAHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDFCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183472_Pol_P-D Product feature CHAIN GQ183472_Pol_P-D of FT:mat_peptide GQ183472_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4691). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGFQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFSCWWLQFRNS
KPCSDYCLAHIVHLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDNCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183473_Pol_P-D Product feature CHAIN GQ183473_Pol_P-D of FT:mat_peptide GQ183473_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4601). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHLKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLAHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLITAVT
IFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPFHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183474_Pol_P-D Product feature CHAIN GQ183474_Pol_P-D of FT:mat_peptide GQ183474_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4594). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHLKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRSLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVDRPIDWKVCQRIGGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183475_Pol_P-D Product feature CHAIN GQ183475_Pol_P-D of FT:mat_peptide GQ183475_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4575). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEKLPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHLKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRSLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183476_Pol_P-D Product feature CHAIN GQ183476_Pol_P-D of FT:mat_peptide GQ183476_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4603). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHLKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLAHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRSLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADNPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183478_Pol_P-D Product feature CHAIN GQ183478_Pol_P-D of FT:mat_peptide GQ183478_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4605). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKR
ETTHSASFCGSPYTWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHSTNFASKSASCLHQSPVRKAAYPTVSTFEKHSSSGHAVELHYLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHITQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFMAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183479_Pol_P-D Product feature CHAIN GQ183479_Pol_P-D of FT:mat_peptide GQ183479_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4607). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHLKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDASAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRSLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPIYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183481_Pol_P-D Product feature CHAIN GQ183481_Pol_P-D of FT:mat_peptide GQ183481_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4569). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHLKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRSLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183482_Pol_P-D Product feature CHAIN GQ183482_Pol_P-D of FT:mat_peptide GQ183482_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4570). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFAGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHLKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRSLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183483_Pol_P-D Product feature CHAIN GQ183483_Pol_P-D of FT:mat_peptide GQ183483_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4566). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHLKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRSLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ183484_Pol_P-D Product feature CHAIN GQ183484_Pol_P-D of FT:mat_peptide GQ183484_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4598). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGAGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNIPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLTLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQNHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ184322_Pol_P-D Product feature CHAIN GQ184322_Pol_P-D of FT:mat_peptide GQ184322_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4522). Complete genome. [Hepadnaviridae] (length=834 residues).
MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLDRRVAEDLNLGTLNVSIPWTHKVGNFTGLYPSTVPVFNPHWKTPCFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRDYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLATKSASCFYQSPDGKAAYPSVSTFERHSSSGRAVELHNFPTNSARFQSERPESPCWWLQFRNS
KPCSDYCPSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSGNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHITQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWAWRPP
>gnl|hbvpro|GQ205380_Pol_P-D Product feature CHAIN GQ205380_Pol_P-D of FT:mat_peptide GQ205380_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1245). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPAGSGHTTNLASKSASCSYQSPVRKAAYPSVSTSERHSSSGHAVDLHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPPYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ205382_Pol_P-D Product feature CHAIN GQ205382_Pol_P-D of FT:mat_peptide GQ205382_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1360d). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARAHPTA
RRPFGVEPAGSGHTTNLASKSASCSYQSPVRKAAYPTVSTSERHSSSGHAVDIHNLPPSSARSQSERPVLPCWWLNFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSSLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLPFRPTTG
RTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ205384_Pol_P-D Product feature CHAIN GQ205384_Pol_P-D of FT:mat_peptide GQ205384_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1434d). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDGEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQPSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPAGSGHTTNLASKSASCSYQSPVRKAAYPTVSTSERHSSSGHAVDLHNLPPSSARSQSERPVFPCWWLNFRNS
KPCSDSCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSGLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ205385_Pol_P-D Product feature CHAIN GQ205385_Pol_P-D of FT:mat_peptide GQ205385_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1469). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPAGSGHTTNLASKSASCSYQSPVRKAAYPTVSTSERHSSSGHAVDLHNLPPSSARSQSERPVFPCWWLNFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNFRIFDHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPPYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ205388_Pol_P-D Product feature CHAIN GQ205388_Pol_P-D of FT:mat_peptide GQ205388_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1562). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCGQFVGPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPAGSGHTTNLASKSASCSYQSPVRKAAYPTVSTSERHSSSGHAVDLHNLPPSSARSQSERPVFPCWWLNFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPPYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGASFVYVPSALNPADDPSRGRLGLCRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ205389_Pol_P-D Product feature CHAIN GQ205389_Pol_P-D of FT:mat_peptide GQ205389_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1667). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPLGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPPGSGHTTNLASKSASCSYQSPVRKAAYPTVSTSERHSSSGHAVELHNLPPSSARSQSERPVFPCWWLNFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPPYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ377589_Pol_P-D Product feature CHAIN GQ377589_Pol_P-D of FT:mat_peptide GQ377589_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate J145). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSTSCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477452_Pol_P-D Product feature CHAIN GQ477452_Pol_P-D of FT:mat_peptide GQ477452_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCLYQSPVRKAAYPAVSTFERHSSSGHAVEFHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477453_Pol_P-D Product feature CHAIN GQ477453_Pol_P-D of FT:mat_peptide GQ477453_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P39). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLGTPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRSPVGSSLQSKHSKSRLGLQSQQGYLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCFYQSTVRKAAYPAVSTFEKHSSSSHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFHHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIVLGFRKIPMGMGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGHSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477455_Pol_P-D Product feature CHAIN GQ477455_Pol_P-D of FT:mat_peptide GQ477455_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P73). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=831 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHNTNLASKSASCFYQSPVRKAAYPADSTFGRHSSSGPVEVHNFPPNSARSQGERPVFPCWWLQFRNSK
PCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPNL
QSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLML
LYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVTN
FLLSLGIHLNPHKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYP
ALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELLA
ACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVFRPLLRLPFRPTTGR
TSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477456_Pol_P-D Product feature CHAIN GQ477456_Pol_P-D of FT:mat_peptide GQ477456_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P84). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADQDLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLRQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFYGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNRASKSASCLYQSPVRKATHPAVSTFEKHSSSGHAVELHNLPPNSARSQGEGPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477457_Pol_P-D Product feature CHAIN GQ477457_Pol_P-D of FT:mat_peptide GQ477457_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P118). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCFYQSPVRKAAYPAVSTFEKHSSSGHAVELHNFPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477458_Pol_P-D Product feature CHAIN GQ477458_Pol_P-D of FT:mat_peptide GQ477458_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P126). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKTAYPSNSTFETHSSPGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAENGEHHIRIPRTPARVTGGVFLVDKNHQNTAESRLVVDFSQFSRGNNRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFSQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ477459_Pol_P-D Product feature CHAIN GQ477459_Pol_P-D of FT:mat_peptide GQ477459_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P127). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRGWSLRAGIHPTA
RRPFRVEPSGSGHTTNLARKSASCLYQSPVREAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRHLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKFTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ922000_Pol_P-D Product feature CHAIN GQ922000_Pol_P-D of FT:mat_peptide GQ922000_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3552). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNPNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFP
HIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQDLHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARSQQGRSWSIRAGFHPTT
RRPFGVEPSGSGHTTNFASKSASCLHQSPIRKAADSTVSTFERHSSSSHAVELHNLPPNSARSQSEGPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPXRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GQ922001_Pol_P-D Product feature CHAIN GQ922001_Pol_P-D of FT:mat_peptide GQ922001_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3654). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPCFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQDLHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCFDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ922002_Pol_P-D Product feature CHAIN GQ922002_Pol_P-D of FT:mat_peptide GQ922002_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3624). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKEGNFTGLYSSTVPVFNPHWKTPCFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQDLHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPTVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLALSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ922003_Pol_P-D Product feature CHAIN GQ922003_Pol_P-D of FT:mat_peptide GQ922003_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3225). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
VSTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPSGSRHNTNFASKSASCLYRSPVRTAAYPAVSTSESHLSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSGIINHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLNFMGYVIGCWGSLPQDHIIHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLDPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWXPP
>gnl|hbvpro|GQ922004_Pol_P-D Product feature CHAIN GQ922004_Pol_P-D of FT:mat_peptide GQ922004_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3284). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
VSTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPSGSGHNTNFASKSASCLNQSTVRTAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCCGXXXXXX
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVNKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTLQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLNFMGYVIGCWGSLPQDHIIHKIKECFRKLPXXXXIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWDLVMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ922005_Pol_P-D Product feature CHAIN GQ922005_Pol_P-D of FT:mat_peptide GQ922005_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B2894). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLNVNIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
VSTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPSGSGHNTNFASKSASCLYQSPVRTAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDHQHGTLQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLNFMGYVIGCWGSLPQDHIIHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GQ924652_Pol_P-D Product feature CHAIN GQ924652_Pol_P-D of FT:mat_peptide GQ924652_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M89). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKYRKSRLGLQSQQGPLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASCIYQSPVGKAAYPAVSTFEKHSSTGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU357846_Pol_P-D Product feature CHAIN GU357846_Pol_P-D of FT:mat_peptide GU357846_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y10). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSRSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEEHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLRPAAMPHLLVGSSGLSRYLARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPFHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456635_Pol_P-D Product feature CHAIN GU456635_Pol_P-D of FT:mat_peptide GU456635_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T26). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETSHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHHKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGLTTNLTSKSASCIYQSPVRKAAYPAVSTFEKHASSGHAVELHNLPPNSARSQSEKPLSSCWWLQFRNS
NPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHILQKIRDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFWAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456636_Pol_P-D Product feature CHAIN GU456636_Pol_P-D of FT:mat_peptide GU456636_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T7). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYQR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHTTNHASKSTSCLYQSPVRQAAYPAVSTFERHSSSGYAVEHHNFPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPDKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKACFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456637_Pol_P-D Product feature CHAIN GU456637_Pol_P-D of FT:mat_peptide GU456637_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T49). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSCQHFRRLVLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWQTPSFP
NIHLHQDIIKKCERFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIWSGIHPTA
RRPFGVEPSGSGHTTNSASKSTSCLYQSTVRTAAYPAVSTFEKHSSPGHAVELHNIPPNSARSQSGRPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESKLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVHHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIHAKQAFTFSPTYKAFLRNQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456638_Pol_P-D Product feature CHAIN GU456638_Pol_P-D of FT:mat_peptide GU456638_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T35). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNVSVPWTHKVGNLTGLYSSTVPVFNPNWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGMEPSGSGHTTNLASKSASCLYQSPVRQAAYPTVSTLEKHSSSGHAVELHNLPPNSARSQSEGPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPTRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGMGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVTWRPP
>gnl|hbvpro|GU456639_Pol_P-D Product feature CHAIN GU456639_Pol_P-D of FT:mat_peptide GU456639_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T129). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPIEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRSFGVEPSGSGHTTNLASKSASCLYQSPVRQAAYPAVSTFEKHTSPGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSELHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU456640_Pol_P-D Product feature CHAIN GU456640_Pol_P-D of FT:mat_peptide GU456640_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPIGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGMEPSGSGHTANLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU456641_Pol_P-D Product feature CHAIN GU456641_Pol_P-D of FT:mat_peptide GU456641_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T53). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHITNLASKSASCLYQSPVRKAAYPAVSTFEKHTSSGHAVELHNLQPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLQSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456643_Pol_P-D Product feature CHAIN GU456643_Pol_P-D of FT:mat_peptide GU456643_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T52). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDLIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSIQSKHSESRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCQYQSPVRKAAYPADSTFKRHSSSGHAVELHNLSSNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPGTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCFGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLIRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456645_Pol_P-D Product feature CHAIN GU456645_Pol_P-D of FT:mat_peptide GU456645_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T80). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESLHQQSAGILSRPSVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHTANLASKSASCLYQSPVRKTAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNDQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456646_Pol_P-D Product feature CHAIN GU456646_Pol_P-D of FT:mat_peptide GU456646_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T77). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHTANLASKSASCLYQSPVRKAAYPAVSTFEKHSSSSHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGGYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456647_Pol_P-D Product feature CHAIN GU456647_Pol_P-D of FT:mat_peptide GU456647_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T130). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDVNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHTANLASKSASCLYQSPVREAAYPAVSTSEKHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456648_Pol_P-D Product feature CHAIN GU456648_Pol_P-D of FT:mat_peptide GU456648_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T85). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGMEPSGSGHTTNLASKSASCLXQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456649_Pol_P-D Product feature CHAIN GU456649_Pol_P-D of FT:mat_peptide GU456649_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T57). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHLKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGPGHTTNLASKSASCLYQSPVRKAVYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFFRGNPRVSWPKFAVPN
FQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456650_Pol_P-D Product feature CHAIN GU456650_Pol_P-D of FT:mat_peptide GU456650_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T62). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRSPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNAEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456651_Pol_P-D Product feature CHAIN GU456651_Pol_P-D of FT:mat_peptide GU456651_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T34). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLHVSIPWTHKVGNFTGLYSSTVPVFNPNWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLILPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGTPYSWEQELHHGAESFHQQSSGILSRSPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHITNLASKSASCLYQPPVRKAADPAVSTFEKHSSSSDAVEFHNIPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGEHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIAGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKLTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU456652_Pol_P-D Product feature CHAIN GU456652_Pol_P-D of FT:mat_peptide GU456652_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T44). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESIFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIRECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLRTQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456653_Pol_P-D Product feature CHAIN GU456653_Pol_P-D of FT:mat_peptide GU456653_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T59). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPRWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456654_Pol_P-D Product feature CHAIN GU456654_Pol_P-D of FT:mat_peptide GU456654_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T39). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTPNVSIPCTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLNLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWQAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASCRYQSPVRKAAYPSVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLMSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456655_Pol_P-D Product feature CHAIN GU456655_Pol_P-D of FT:mat_peptide GU456655_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T95). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPNWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCFYQSPVRKAAYSSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQGFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456656_Pol_P-D Product feature CHAIN GU456656_Pol_P-D of FT:mat_peptide GU456656_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T9). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDESGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESLHQQSSGILSRPSVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRARIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVKQAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHISQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU456657_Pol_P-D Product feature CHAIN GU456657_Pol_P-D of FT:mat_peptide GU456657_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T83). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKPPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYFPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLPSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAHPSVSTFERHSSSGHAVELHNLPPNFARSQSERPVFPCWWLQFRNS
KPCSDYCISHIVTLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456658_Pol_P-D Product feature CHAIN GU456658_Pol_P-D of FT:mat_peptide GU456658_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T114). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRSGSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTAEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456659_Pol_P-D Product feature CHAIN GU456659_Pol_P-D of FT:mat_peptide GU456659_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T24). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRSPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPVGVEPSGSGHTTNLANESASCLYQSPVRKAAYPSVSTFERHSSSGHAVELHNLPPNSARSKSERPVFPCWWLQFRNS
KPCSDYCLTHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLRKQYLDLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456660_Pol_P-D Product feature CHAIN GU456660_Pol_P-D of FT:mat_peptide GU456660_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T64). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKPPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTANLANKSASCLNQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLTHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456661_Pol_P-D Product feature CHAIN GU456661_Pol_P-D of FT:mat_peptide GU456661_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T99). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHSTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKATYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPIFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLYKQYLNLYPVARQRQGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456662_Pol_P-D Product feature CHAIN GU456662_Pol_P-D of FT:mat_peptide GU456662_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T23). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=827 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHASSGHAVELHNLQPNSARSQSPCWWLQFRNSKPCSD
YCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPNLQSLT
NLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLLLLYQT
FGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNFLLS
LGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMP
LYACIQSKQAFTFSPTYKAFLCNQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELLAACFA
RSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRTSLY
ADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456663_Pol_P-D Product feature CHAIN GU456663_Pol_P-D of FT:mat_peptide GU456663_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T86). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNASIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASYLYQSPDRKAAYPSVSTFEKHSSSGHAVELYNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADPTPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456664_Pol_P-D Product feature CHAIN GU456664_Pol_P-D of FT:mat_peptide GU456664_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T40). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSSVRKAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456665_Pol_P-D Product feature CHAIN GU456665_Pol_P-D of FT:mat_peptide GU456665_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T76). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQARHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSRHTTNLANKSASCLYQSPVRKAAYSTVSTSERHSSSGYAVDFHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPGRVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTGAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTRRWGYSLQFMGYVIGGYGSLPQDHIRQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456666_Pol_P-D Product feature CHAIN GU456666_Pol_P-D of FT:mat_peptide GU456666_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYQR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYSSVSTFERHSSSGHAVELHHLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKQCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456667_Pol_P-D Product feature CHAIN GU456667_Pol_P-D of FT:mat_peptide GU456667_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T120). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSVPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKTAYPSVSTFEKLSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSGIFNHQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLMSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456668_Pol_P-D Product feature CHAIN GU456668_Pol_P-D of FT:mat_peptide GU456668_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T21). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYRHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLPSKHCKSRLGLQSQQGHMARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCIYQSPVREAAYPSVSTFEKYSSSSHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456669_Pol_P-D Product feature CHAIN GU456669_Pol_P-D of FT:mat_peptide GU456669_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T94). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDPDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLEKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTANLANKSASCLYQSSVRKAAYSSVSTFEKHSSSSNAVELHNLPPNPARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTVESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLDPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456670_Pol_P-D Product feature CHAIN GU456670_Pol_P-D of FT:mat_peptide GU456670_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T27). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYQR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHTTA
RRPFGMEPSGSGHTTNLANKSASCLHQSPVREAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTQRWGYSLHFMGYVIGGYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|GU456671_Pol_P-D Product feature CHAIN GU456671_Pol_P-D of FT:mat_peptide GU456671_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T56). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLANKSASCFYQSPVRKTAYPSVFTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456673_Pol_P-D Product feature CHAIN GU456673_Pol_P-D of FT:mat_peptide GU456673_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T75). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFTAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLYVAWRPP
>gnl|hbvpro|GU456674_Pol_P-D Product feature CHAIN GU456674_Pol_P-D of FT:mat_peptide GU456674_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T16). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEDELPRLADEDLNRRIAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELPHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRSFGVEPSGSGHTSNLANKSASCLYQSPVRQAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCITHIVNLLEDWGPCAEHGEHHIRIPRTPTRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARMSSNSRIFNNQHGTMQNLHDSCSRNLYVSLM
LLYKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPTKTKRWGYSLHFMGYVIGGYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456675_Pol_P-D Product feature CHAIN GU456675_Pol_P-D of FT:mat_peptide GU456675_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T13). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQETQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPAGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDHCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSGYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFTAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456676_Pol_P-D Product feature CHAIN GU456676_Pol_P-D of FT:mat_peptide GU456676_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T98). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=830 residues).
MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTTNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSGSIRTGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSDSTFEKHPSSGHAVELHNLPPNSARSRSERPPCWWLQFRNSKP
CSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPNLQ
SLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLLLL
YKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNF
LLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPA
LMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELLAA
CFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRT
SLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456677_Pol_P-D Product feature CHAIN GU456677_Pol_P-D of FT:mat_peptide GU456677_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T46). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPENLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTILASKSASCLYQSPVRKAAHPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCISHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSQTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGASILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVEWRPP
>gnl|hbvpro|GU456678_Pol_P-D Product feature CHAIN GU456678_Pol_P-D of FT:mat_peptide GU456678_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T97). Complete genome. [Hepadnaviridae] (length=834 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPTFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRETAYPSVSTFEKHSSSSHAVELHKLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNCSQRVFDHQHGTVQNLHDSCSRNLYVS
LLLLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTA
VTNFLLSLGIHLNPDKTKRWGYSLHFMGYVIGSYGSLPQDHITQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQC
GYPALKPLYACIQAKQAFTFSATYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAE
LLAACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFIYVPSALNPADDPSRGRLGLSRPLLRLPFRPT
TGRTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456679_Pol_P-D Product feature CHAIN GU456679_Pol_P-D of FT:mat_peptide GU456679_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T63). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEQVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHMARRQQGRSGSIRAGIHTTS
RRPFGVEPSGSRHTTNLANESASCLYQSPVRKAAHSSVSTFEKHSSSGHAVELHNLPPNSARSQSEGPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVEWRPP
>gnl|hbvpro|GU456680_Pol_P-D Product feature CHAIN GU456680_Pol_P-D of FT:mat_peptide GU456680_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T88). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELNNLPPSSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFKKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPSLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456681_Pol_P-D Product feature CHAIN GU456681_Pol_P-D of FT:mat_peptide GU456681_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T79). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLANKSASGLYQSPVRKAADPSVSTVEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDHCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFFRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456682_Pol_P-D Product feature CHAIN GU456682_Pol_P-D of FT:mat_peptide GU456682_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T42). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFAGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQPQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHTTNLASKSASCFYQSPVRKAAYPSVSTFEKHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRVFPHCLAFSYMDDVVLGAKSVSHLQSLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456683_Pol_P-D Product feature CHAIN GU456683_Pol_P-D of FT:mat_peptide GU456683_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T101). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSVRTGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAANPSVSTFEKHSSSSHAVELNNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|GU456684_Pol_P-D Product feature CHAIN GU456684_Pol_P-D of FT:mat_peptide GU456684_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T60). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPYWKTPSFP
NIHLHQDIIKKCEQLVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGIPSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSRSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRTAAYSSVSTVEKHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHKHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGANSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM750151_Pol_P-D Product feature CHAIN HM750151_Pol_P-D of FT:mat_peptide HM750151_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSD-8). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPVGVEPSGSGHITNFASKSASCLHQSPVRKAAYPTVSTFEKHSSSGHAVELHKLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM750152_Pol_P-D Product feature CHAIN HM750152_Pol_P-D of FT:mat_peptide HM750152_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate QHN-99). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEKELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
TIHLHQDIIKKCEQFVGPLTANEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTQRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM750153_Pol_P-D Product feature CHAIN HM750153_Pol_P-D of FT:mat_peptide HM750153_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJW-12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
SIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLGKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQSSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKPPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM750154_Pol_P-D Product feature CHAIN HM750154_Pol_P-D of FT:mat_peptide HM750154_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XGW-23). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRRWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVSGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM750155_Pol_P-D Product feature CHAIN HM750155_Pol_P-D of FT:mat_peptide HM750155_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGSLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTQRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQTFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HM750156_Pol_P-D Product feature CHAIN HM750156_Pol_P-D of FT:mat_peptide HM750156_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGSLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTQRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFPPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ236014_Pol_P-D Product feature CHAIN HQ236014_Pol_P-D of FT:mat_peptide HQ236014_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHTTNFANKSASCIHQSPVRKAAYPAVSTFEKHSSSGHAVELHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAEPRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVLKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANVIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ236015_Pol_P-D Product feature CHAIN HQ236015_Pol_P-D of FT:mat_peptide HQ236015_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHHKSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHTTHFANKSASCIHQSPVRKAAYPAVSTFEKHASSGHAVELHHHSPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAEPRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVLKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ236016_Pol_P-D Product feature CHAIN HQ236016_Pol_P-D of FT:mat_peptide HQ236016_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS3). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHTTHFANKSASCIHQSPVRKAAYPAVSTFEKHASSGHAVELHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVLKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRLRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700440_Pol_P-D Product feature CHAIN HQ700440_Pol_P-D of FT:mat_peptide HQ700440_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AD05_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKXFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700441_Pol_P-D Product feature CHAIN HQ700441_Pol_P-D of FT:mat_peptide HQ700441_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN10_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700442_Pol_P-D Product feature CHAIN HQ700442_Pol_P-D of FT:mat_peptide HQ700442_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSTSCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700443_Pol_P-D Product feature CHAIN HQ700443_Pol_P-D of FT:mat_peptide HQ700443_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1999). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSTSCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700444_Pol_P-D Product feature CHAIN HQ700444_Pol_P-D of FT:mat_peptide HQ700444_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN19_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQKGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVEFHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700445_Pol_P-D Product feature CHAIN HQ700445_Pol_P-D of FT:mat_peptide HQ700445_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPSNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700446_Pol_P-D Product feature CHAIN HQ700446_Pol_P-D of FT:mat_peptide HQ700446_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1999). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPSNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700447_Pol_P-D Product feature CHAIN HQ700447_Pol_P-D of FT:mat_peptide HQ700447_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700448_Pol_P-D Product feature CHAIN HQ700448_Pol_P-D of FT:mat_peptide HQ700448_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1999). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700449_Pol_P-D Product feature CHAIN HQ700449_Pol_P-D of FT:mat_peptide HQ700449_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE06_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSTSCLYQSPVRKAAYPSVSTFEKHSSSGHAVELXNLPPNXARSQSEXPVFXCWWLQFRNX
KPCSDYCLSHIVNLLEDWGPCXEHGEHXIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGXYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700450_Pol_P-D Product feature CHAIN HQ700450_Pol_P-D of FT:mat_peptide HQ700450_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE09_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSTSCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700451_Pol_P-D Product feature CHAIN HQ700451_Pol_P-D of FT:mat_peptide HQ700451_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GI11_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSTSCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700454_Pol_P-D Product feature CHAIN HQ700454_Pol_P-D of FT:mat_peptide HQ700454_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHXKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700455_Pol_P-D Product feature CHAIN HQ700455_Pol_P-D of FT:mat_peptide HQ700455_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1999). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLAXEGXNXRVAKDXNXGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLXSLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALXPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700458_Pol_P-D Product feature CHAIN HQ700458_Pol_P-D of FT:mat_peptide HQ700458_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE35_1997). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPKFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
VSTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQQSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPSGSGHNTNLASTSASCFYQSPVRTTAYPAVSTSEDHSSSGHAVELHNLPSNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIIDHKHGTLQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGATSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGSLPQDHIIHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPYRPLLCLPFRPTTG
RTSLYADSPSVPSXLPVRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700459_Pol_P-D Product feature CHAIN HQ700459_Pol_P-D of FT:mat_peptide HQ700459_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE55_1993). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700463_Pol_P-D Product feature CHAIN HQ700463_Pol_P-D of FT:mat_peptide HQ700463_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HI43_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQKGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHASSGHAMERHNLPPNAARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700464_Pol_P-D Product feature CHAIN HQ700464_Pol_P-D of FT:mat_peptide HQ700464_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_KA40_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700466_Pol_P-D Product feature CHAIN HQ700466_Pol_P-D of FT:mat_peptide HQ700466_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQKGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700469_Pol_P-D Product feature CHAIN HQ700469_Pol_P-D of FT:mat_peptide HQ700469_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKYSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700470_Pol_P-D Product feature CHAIN HQ700470_Pol_P-D of FT:mat_peptide HQ700470_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1999). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKYSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700471_Pol_P-D Product feature CHAIN HQ700471_Pol_P-D of FT:mat_peptide HQ700471_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO70_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNVASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700472_Pol_P-D Product feature CHAIN HQ700472_Pol_P-D of FT:mat_peptide HQ700472_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO77_1997). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTVNIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSGLGLQSPQGHLARRQQGRSWSIRAGIHPTT
RRPSGVEPSGSGHTTNFASKSTSCLYQSPVRKAAYPSVSAFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGGFGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700473_Pol_P-D Product feature CHAIN HQ700473_Pol_P-D of FT:mat_peptide HQ700473_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGXLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHXIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700474_Pol_P-D Product feature CHAIN HQ700474_Pol_P-D of FT:mat_peptide HQ700474_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1999). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYHHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700477_Pol_P-D Product feature CHAIN HQ700477_Pol_P-D of FT:mat_peptide HQ700477_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1984). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKXVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700478_Pol_P-D Product feature CHAIN HQ700478_Pol_P-D of FT:mat_peptide HQ700478_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1994). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSKQLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700479_Pol_P-D Product feature CHAIN HQ700479_Pol_P-D of FT:mat_peptide HQ700479_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA11_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700480_Pol_P-D Product feature CHAIN HQ700480_Pol_P-D of FT:mat_peptide HQ700480_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSISTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYXDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700481_Pol_P-D Product feature CHAIN HQ700481_Pol_P-D of FT:mat_peptide HQ700481_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1999). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSISTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEXLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700482_Pol_P-D Product feature CHAIN HQ700482_Pol_P-D of FT:mat_peptide HQ700482_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA40_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700483_Pol_P-D Product feature CHAIN HQ700483_Pol_P-D of FT:mat_peptide HQ700483_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA120_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPIFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKXVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGLLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700484_Pol_P-D Product feature CHAIN HQ700484_Pol_P-D of FT:mat_peptide HQ700484_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA229_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700487_Pol_P-D Product feature CHAIN HQ700487_Pol_P-D of FT:mat_peptide HQ700487_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TU25_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSTSCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRLRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700488_Pol_P-D Product feature CHAIN HQ700488_Pol_P-D of FT:mat_peptide HQ700488_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1984). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700510_Pol_P-D Product feature CHAIN HQ700510_Pol_P-D of FT:mat_peptide HQ700510_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_128225_2003). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRXPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRSFGVEPSGSGHNTNLASKSASCIYQSPDRKAAYTAVSTFEKHASSGHAVEFHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700511_Pol_P-D Product feature CHAIN HQ700511_Pol_P-D of FT:mat_peptide HQ700511_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_164317_2001). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKKAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRLRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700512_Pol_P-D Product feature CHAIN HQ700512_Pol_P-D of FT:mat_peptide HQ700512_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_182089_2001). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRSFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700513_Pol_P-D Product feature CHAIN HQ700513_Pol_P-D of FT:mat_peptide HQ700513_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_16600_2001). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRSFGVEPSRSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700514_Pol_P-D Product feature CHAIN HQ700514_Pol_P-D of FT:mat_peptide HQ700514_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_1664337_2001). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRSFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ700553_Pol_P-D Product feature CHAIN HQ700553_Pol_P-D of FT:mat_peptide HQ700553_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1999). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNFASKSXSCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNAARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSKQLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ833465_Pol_P-D Product feature CHAIN HQ833465_Pol_P-D of FT:mat_peptide HQ833465_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLNQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGQTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDYCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQAHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ833467_Pol_P-D Product feature CHAIN HQ833467_Pol_P-D of FT:mat_peptide HQ833467_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB27). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKATYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ833468_Pol_P-D Product feature CHAIN HQ833468_Pol_P-D of FT:mat_peptide HQ833468_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB52). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYKTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFHAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ833469_Pol_P-D Product feature CHAIN HQ833469_Pol_P-D of FT:mat_peptide HQ833469_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB79). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGXHPTA
RRPFGVEPSGSGQTTNLANKSASCLHQSPVRKAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSQRPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALLPLYACVQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|HQ833470_Pol_P-D Product feature CHAIN HQ833470_Pol_P-D of FT:mat_peptide HQ833470_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB80). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPXVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSQRPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALLPLYACVQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|HQ833471_Pol_P-D Product feature CHAIN HQ833471_Pol_P-D of FT:mat_peptide HQ833471_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB97). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRXQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTLGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439692_Pol_P-D Product feature CHAIN JF439692_Pol_P-D of FT:mat_peptide JF439692_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN132). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGRAVEFHNLPPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439693_Pol_P-D Product feature CHAIN JF439693_Pol_P-D of FT:mat_peptide JF439693_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN133). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQEHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVKFHNLLPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKDCFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439694_Pol_P-D Product feature CHAIN JF439694_Pol_P-D of FT:mat_peptide JF439694_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN134). Partial genome (Contains: HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVKFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439695_Pol_P-D Product feature CHAIN JF439695_Pol_P-D of FT:mat_peptide JF439695_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN135). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQEHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVKFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKDCFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439696_Pol_P-D Product feature CHAIN JF439696_Pol_P-D of FT:mat_peptide JF439696_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWERDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGRAVEFHNLPPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCFEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNSSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYAARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439699_Pol_P-D Product feature CHAIN JF439699_Pol_P-D of FT:mat_peptide JF439699_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSREQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNPSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWLLRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439700_Pol_P-D Product feature CHAIN JF439700_Pol_P-D of FT:mat_peptide JF439700_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN143). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLPYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWLLRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439701_Pol_P-D Product feature CHAIN JF439701_Pol_P-D of FT:mat_peptide JF439701_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN144). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLPYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWLLRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439702_Pol_P-D Product feature CHAIN JF439702_Pol_P-D of FT:mat_peptide JF439702_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN145). Partial genome (Contains: HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYLEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQEHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVKFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFPVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439703_Pol_P-D Product feature CHAIN JF439703_Pol_P-D of FT:mat_peptide JF439703_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN146). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGRAVEFHNLPPNSARSQSEGPVFPCWWLQFRSS
KPCSDCCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPRNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYAARSSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKDCFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439704_Pol_P-D Product feature CHAIN JF439704_Pol_P-D of FT:mat_peptide JF439704_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN149). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLPYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
GTTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439705_Pol_P-D Product feature CHAIN JF439705_Pol_P-D of FT:mat_peptide JF439705_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN150). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLPYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
GTTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439706_Pol_P-D Product feature CHAIN JF439706_Pol_P-D of FT:mat_peptide JF439706_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVFTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPGTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVVGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439707_Pol_P-D Product feature CHAIN JF439707_Pol_P-D of FT:mat_peptide JF439707_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN153). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQAHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVKFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439708_Pol_P-D Product feature CHAIN JF439708_Pol_P-D of FT:mat_peptide JF439708_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN154). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLDIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPSYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439709_Pol_P-D Product feature CHAIN JF439709_Pol_P-D of FT:mat_peptide JF439709_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN155). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRVVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439710_Pol_P-D Product feature CHAIN JF439710_Pol_P-D of FT:mat_peptide JF439710_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDRGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439711_Pol_P-D Product feature CHAIN JF439711_Pol_P-D of FT:mat_peptide JF439711_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN157). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVFTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPGTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVVGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439712_Pol_P-D Product feature CHAIN JF439712_Pol_P-D of FT:mat_peptide JF439712_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN158). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQEHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCPHQSPDRKAAYPAVSTFEKHSSSGHAVKFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439713_Pol_P-D Product feature CHAIN JF439713_Pol_P-D of FT:mat_peptide JF439713_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN159). Partial genome (Contains: HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPFYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVVPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLYSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSPM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLVFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439716_Pol_P-D Product feature CHAIN JF439716_Pol_P-D of FT:mat_peptide JF439716_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN164). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQEHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVKFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439717_Pol_P-D Product feature CHAIN JF439717_Pol_P-D of FT:mat_peptide JF439717_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN166). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRNWSIRAGFHPTA
RKPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVKFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQYGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIRHKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439718_Pol_P-D Product feature CHAIN JF439718_Pol_P-D of FT:mat_peptide JF439718_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN167). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGHYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALTPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF439719_Pol_P-D Product feature CHAIN JF439719_Pol_P-D of FT:mat_peptide JF439719_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN172). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVKFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCSEHGEHHIRTPKTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLPSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYHLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754588_Pol_P-D Product feature CHAIN JF754588_Pol_P-D of FT:mat_peptide JF754588_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK61). Complete genome. [Hepadnaviridae] (length=834 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRSPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSGSIRAGIHPTA
RRPFGVEPSGSGRTTNLASKSASCFYQSSVRKAAYSSVSAFEKHSSSGYAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVYWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSNDSRIFNHQHGTMQNLHDPCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWAWRPP
>gnl|hbvpro|JF754590_Pol_P-D Product feature CHAIN JF754590_Pol_P-D of FT:mat_peptide JF754590_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK41). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASGLYQSPVRKATYPSVSTFEKHSSSGHAVELHNLPPNSARPQSEGPVFPCWWLQFRNS
KPCSDHCLSYIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYTIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754591_Pol_P-D Product feature CHAIN JF754591_Pol_P-D of FT:mat_peptide JF754591_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK38). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNSHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCTRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVHRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754592_Pol_P-D Product feature CHAIN JF754592_Pol_P-D of FT:mat_peptide JF754592_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK64). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPNWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYQR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHTPNLASKSASCFYQSPVRKAAYPSVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCISHIVNLLEDWGPCAEHGEHHIRILRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLPDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKRAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWQPP
>gnl|hbvpro|JF754593_Pol_P-D Product feature CHAIN JF754593_Pol_P-D of FT:mat_peptide JF754593_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK170). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSVPWTHKVGTFTGLYSSTVPVFNPHGKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLCQSPVRKAAYPSVSTTEKHSSSGHAVELHNLPSNSPRSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQLTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLYKQYMHLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
HTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754594_Pol_P-D Product feature CHAIN JF754594_Pol_P-D of FT:mat_peptide JF754594_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK165). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPHYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSSSGHTTNLASKSASCLYQSPVRKAADPSVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF754595_Pol_P-D Product feature CHAIN JF754595_Pol_P-D of FT:mat_peptide JF754595_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK164). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNXRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRTGANILGTDNSVVLSRKFTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754596_Pol_P-D Product feature CHAIN JF754596_Pol_P-D of FT:mat_peptide JF754596_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK106). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHPSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754597_Pol_P-D Product feature CHAIN JF754597_Pol_P-D of FT:mat_peptide JF754597_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK105). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFFPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVESSGSGHNTKLASESASCIYQSPVRKAAYPAVSTFEKHSSSGHAVEFHNVPSNSARSQGERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSTGLSGYVARVSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGIFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF754598_Pol_P-D Product feature CHAIN JF754598_Pol_P-D of FT:mat_peptide JF754598_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK104). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSSSGHTTNLASKSASGLYQSPVRKAADPSVSTFERHSSSGHAVEFHNLPPNSARSQSERPVSTCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLDSLFTAVT
NFLLSLGIQLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754599_Pol_P-D Product feature CHAIN JF754599_Pol_P-D of FT:mat_peptide JF754599_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK173). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNSRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDYCSRNLYVSIL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754600_Pol_P-D Product feature CHAIN JF754600_Pol_P-D of FT:mat_peptide JF754600_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK91). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCKQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSSIRKAAYPPVSTFEKHSSSGHAVEFHNFPPNSARSQSEGPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPXRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTQRWGYSLHFMGYVIGGYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754601_Pol_P-D Product feature CHAIN JF754601_Pol_P-D of FT:mat_peptide JF754601_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK88). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRKAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754602_Pol_P-D Product feature CHAIN JF754602_Pol_P-D of FT:mat_peptide JF754602_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK83). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDHEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPCTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSQYSWEQKLQHGAESFHQQSSGILSRSPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGMEPSGSGHTTNLASKSTSCLYQSPVRTAAYPAVSTFEKHSSSGHTVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPNRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754603_Pol_P-D Product feature CHAIN JF754603_Pol_P-D of FT:mat_peptide JF754603_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK8). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHKQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRSWSIRAGIHPSA
RRPFRMEPSGSGHTTNPASKSASCLYQSPVRKAAYPAVSTFEKHSSSGPAVELHNLPQHSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNNQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754604_Pol_P-D Product feature CHAIN JF754604_Pol_P-D of FT:mat_peptide JF754604_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK79). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDRGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTSEKHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754606_Pol_P-D Product feature CHAIN JF754606_Pol_P-D of FT:mat_peptide JF754606_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK73). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=830 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPYWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGFQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFERHASSGHAVELHNLPPNSARSQSERPPCWWLQFRNSKP
CSDYCLSHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNDRVSWPKFAVPNLQ
SLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLLLL
YQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNF
LLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPA
LKPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELLAA
CFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRT
SLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754607_Pol_P-D Product feature CHAIN JF754607_Pol_P-D of FT:mat_peptide JF754607_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK67). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQLVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPENIVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRKQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCFYQSPVRKTAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPTRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JF754609_Pol_P-D Product feature CHAIN JF754609_Pol_P-D of FT:mat_peptide JF754609_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK45). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYQR
ETTHSASFCGLPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGFQSQQGHLARRQQGRSWSIRAGIHTTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYSSVSTFERHSSSSHAVELHNLPSNSARSQSERPVFPCWWLQFRNS
QPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLDSLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754610_Pol_P-D Product feature CHAIN JF754610_Pol_P-D of FT:mat_peptide JF754610_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK157). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQARDYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRSFGVEPSGSRHTTNLASKSASCLYQSSVRKAAYPAVSTFEKHPSSGHAVELHNLPPNSARSRSERPASHCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754611_Pol_P-D Product feature CHAIN JF754611_Pol_P-D of FT:mat_peptide JF754611_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK152). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPCFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLSQSQDKQAAYPAVSTFERHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGXHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSXYVARLSSNSRIFDYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRSFPHCMAFSYMDDVVLGAKSAXHLESLVTAVT
NFLLSLGIHLNPXKTKRWGHSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754612_Pol_P-D Product feature CHAIN JF754612_Pol_P-D of FT:mat_peptide JF754612_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK148). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNRRVADDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNSHWKTPSFP
NIHLHEDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPKATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYRR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNFANKSASCFYQSPVGKAAYPSVSTFERHPSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754614_Pol_P-D Product feature CHAIN JF754614_Pol_P-D of FT:mat_peptide JF754614_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHTTA
RRPFGVEPSGSGHNANLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754615_Pol_P-D Product feature CHAIN JF754615_Pol_P-D of FT:mat_peptide JF754615_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK141). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGMEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSGRPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754617_Pol_P-D Product feature CHAIN JF754617_Pol_P-D of FT:mat_peptide JF754617_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK131). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIQKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQRHLARRQQGRSWSIRDGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSAFEGHPSSGYAVEHHKLPSNSARSQSERPIFPCWWLQFRNS
KPCSDYCLSRIVNLIEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLMSLGIHLNPNKTKRWGYSLHFMGYVIGGYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754618_Pol_P-D Product feature CHAIN JF754618_Pol_P-D of FT:mat_peptide JF754618_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK129). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNVSIPWTHKVGNFXGLYSSTVPVFNPHGKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JF754619_Pol_P-D Product feature CHAIN JF754619_Pol_P-D of FT:mat_peptide JF754619_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK62). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTANLASKSASCFYQSTVRKAAYPSDSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMPNMHDSCSRNLYVSLL
LLYKTFGRKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSVGIHLNPTKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKTFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754621_Pol_P-D Product feature CHAIN JF754621_Pol_P-D of FT:mat_peptide JF754621_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK161). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
TIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFHARHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSSSGHNANPASKSASCIYHSPVRKTAYTTVSTFERHSSSGHAVELHNFPPKSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTXAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754622_Pol_P-D Product feature CHAIN JF754622_Pol_P-D of FT:mat_peptide JF754622_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK16). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=827 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVDIPWTHKVGNLTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSEHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSSSGHTTNLASKSASCLYQSPVRKAGHTSVATFERHSSSGHAVELHKLPPNSAGSQSPCWWLQFRNSKPCSD
YCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTSESRLVVDFSQFSRGXHRVSWPKFAVPNLQSLT
NLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLLLLYQT
FGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNFLLS
LGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRLVGLLGFAAPFTQCGYPALMP
LYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELLAACFA
RSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRTSLY
ADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754623_Pol_P-D Product feature CHAIN JF754623_Pol_P-D of FT:mat_peptide JF754623_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK171). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPESPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDYCSRNLYVSIL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754624_Pol_P-D Product feature CHAIN JF754624_Pol_P-D of FT:mat_peptide JF754624_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK28). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754626_Pol_P-D Product feature CHAIN JF754626_Pol_P-D of FT:mat_peptide JF754626_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK23). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPNHLVNHYFKTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCHYQSPVRKAAYPSVSTFERHSSSGYPVELQKLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYTIGCYGSLPQDHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754627_Pol_P-D Product feature CHAIN JF754627_Pol_P-D of FT:mat_peptide JF754627_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK37). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGLEPSGSGHNTNLASKSASCLYQSPVRKAAYSSVSTFEKHSSSGHVLELHNLPPNSARSQSERPIFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754628_Pol_P-D Product feature CHAIN JF754628_Pol_P-D of FT:mat_peptide JF754628_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRHFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCVY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754629_Pol_P-D Product feature CHAIN JF754629_Pol_P-D of FT:mat_peptide JF754629_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK176). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSTSCLYQSPVRKAAYPAVSTFERHSSSGHAVELNNLPSNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSASHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754630_Pol_P-D Product feature CHAIN JF754630_Pol_P-D of FT:mat_peptide JF754630_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK175). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSCQHFRRLLLLDNESGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILPRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPANSTFEKHSSSSHAVELHNLPPNSARSQSERLVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNAAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCVAFSYMDDVVLGAKSVQHLDSLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RISLYADSPSVPYHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754631_Pol_P-D Product feature CHAIN JF754631_Pol_P-D of FT:mat_peptide JF754631_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK193). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSNVPVFNPHGKTPSFP
NIHLHQDIIKKCAQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSIQSKHRKSRLGLQSQQGHLARRQQGRSWSLRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPAKKAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCADHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLYTAVS
NFLMSVGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPFHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754632_Pol_P-D Product feature CHAIN JF754632_Pol_P-D of FT:mat_peptide JF754632_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK186). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKPPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLVMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRSFGVEPSGSGHTTNLASKSASCLYQSSVRKAAYPAVSAFEKHSSSGHAVELHNLPPNSARSQSERPIFPCWWLQFRNS
KPCSDYCLSHIINLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRILNYQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLYTAVT
NFLVSLGIHLNPNKTKRWGYSLHFMGYVIGGYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754633_Pol_P-D Product feature CHAIN JF754633_Pol_P-D of FT:mat_peptide JF754633_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK128). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKKAYPAVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHSAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754634_Pol_P-D Product feature CHAIN JF754634_Pol_P-D of FT:mat_peptide JF754634_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFP
NIHLHQNIIEKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSSVRKAAHSSVSTFERHSSSGHAVELHNLPPNSARSKSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNXEESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIKQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JF754635_Pol_P-D Product feature CHAIN JF754635_Pol_P-D of FT:mat_peptide JF754635_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK113). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGNITGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPGHLVNHYFQTRHYLHTLWKAGILYQR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPTRVTGGVFLVDTSPHNTAESRLVVDFSQFFRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSVGIHLNPNKTKRWGYSLHFMGYVIGGYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040750_Pol_P-D Product feature CHAIN JN040750_Pol_P-D of FT:mat_peptide JN040750_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919078). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTLEKHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFLGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040751_Pol_P-D Product feature CHAIN JN040751_Pol_P-D of FT:mat_peptide JN040751_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919047). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSSSGHTTNLASTSASCIYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040753_Pol_P-D Product feature CHAIN JN040753_Pol_P-D of FT:mat_peptide JN040753_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919064). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPAA
RRPFGVEPSGSGHTTNLANKSASCFHQAPDRKAAYPSDSTFERHSSSGHAVELHNLPPNSAKSQSERPVYPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLTLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040755_Pol_P-D Product feature CHAIN JN040755_Pol_P-D of FT:mat_peptide JN040755_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919086). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGIPSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRSFGVEPSGSGHTTNLASKSASCFYQSPVRKAAYPSVSTSEKHSSSGHAVEFHNIPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPQNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIPNHQHGTMPNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040756_Pol_P-D Product feature CHAIN JN040756_Pol_P-D of FT:mat_peptide JN040756_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919039). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=826 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTILPSKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQPCWWLQFRNSKPCSDY
CLSHIVNLLEGWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPNLQSLTN
LLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQDLHDSCSRNLYVSLLLLYQTF
GRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNFLLSL
GIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDGKVCQRIVGLLGFAAPFTQCGYPALMPL
YACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELLAACFAR
SRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRTSLYA
DSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040757_Pol_P-D Product feature CHAIN JN040757_Pol_P-D of FT:mat_peptide JN040757_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919056). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDPCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGATILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN040758_Pol_P-D Product feature CHAIN JN040758_Pol_P-D of FT:mat_peptide JN040758_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919037). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSGRPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPGTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040759_Pol_P-D Product feature CHAIN JN040759_Pol_P-D of FT:mat_peptide JN040759_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919063). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040761_Pol_P-D Product feature CHAIN JN040761_Pol_P-D of FT:mat_peptide JN040761_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919002). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLQPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040762_Pol_P-D Product feature CHAIN JN040762_Pol_P-D of FT:mat_peptide JN040762_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919007). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCFYQSPVRKATYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTEQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKLKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040765_Pol_P-D Product feature CHAIN JN040765_Pol_P-D of FT:mat_peptide JN040765_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919006). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQYFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTT
RRPFGVEPSGSGHTTNLANKSASCFYQSPVRKAAYPSVSTFERHASSGHAVELHNLPPNSARSQSERPVLPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040766_Pol_P-D Product feature CHAIN JN040766_Pol_P-D of FT:mat_peptide JN040766_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919046). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRLVAEDLNLGKLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYRR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPAGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSEGPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCSEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLIGSSGLSRYVARLSSTSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANVIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLYVAWRPP
>gnl|hbvpro|JN040767_Pol_P-D Product feature CHAIN JN040767_Pol_P-D of FT:mat_peptide JN040767_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919019). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGHLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFERHASSGHAVELHNIPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSGQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040768_Pol_P-D Product feature CHAIN JN040768_Pol_P-D of FT:mat_peptide JN040768_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919051). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYYQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGQLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPLFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTSESRLVVDFSQFSRGNHRVSWPKFAVPN
FQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRTGFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040769_Pol_P-D Product feature CHAIN JN040769_Pol_P-D of FT:mat_peptide JN040769_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919015). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSRHTANLASKFASCLHQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCMAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIKHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040770_Pol_P-D Product feature CHAIN JN040770_Pol_P-D of FT:mat_peptide JN040770_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919087). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRSGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040771_Pol_P-D Product feature CHAIN JN040771_Pol_P-D of FT:mat_peptide JN040771_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919013). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTR
RRPFGVEPSGSGHTTNLARKSASCLYQSPVRKAAYSSVSTVEKHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPDKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040773_Pol_P-D Product feature CHAIN JN040773_Pol_P-D of FT:mat_peptide JN040773_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919084). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLHLGDLNVDIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELRNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPTRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040774_Pol_P-D Product feature CHAIN JN040774_Pol_P-D of FT:mat_peptide JN040774_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919088). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKATYPSVSTFEKHSSSGHAVELHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHITQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040775_Pol_P-D Product feature CHAIN JN040775_Pol_P-D of FT:mat_peptide JN040775_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919049). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLARKSASCLHQSPVRQAAYPSVSTFEKHASSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSEYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLCWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDLVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040777_Pol_P-D Product feature CHAIN JN040777_Pol_P-D of FT:mat_peptide JN040777_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919017). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCRYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSKHLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCDGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040778_Pol_P-D Product feature CHAIN JN040778_Pol_P-D of FT:mat_peptide JN040778_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919038). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADAGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGMEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSRSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFMAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040779_Pol_P-D Product feature CHAIN JN040779_Pol_P-D of FT:mat_peptide JN040779_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919070). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPNWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSSVRKAAYPSVSTFEKHSSSGHAVEFHNLPPNSARSQSDRPVFPCWWLQFRNS
KPCSDYCISHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPGYVARMSSTSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSSLNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN040781_Pol_P-D Product feature CHAIN JN040781_Pol_P-D of FT:mat_peptide JN040781_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919029). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGVHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040782_Pol_P-D Product feature CHAIN JN040782_Pol_P-D of FT:mat_peptide JN040782_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919041). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPDVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGHLARRQQGRSGSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVEFHNLPPNSARSQSERPEFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEQHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040783_Pol_P-D Product feature CHAIN JN040783_Pol_P-D of FT:mat_peptide JN040783_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919090). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGGEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVEHHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLQFMGYIIGCYGSLPQDHIIQKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040784_Pol_P-D Product feature CHAIN JN040784_Pol_P-D of FT:mat_peptide JN040784_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919030). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIVKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGAGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAENGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040785_Pol_P-D Product feature CHAIN JN040785_Pol_P-D of FT:mat_peptide JN040785_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919022). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTKPARKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040786_Pol_P-D Product feature CHAIN JN040786_Pol_P-D of FT:mat_peptide JN040786_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919035). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSFRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPKTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPTKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPMPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040787_Pol_P-D Product feature CHAIN JN040787_Pol_P-D of FT:mat_peptide JN040787_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919040). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSFRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKYSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPKTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYDSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPTKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPMPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040788_Pol_P-D Product feature CHAIN JN040788_Pol_P-D of FT:mat_peptide JN040788_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919024). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKGGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSFRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSEGPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPKTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGIMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIQLNPTKTKRWGYSLHFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPMPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040790_Pol_P-D Product feature CHAIN JN040790_Pol_P-D of FT:mat_peptide JN040790_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919054). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKYRVSWPKFAVPN
LQSLTNLLSSILSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040791_Pol_P-D Product feature CHAIN JN040791_Pol_P-D of FT:mat_peptide JN040791_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919082). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHKLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCISHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040792_Pol_P-D Product feature CHAIN JN040792_Pol_P-D of FT:mat_peptide JN040792_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919079). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSEGPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIRQKIKECFRQLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040793_Pol_P-D Product feature CHAIN JN040793_Pol_P-D of FT:mat_peptide JN040793_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919083). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNVSVPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLDQSPVRKAAYPSVSTFEKHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040794_Pol_P-D Product feature CHAIN JN040794_Pol_P-D of FT:mat_peptide JN040794_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919075). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELNNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIRQKIKECFRQLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANFIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040795_Pol_P-D Product feature CHAIN JN040795_Pol_P-D of FT:mat_peptide JN040795_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919003). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESLHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAADPAVSTFENHSSSGHAVELHNLPPNSARSQSERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLHLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040796_Pol_P-D Product feature CHAIN JN040796_Pol_P-D of FT:mat_peptide JN040796_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919018). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQRFRSVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN040797_Pol_P-D Product feature CHAIN JN040797_Pol_P-D of FT:mat_peptide JN040797_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919021). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKTFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040799_Pol_P-D Product feature CHAIN JN040799_Pol_P-D of FT:mat_peptide JN040799_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919080). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTCNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGFQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFERHSSSGHAVELQNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPTRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN040800_Pol_P-D Product feature CHAIN JN040800_Pol_P-D of FT:mat_peptide JN040800_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919012). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARITGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN040801_Pol_P-D Product feature CHAIN JN040801_Pol_P-D of FT:mat_peptide JN040801_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919042). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCHYQSPVRKAAYSADSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN040802_Pol_P-D Product feature CHAIN JN040802_Pol_P-D of FT:mat_peptide JN040802_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919074). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRTLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGRLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFENHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHYIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQYGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVLQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFAFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN040805_Pol_P-D Product feature CHAIN JN040805_Pol_P-D of FT:mat_peptide JN040805_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919058). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLRQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSRLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040806_Pol_P-D Product feature CHAIN JN040806_Pol_P-D of FT:mat_peptide JN040806_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919066). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDETGSLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHTSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKTFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040807_Pol_P-D Product feature CHAIN JN040807_Pol_P-D of FT:mat_peptide JN040807_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919034). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHTTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVTRQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040808_Pol_P-D Product feature CHAIN JN040808_Pol_P-D of FT:mat_peptide JN040808_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919011). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRIAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHTANLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELRNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040809_Pol_P-D Product feature CHAIN JN040809_Pol_P-D of FT:mat_peptide JN040809_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919014). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSFRAGIHPTA
RRPFGVEPSGSGHTANLASKSASCLYQSPVRKAAYPAVSTFEKHASSGHAVELHNLPPNSARSQSERPAFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARMSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSMVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040810_Pol_P-D Product feature CHAIN JN040810_Pol_P-D of FT:mat_peptide JN040810_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919060). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
WRPSGVEPSGSGHITNFASKSASCLDQSPVRKGAYPADSTFERHSSSVHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCNQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040811_Pol_P-D Product feature CHAIN JN040811_Pol_P-D of FT:mat_peptide JN040811_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919048). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSRIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYSCIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040812_Pol_P-D Product feature CHAIN JN040812_Pol_P-D of FT:mat_peptide JN040812_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919027). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHMARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNAAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNNQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040813_Pol_P-D Product feature CHAIN JN040813_Pol_P-D of FT:mat_peptide JN040813_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919025). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWQTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQPQQGHLARCQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNPARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040814_Pol_P-D Product feature CHAIN JN040814_Pol_P-D of FT:mat_peptide JN040814_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919032). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYTWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPAGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNIPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN040815_Pol_P-D Product feature CHAIN JN040815_Pol_P-D of FT:mat_peptide JN040815_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919073). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKNRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040818_Pol_P-D Product feature CHAIN JN040818_Pol_P-D of FT:mat_peptide JN040818_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919081). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFAGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHSKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHSTNLASKSASCLYQSPVRQAAYPAVSAFEEHSSSSHAVELNNLPPNSARSQSERPVLPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSGYVARLSSNSRIVNNQHGTMQDLHHSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040819_Pol_P-D Product feature CHAIN JN040819_Pol_P-D of FT:mat_peptide JN040819_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919067). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHHKSRLGLQSQQGHLARRQQGRSWSMRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPTVSTFEKHTSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040820_Pol_P-D Product feature CHAIN JN040820_Pol_P-D of FT:mat_peptide JN040820_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919010). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWEAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSKRPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRPPFRPTTG
RNSLYADSPSVPSHLPDRVHFASPLHVEWRPP
>gnl|hbvpro|JN040821_Pol_P-D Product feature CHAIN JN040821_Pol_P-D of FT:mat_peptide JN040821_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919085). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPDRKAADPAVSTFEKHSSSGHAVEHHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKTFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN040822_Pol_P-D Product feature CHAIN JN040822_Pol_P-D of FT:mat_peptide JN040822_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919044). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPVGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSDLSWVSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFSSAICSVVRRAFPHCLAFSYIDDVVLGAKTVQHLESLFTAVT
NFLVSLGIHLNPHKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040823_Pol_P-D Product feature CHAIN JN040823_Pol_P-D of FT:mat_peptide JN040823_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919005). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLARKSASCLYQSPVRKAAYPSVSTFEKHAPSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040824_Pol_P-D Product feature CHAIN JN040824_Pol_P-D of FT:mat_peptide JN040824_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919071). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLFMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPYRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040826_Pol_P-D Product feature CHAIN JN040826_Pol_P-D of FT:mat_peptide JN040826_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919055). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQPSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNIPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPSTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040827_Pol_P-D Product feature CHAIN JN040827_Pol_P-D of FT:mat_peptide JN040827_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919008). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKTAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNI
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDACSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHITQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040828_Pol_P-D Product feature CHAIN JN040828_Pol_P-D of FT:mat_peptide JN040828_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919069). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHTANLASKSASCLYQSAVRKAAYPVVSTFKKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFKAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040829_Pol_P-D Product feature CHAIN JN040829_Pol_P-D of FT:mat_peptide JN040829_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919089). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSAGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCISHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFFRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN040830_Pol_P-D Product feature CHAIN JN040830_Pol_P-D of FT:mat_peptide JN040830_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919052). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRSPVGSSLQSKYRKSRLGLQSQQGLLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHITNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVEFHNISPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257148_Pol_P-D Product feature CHAIN JN257148_Pol_P-D of FT:mat_peptide JN257148_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMF). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNSRVSWPKFAVPN
LQSLTNLLSSNLSWLSMDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCQQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257149_Pol_P-D Product feature CHAIN JN257149_Pol_P-D of FT:mat_peptide JN257149_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSFN). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVXKAAYPAVSTFEXHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKXVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN257150_Pol_P-D Product feature CHAIN JN257150_Pol_P-D of FT:mat_peptide JN257150_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABS). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPXFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTXESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGXMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFVAPLXIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257151_Pol_P-D Product feature CHAIN JN257151_Pol_P-D of FT:mat_peptide JN257151_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHHR). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTVEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDNCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257152_Pol_P-D Product feature CHAIN JN257152_Pol_P-D of FT:mat_peptide JN257152_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRJB). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAISTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYAARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKXVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257153_Pol_P-D Product feature CHAIN JN257153_Pol_P-D of FT:mat_peptide JN257153_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS1). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=831 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNXSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNXASKSASCLYQSPVRKAAYPSDSTSEXHSSSGPVXXXXLSPNSARSQSERPVFPCWWLQFRNSK
PCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPNL
QSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSAGLSRYVARLSSNSRIFNHQHGTMQDLHDACSRNLYVSLLL
LYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSXQHLESLFTAVTN
FLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYP
ALMPLYACIQAKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELLA
ACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLXRPLXRLPFRPTTGR
TSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257155_Pol_P-D Product feature CHAIN JN257155_Pol_P-D of FT:mat_peptide JN257155_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJHM1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSTSCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257159_Pol_P-D Product feature CHAIN JN257159_Pol_P-D of FT:mat_peptide JN257159_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMRW). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGQLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSTSCLYQSSVRKAAYPSDSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257160_Pol_P-D Product feature CHAIN JN257160_Pol_P-D of FT:mat_peptide JN257160_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHATR1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRXVAXDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPXXTKYLPLDKGIKPYYPEHLVNHYFQTXXYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRXGXHPTA
RRPXGVEPSGSGHTTNLARXSASCLXQSPVRKATYXSVSTFEKHPSSGHAVELHNLPPNSAXSXSERPVFPCWWLQFRBS
KPCSDYCLSHIVNLXEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257162_Pol_P-D Product feature CHAIN JN257162_Pol_P-D of FT:mat_peptide JN257162_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSDQ). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQXRHYLHTLWKSGVLYQR
ETTHSASFCGSLYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNPASKSASCFYQSPVRKAAXTVVSTFEKHSSSGHAVEXHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDHCLSHIVNLLEDWGPCAEHGEHYIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGXHRVSWPKFAVPN
LQSLTNLLSSBLSWLSLDVSAAFYHLPLHPAAMPHLLIGSSGLSRYVARLSSNSRIXNXQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAXSVXHLEXLFXAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGXYGSLPQDHIRQKIKECFRKLPXNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALXPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSXPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFQPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVEWRPP
>gnl|hbvpro|JN257163_Pol_P-D Product feature CHAIN JN257163_Pol_P-D of FT:mat_peptide JN257163_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAZI). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPTGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPIFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYIARLSSTSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257165_Pol_P-D Product feature CHAIN JN257165_Pol_P-D of FT:mat_peptide JN257165_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYRR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPXGVEPSGSGHTTNLASKSASCFYQSPVRKAAYPSVSTFERHPSSGHAVELHNLPPNSTRSQSEGPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRXPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSXDSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGGYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLEPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257166_Pol_P-D Product feature CHAIN JN257166_Pol_P-D of FT:mat_peptide JN257166_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL2). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=831 residues).
MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYRR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPXGVEPSGSGHTTNLASKSASCFYQSPVRKAAYPSVSTFERHPSSGHAVELHNLPPNSTRSQSEGPVPCWWLQFRNSK
PCSDYCLSHIVNLLEDWGPCAEHGEHHIRXPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNHRVSWPKFAVPNL
QSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSXDSRIFNHQHGTMQNLHDSCSRNLYVSLLL
LYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVTN
FLLSLGIHLNPNKTKRWGYSLHFMGYVIGGYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYP
ALKPLYACIQSKQAFTFSPTYKAFLRQQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLEPLPIHTAELLA
ACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGR
TSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257169_Pol_P-D Product feature CHAIN JN257169_Pol_P-D of FT:mat_peptide JN257169_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAFF). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257170_Pol_P-D Product feature CHAIN JN257170_Pol_P-D of FT:mat_peptide JN257170_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJWB). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPTGSGHTTNLASKSASCLYQSPVRKAAHPSVSTSERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSTLNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257171_Pol_P-D Product feature CHAIN JN257171_Pol_P-D of FT:mat_peptide JN257171_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKML). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNERRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSFRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257172_Pol_P-D Product feature CHAIN JN257172_Pol_P-D of FT:mat_peptide JN257172_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMYD1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLQLIMPARFXPNVTKYLPLDKGIKPYYPNHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKYRKSRLGLQSQQGLLARRQQGRSWSIRAGXHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHPSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLKDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFXAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257173_Pol_P-D Product feature CHAIN JN257173_Pol_P-D of FT:mat_peptide JN257173_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMYD2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=826 residues).
MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLQLIMPARFXPNVTKYLPLDKGIKPYYPNHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKYRKSRLGLQSQQGLLARRQQGRSWSIRAGXHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHPSSGHAVELHNLPPNSARSQPCWWLQFRNSKPCSDY
CLSHIVNLLKDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPNLQSLTN
LLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLLLLYKTF
GRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVTNFLLSL
GIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPL
YACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFXAPLPIHTAELLAACFAR
SRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRTSLYA
DSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257176_Pol_P-D Product feature CHAIN JN257176_Pol_P-D of FT:mat_peptide JN257176_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNVNVSIPWTHKVGSFTGFYSSTVPVFNPHWKTPSFP
XIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELXHGSESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGXLARRQQGRSWSIRAGXHPTA
RRPFGXEPSGSGHTTXLASKSASCLYQSPVRKAAYPSVSTFEXHSSSGXAVELHNLPPNSARSQSERPXFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSBLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSXXFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVXHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCXGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLRKQYLBLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFXXPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN257177_Pol_P-D Product feature CHAIN JN257177_Pol_P-D of FT:mat_peptide JN257177_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFRJ2). Complete genome. [Hepadnaviridae] (length=833 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNNINVSIPWTHKVGSFTGFYSSTVPVFNPHWKTPSF
PXIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYK
RETTHSASFCGSPYSWEQELXHGSESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGXLARRQQGRSWSIRAGXHPT
ARRPFGXEPSGSGHTTXLASKSASCLYQSPVRKAAYPSVSTFEXHSSSGXAVELHNLPPNSARSQSERPXFPCWWLQFRN
SKPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVP
NLQSLTNLLSSBLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSXSXXFNHQHGTMQNLHDSCSRNLYVSL
LLLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVXHLESLFTAV
TNFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCXGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
YPALKPLYACIQSKQAFTFSPTYKAFLRKQYLBLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFXXPLPIHTAEL
LAACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTT
GRTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN257179_Pol_P-D Product feature CHAIN JN257179_Pol_P-D of FT:mat_peptide JN257179_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMJD1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTXSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257181_Pol_P-D Product feature CHAIN JN257181_Pol_P-D of FT:mat_peptide JN257181_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHNDA). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQKGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKDCFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257182_Pol_P-D Product feature CHAIN JN257182_Pol_P-D of FT:mat_peptide JN257182_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMSL). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKICQRIVGLLGFAAPFTQCGY
PALKPLYACIQYKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257183_Pol_P-D Product feature CHAIN JN257183_Pol_P-D of FT:mat_peptide JN257183_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKSH). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPXVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYXR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASGLXQSPVGKAAHPAVSTVEKHSSSGHAVELHNLPPNSARSQSERPVXPCWWLQFRNS
KPCSDYCLSHIVNLIEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLTLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257185_Pol_P-D Product feature CHAIN JN257185_Pol_P-D of FT:mat_peptide JN257185_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHZYD). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYARIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN257186_Pol_P-D Product feature CHAIN JN257186_Pol_P-D of FT:mat_peptide JN257186_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHDHM). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTVEKHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWXSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNDQHGXMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYXDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257187_Pol_P-D Product feature CHAIN JN257187_Pol_P-D of FT:mat_peptide JN257187_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL1). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=824 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPXVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRTPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTXXANKSASCLYQSPVRKAAYXAVSTFEXHSSSGHAVELHNLPPNSARSCWWLQFRNSKPCSDYCL
SHIVNLLEDWGPCTEHGEHHIRXPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPNLQSLTNLL
SSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGXMQNLHDSCSRNLYVSLLLLYQTFGR
KLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVTNFLLSLGI
HLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYA
CIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELLAACFARSR
SGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRTSLYADS
PSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257188_Pol_P-D Product feature CHAIN JN257188_Pol_P-D of FT:mat_peptide JN257188_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPXVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRTPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTXXANKSASCLYQSPVRKAAYXAVSTFEKHSSSGHAVELHNLPPNSARSQSERPEFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRXPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGXMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257190_Pol_P-D Product feature CHAIN JN257190_Pol_P-D of FT:mat_peptide JN257190_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHYHY). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNLRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFYQQSSGILSRPPVGSSLQSKHHKSRLGLQSQQGHMARRQQGRSWSIRAGFHPSA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAADPAVSTFEEHSSSGHAVELHNLPSNSARSQGARPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAVCSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN257193_Pol_P-D Product feature CHAIN JN257193_Pol_P-D of FT:mat_peptide JN257193_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPXVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257195_Pol_P-D Product feature CHAIN JN257195_Pol_P-D of FT:mat_peptide JN257195_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHRS2). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=831 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNXSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
KIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNXASKSASCLYQSPVRKAAYPSDSTSEXHSSSGPVXXXXLSPNSARSQSERPVFPCWWLQFRNSK
PCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPNL
QSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSAGLSRYVARLSSNSRIFNHQHGTMQDLHDACSRNLYVSLLL
LYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSXQHLESLFTAVTN
FLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYP
ALMPLYACIQAKQAFTFSPTYKAFLCKQYLXLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELLA
ACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTGR
TSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257196_Pol_P-D Product feature CHAIN JN257196_Pol_P-D of FT:mat_peptide JN257196_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABR1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHSKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPVVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSXNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFXAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257199_Pol_P-D Product feature CHAIN JN257199_Pol_P-D of FT:mat_peptide JN257199_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSOD2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSSVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRFVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257200_Pol_P-D Product feature CHAIN JN257200_Pol_P-D of FT:mat_peptide JN257200_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMNM). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTANLASKSASGLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPTNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFXAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257201_Pol_P-D Product feature CHAIN JN257201_Pol_P-D of FT:mat_peptide JN257201_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHFAD). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRDGIHPTA
RRPFGVEPSGSGHAANLASKSASCXYQSPXRKAAYPAVSTFERHSSSGHAVGLHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGATSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGPQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257202_Pol_P-D Product feature CHAIN JN257202_Pol_P-D of FT:mat_peptide JN257202_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSLI). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFRVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVATFERNSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNDQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257203_Pol_P-D Product feature CHAIN JN257203_Pol_P-D of FT:mat_peptide JN257203_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJKF). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRXPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPMPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257205_Pol_P-D Product feature CHAIN JN257205_Pol_P-D of FT:mat_peptide JN257205_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRYD). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASYLYQSPVRKAAYPADSTFEKHSSSGHAVELHNLPTNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN257209_Pol_P-D Product feature CHAIN JN257209_Pol_P-D of FT:mat_peptide JN257209_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMR2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEXLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642126_Pol_P-D Product feature CHAIN JN642126_Pol_P-D of FT:mat_peptide JN642126_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb9). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQNIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHMARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKPASCLYQSSVRKAAYPSVSTSEKHSSSGHAVELHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRESWQKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFPQGGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642128_Pol_P-D Product feature CHAIN JN642128_Pol_P-D of FT:mat_peptide JN642128_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb11). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFPRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVCPLTVNVESRLQLIMHARSYPKVTKYLPLDKGIKPYYPEHLVDHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWNIRAGIHPTA
RRPFGVEPSGSGHTTNLARQSTSCLYQSPVRKAAYPSVSAFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCTRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIRECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSAMNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642129_Pol_P-D Product feature CHAIN JN642129_Pol_P-D of FT:mat_peptide JN642129_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHFTNLASKSASGLNQSPVGKAANPSVSTFEKYSSSGHAVELHNLPPNSARSQSERPIFPCWWLQFRNS
KPCSDYCISHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRIFNNQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSEQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642130_Pol_P-D Product feature CHAIN JN642130_Pol_P-D of FT:mat_peptide JN642130_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb13). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSSYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRDS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSQQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642131_Pol_P-D Product feature CHAIN JN642131_Pol_P-D of FT:mat_peptide JN642131_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb16). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKQSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
RPCSDYCLSHIVNLLEEWGPCVEHGEHHIRIPRTPARVTGGVFLVDKNPHNTGKSRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCFGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFPQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642132_Pol_P-D Product feature CHAIN JN642132_Pol_P-D of FT:mat_peptide JN642132_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb18). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYTWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSEGPVFPCWWLQFRNS
EPCSDHCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPRYVARVSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642133_Pol_P-D Product feature CHAIN JN642133_Pol_P-D of FT:mat_peptide JN642133_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb21). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRESRLGLQSQQRHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVGKAVYPSVSTFEEHSSSGRAVEFHSLPPNSARSQSEGPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMQNLHDSCSRKLFVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRNLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642134_Pol_P-D Product feature CHAIN JN642134_Pol_P-D of FT:mat_peptide JN642134_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb22). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDAESGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGSLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTVEKHSSSGRAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGNMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPVIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLRKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642135_Pol_P-D Product feature CHAIN JN642135_Pol_P-D of FT:mat_peptide JN642135_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb24). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNNAGPLEEELPRLADEGLNRRVAEDLSLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGMEPSGSGHTTDLASKSASCLYQSPVRKATYPSDSTFENHSSSHHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPVRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSMVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFEAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642136_Pol_P-D Product feature CHAIN JN642136_Pol_P-D of FT:mat_peptide JN642136_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb25). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSTPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKGTKYLPLDKGIKPYYPEHLVNHYFQTRNYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSGSIRTGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNMHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLMSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLTPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVEWRPP
>gnl|hbvpro|JN642138_Pol_P-D Product feature CHAIN JN642138_Pol_P-D of FT:mat_peptide JN642138_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb28). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYTWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQLRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFCRGNYRVSWPKFAVPN
LQSLTNLLSSNLSCLSLDVSAAFYHHPLHPAAMPHLLVGSSGLSRYVARLSSNSRIDDHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAHFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFPQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642140_Pol_P-D Product feature CHAIN JN642140_Pol_P-D of FT:mat_peptide JN642140_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb30). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRSPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHTANPASKSASCLYQSPVRKAADPAISTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPGTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSPNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSGQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGASIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642142_Pol_P-D Product feature CHAIN JN642142_Pol_P-D of FT:mat_peptide JN642142_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSQHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTSKRHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHLVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN642143_Pol_P-D Product feature CHAIN JN642143_Pol_P-D of FT:mat_peptide JN642143_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb33). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHDTNLASKSASCIYQSPVRKAAYSAVSTFERNSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642144_Pol_P-D Product feature CHAIN JN642144_Pol_P-D of FT:mat_peptide JN642144_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb34). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFFGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSIQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGLHPTA
RRPFGVEPSGSGHNTNLASKSASCTYQSPVKKAAYPAVSTFEKHSSSGHAVELHNLSPNSARSQGEGAVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLISLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLRTQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLRFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642145_Pol_P-D Product feature CHAIN JN642145_Pol_P-D of FT:mat_peptide JN642145_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb36). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGRHRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNTARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPGRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642146_Pol_P-D Product feature CHAIN JN642146_Pol_P-D of FT:mat_peptide JN642146_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb38). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLRQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQTPVRKAAYPAVSTFERHSSSGHAVELHNLPPNSARSQSESPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHRESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLSLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642147_Pol_P-D Product feature CHAIN JN642147_Pol_P-D of FT:mat_peptide JN642147_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb39). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFPRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVNIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTSNLASKSASCLYQSSVRKATNPSVSTFEKHSSSGHAVEFHNLPPNSAGSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLPGYVARLSSNSRIFDHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642148_Pol_P-D Product feature CHAIN JN642148_Pol_P-D of FT:mat_peptide JN642148_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb40). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQRPLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTTERHSSSGHAVELHNLPPNSTRSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN642149_Pol_P-D Product feature CHAIN JN642149_Pol_P-D of FT:mat_peptide JN642149_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb41). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGFQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKAAYPAVSTFERHSSSGHAVELHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIKQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN642150_Pol_P-D Product feature CHAIN JN642150_Pol_P-D of FT:mat_peptide JN642150_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb43). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNRASKSASCLYQSPVGKAAYPSVSTFEKHASSGHAVEFHNLPPNSARSQGERPVSSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFCRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642151_Pol_P-D Product feature CHAIN JN642151_Pol_P-D of FT:mat_peptide JN642151_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb44). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYTSVSTFEKYSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642153_Pol_P-D Product feature CHAIN JN642153_Pol_P-D of FT:mat_peptide JN642153_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb47). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLVRRQQGRSWSIRAGIHSTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIIHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642154_Pol_P-D Product feature CHAIN JN642154_Pol_P-D of FT:mat_peptide JN642154_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb48). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGYLYKR
ETTHSASFCGSPYSWEQEIRHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSTSCLHQSPVRKAAYPTVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVKLLDDWGPCDEHGENHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLDSLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642155_Pol_P-D Product feature CHAIN JN642155_Pol_P-D of FT:mat_peptide JN642155_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb49). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSWGHAVELHNLPPNSARSQSERPVSPCWWLQLRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVIRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642156_Pol_P-D Product feature CHAIN JN642156_Pol_P-D of FT:mat_peptide JN642156_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb50). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTLPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFHTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGFQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSMVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642157_Pol_P-D Product feature CHAIN JN642157_Pol_P-D of FT:mat_peptide JN642157_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb51). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGQLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSDSTFEKHSSSSHAVELHNFPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN642158_Pol_P-D Product feature CHAIN JN642158_Pol_P-D of FT:mat_peptide JN642158_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb57). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNATKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSGPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSGSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSAACLYQSPVRKAAYPSESTFEKHSSSSHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDMVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642159_Pol_P-D Product feature CHAIN JN642159_Pol_P-D of FT:mat_peptide JN642159_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb52). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHCKSRLGLQSQQGLLARRQQGRSWSIRDGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKATYTAVSTSERHSSSGHAVELHNLPPNSTRSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIRQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGISRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642161_Pol_P-D Product feature CHAIN JN642161_Pol_P-D of FT:mat_peptide JN642161_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb54). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELRHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSSSGHTTNLASKSASCLYQSPVRKAAYPAISTFEEHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642163_Pol_P-D Product feature CHAIN JN642163_Pol_P-D of FT:mat_peptide JN642163_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb59). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVGKEAYPAVSTFERHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRNCNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRTFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCYGSLPQDHIIRKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALIPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLLFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642165_Pol_P-D Product feature CHAIN JN642165_Pol_P-D of FT:mat_peptide JN642165_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb17). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHMVGNFTGLYSSTVPVFTPHWKTPSFP
TIHLHQDIIKKCAQFVGPLTVNAKRRLQLIMPAMFYPKVTKYLPLDTGITPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIHHGAESFHQQSSGILSRPPVGSSLQSKHRKPRLGLQSQQGLLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLHQSPVRKATYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQLRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642166_Pol_P-D Product feature CHAIN JN642166_Pol_P-D of FT:mat_peptide JN642166_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb35). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTANLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCVEHGERHIRIPRTPARVTGGVFLVDKNPHHTEESRLVVDFSQFSRGNHSVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSDSRIFNHQHGIMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN642167_Pol_P-D Product feature CHAIN JN642167_Pol_P-D of FT:mat_peptide JN642167_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb37). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRHVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTLQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664909_Pol_P-D Product feature CHAIN JN664909_Pol_P-D of FT:mat_peptide JN664909_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB36_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQNIIEKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHLASPLHVAWRPP
>gnl|hbvpro|JN664910_Pol_P-D Product feature CHAIN JN664910_Pol_P-D of FT:mat_peptide JN664910_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB43_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIEKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ESTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKLRQSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCCGSLPQDHIILKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664911_Pol_P-D Product feature CHAIN JN664911_Pol_P-D of FT:mat_peptide JN664911_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB47_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664912_Pol_P-D Product feature CHAIN JN664912_Pol_P-D of FT:mat_peptide JN664912_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB49_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHPKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGNLPNLHDSCSRNLYVSLL
LLYQTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGSLPQDHIILKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKPFLCQQYLNLLPVARQRSGLCQVFAEPTPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRFGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDHVHFASPLHVAWRPP
>gnl|hbvpro|JN664913_Pol_P-D Product feature CHAIN JN664913_Pol_P-D of FT:mat_peptide JN664913_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN01_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRIVDHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664914_Pol_P-D Product feature CHAIN JN664914_Pol_P-D of FT:mat_peptide JN664914_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN48_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQNLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664917_Pol_P-D Product feature CHAIN JN664917_Pol_P-D of FT:mat_peptide JN664917_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SKR_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPSSCRSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664918_Pol_P-D Product feature CHAIN JN664918_Pol_P-D of FT:mat_peptide JN664918_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2198_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPFFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNFASKSASCIYQSPVRKAAYPAVSTFERHASSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGEHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664919_Pol_P-D Product feature CHAIN JN664919_Pol_P-D of FT:mat_peptide JN664919_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2320_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
HIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRTPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHKLPPNSARSQGERPVFPCWWLQFGNS
EPCSDHCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGSFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664920_Pol_P-D Product feature CHAIN JN664920_Pol_P-D of FT:mat_peptide JN664920_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1903_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCEQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHILWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQEHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPAYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664921_Pol_P-D Product feature CHAIN JN664921_Pol_P-D of FT:mat_peptide JN664921_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN47_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHTVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPSSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRIVDHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLIMGHQRMRGTFVAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664922_Pol_P-D Product feature CHAIN JN664922_Pol_P-D of FT:mat_peptide JN664922_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DH01_IC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPDWKTPSFP
HIHLKEDIINRCQQFVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGRLSFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPSSARSQSERPVFPCWWLNFRNS
KPCSDYCLSHIVNLLEDWGPCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGSFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664924_Pol_P-D Product feature CHAIN JN664924_Pol_P-D of FT:mat_peptide JN664924_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN32_CHB). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPKFTKYLPLDKGIKPYYPEHLVDHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVQPAGSGHTTNLASKSASCIYQSPVRKAAYPTVSTSEKHSSSCHAVDLHNLPPSSARSQSERPVFPCWWLNFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMPHLHDHCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIDCWGSLPQEHIIHKLKECFRKLPCYRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664926_Pol_P-D Product feature CHAIN JN664926_Pol_P-D of FT:mat_peptide JN664926_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN63_CHB). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPAGSGHTTNLASKSASCSYQSPVRKAAYPTVSTSERHPSSGHAVDLHNLPPSSARSQSERPVSPCWWLNFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMPHLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIDCWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVIGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLPFRPTTG
RTSLYAASPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664927_Pol_P-D Product feature CHAIN JN664927_Pol_P-D of FT:mat_peptide JN664927_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE20_CHB). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDHCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664928_Pol_P-D Product feature CHAIN JN664928_Pol_P-D of FT:mat_peptide JN664928_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE27_CHB). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASSIYQSPVRKAAYPAVSTFERYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDFCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPALFSHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSALCSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTDVT
NFLLSLGIHLNPTKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664930_Pol_P-D Product feature CHAIN JN664930_Pol_P-D of FT:mat_peptide JN664930_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEN9_CHB). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRISRLGLQSQQGHLARCQQGRSWSIRAGIHPTA
RRPFGVEPSRSRHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWNVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPAYKAFLCKQYMNLYPVARQRSGLCQVFADPTPTGWGLVMGHQRMRGSFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664931_Pol_P-D Product feature CHAIN JN664931_Pol_P-D of FT:mat_peptide JN664931_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB6_CHB). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQRHLARRQQGRSWSIRAGTHPTA
RRPFGVEPSGSGHTTNRASKSASCFYHSPVRKATYPSVSTFENHSSSGHTVELHNLPTISARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLIEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANLLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664932_Pol_P-D Product feature CHAIN JN664932_Pol_P-D of FT:mat_peptide JN664932_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2235_CHB). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGPMARRQQGRSWSIRARVHPTA
RRPFGVEPAGSGHTTNLASKSASCSYQSPVRKAAYPTVSTSERHSSSGHAVELHNLPPSSARSQSERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHNHCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664936_Pol_P-D Product feature CHAIN JN664936_Pol_P-D of FT:mat_peptide JN664936_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate E3529_LC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRARFHPTT
RRPFGVEPSGSGHTTNFASKSASCLRQSPVRKAAYPAVSTFEKHASSGHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664937_Pol_P-D Product feature CHAIN JN664937_Pol_P-D of FT:mat_peptide JN664937_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN45_LC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664938_Pol_P-D Product feature CHAIN JN664938_Pol_P-D of FT:mat_peptide JN664938_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN46_LC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVEFHNLPPSSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNNQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664939_Pol_P-D Product feature CHAIN JN664939_Pol_P-D of FT:mat_peptide JN664939_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN71_LC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEEHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVSLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JN664941_Pol_P-D Product feature CHAIN JN664941_Pol_P-D of FT:mat_peptide JN664941_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB21_LC). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKR
ESSRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRESRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTSERHASSGHAVEFHNIPPNSARSQGERPVFPCWWLQFRNT
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTEESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLIGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDDCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN664948_Pol_P-D Product feature CHAIN JN664948_Pol_P-D of FT:mat_peptide JN664948_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN64_LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=824 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWQAGILYKR
ETSHSASFCGSPYTWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGFQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPTVSTFEKHASSGHAVELHNLPPNYANPCWWLQFRNSKPCSDYCL
SLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPNLQSLTNLL
SSNLSWLSLDVSAAFYHLPLHPAAMPHHIVGSSGLSRYVARLSSNSRIINHQHGTMQNLHDSCSRNLYVSLLLLYQTFGR
KLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSAQHLESLFTAVTNFLLSLGI
HLNPNKTKRWGYSLNFMGYVIGCYGSLPQVHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYPALMPLYA
CIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFKAPLPIHTAELLAACFARSR
SGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTGRTSLYADS
PSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN688678_Pol_P-D Product feature CHAIN JN688678_Pol_P-D of FT:mat_peptide JN688678_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV007). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRXGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSQVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKKWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN688679_Pol_P-D Product feature CHAIN JN688679_Pol_P-D of FT:mat_peptide JN688679_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV010). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGVHPTA
RRSFGVEPSGSGHTTNFASKSASCLHQSPDRKTAYPAVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIRKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN688683_Pol_P-D Product feature CHAIN JN688683_Pol_P-D of FT:mat_peptide JN688683_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV087). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLNNKAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNLAGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEHFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRXQGRSWSXRAGVHPTA
RRSFGVEPSGSGHTTNFASKXASCLXQSPIRKTAYPAVSTFERHSSSGHAVEXHNLPPNSARSQSEXPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIRKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHTAELL
AACFARSRSGAXXIGTDNSVVLSRKYTSFPWLLGCXANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFXPTTG
RTSLYADSPSVPSHLPDRVHFXSPLHVGWRPP
>gnl|hbvpro|JN688685_Pol_P-D Product feature CHAIN JN688685_Pol_P-D of FT:mat_peptide JN688685_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV097). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=831 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRTPVGSSLQSKHRKSRLGLQSQQGQLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKTAYPADSTFERHSSSGPVDLLNLPPNSARSQSERPVSPCWWLQFRNSK
PCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPNL
QSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLLL
LYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRVFPHCLAFSYMDDVVLGAKTVQHLESLFTAVTN
FLLSLGIHLNPNKTKRWGYSLNFMGYVIGGYGSLPQEHIIRKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGYP
ALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFVAPLPIHTAELLA
ACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTGR
TSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JN688695_Pol_P-D Product feature CHAIN JN688695_Pol_P-D of FT:mat_peptide JN688695_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV128). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPIEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSSVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSTRSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILDHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLXKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN688708_Pol_P-D Product feature CHAIN JN688708_Pol_P-D of FT:mat_peptide JN688708_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV142). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSIQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPVGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFERHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYQNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFXAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN688710_Pol_P-D Product feature CHAIN JN688710_Pol_P-D of FT:mat_peptide JN688710_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV144). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNHRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQMSMPARFYPNVTKYFPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGDHPTA
RRPFGVEPSSSGHTTNFASKSASCLHQSPGRKAAYPAVSTFEKHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGKYRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARVSSNSRIINHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQXLEALFTTVT
NFLLSLGIHLNPDKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN688711_Pol_P-D Product feature CHAIN JN688711_Pol_P-D of FT:mat_peptide JN688711_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV161). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPVEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPSVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGXHPTA
WRPVGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFERHSSSGHAVEFHNLPPNSARSQTDRPGCLCWRLKFRNS
KPCSHYSVSLIVDRLEDCEPCDEHGELPIRIPRTPSRVTGGVFFVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTLPNLHDSCSRNLYVSLL
LLYQTFGRKLHMYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIVQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN688712_Pol_P-D Product feature CHAIN JN688712_Pol_P-D of FT:mat_peptide JN688712_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV163). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLTLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESVHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGQLARRQQGRSWSIRAGXHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSXVRKTAYSAVSTFEKHSSSSHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQILESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIQKIKXCFRKLPVNRPIDWKVCQRIVGLLGFXAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLYKQXLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPARVHFASPLHVAWGPP
>gnl|hbvpro|JN688713_Pol_P-D Product feature CHAIN JN688713_Pol_P-D of FT:mat_peptide JN688713_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV173). Complete genome. [Hepadnaviridae] (length=833 residues).
MPLSYQHFRRLLLLDEKAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYQR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKYRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPAA
RRPFGVEPSGSGHTANFASKSTSCLHQSPVRKAADPAISTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGXYGSLPQPHIVQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLAIGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHHVEWRPP
>gnl|hbvpro|JN792903_Pol_P-D Product feature CHAIN JN792903_Pol_P-D of FT:mat_peptide JN792903_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 310000127). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792904_Pol_P-D Product feature CHAIN JN792904_Pol_P-D of FT:mat_peptide JN792904_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002943). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792905_Pol_P-D Product feature CHAIN JN792905_Pol_P-D of FT:mat_peptide JN792905_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000345). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792906_Pol_P-D Product feature CHAIN JN792906_Pol_P-D of FT:mat_peptide JN792906_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002958). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHLSSGHAVELNNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792907_Pol_P-D Product feature CHAIN JN792907_Pol_P-D of FT:mat_peptide JN792907_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000473). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGNLNVDIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNRTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKTAYPAVSPFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792908_Pol_P-D Product feature CHAIN JN792908_Pol_P-D of FT:mat_peptide JN792908_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002951). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGNLNVDIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKTAYPAVSPFEKHLSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNXRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQDLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792909_Pol_P-D Product feature CHAIN JN792909_Pol_P-D of FT:mat_peptide JN792909_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000479). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792910_Pol_P-D Product feature CHAIN JN792910_Pol_P-D of FT:mat_peptide JN792910_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 109001205). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792911_Pol_P-D Product feature CHAIN JN792911_Pol_P-D of FT:mat_peptide JN792911_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111002952). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEQELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLVMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSRILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVGKAAYSAVSTFENYSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JN792912_Pol_P-D Product feature CHAIN JN792912_Pol_P-D of FT:mat_peptide JN792912_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 307000449). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEQELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLVMPARFYPNGTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPVGVEPSGSGHTTNLASKSASCLYQSPVRKAADSAVTTFEKHSSSGHAVELHNLPSNSARSQSERPVFPCWWLQFRNS
EPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNDRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGCSGLPRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLVSLGVHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIKQKITECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ687530_Pol_P-D Product feature CHAIN JQ687530_Pol_P-D of FT:mat_peptide JQ687530_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 200). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLKEELPRLANEDLNRRVAKDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSVRAGIHPAT
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNVPPNSARSQGERPVFPCWWLQFTHS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESKLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSTGLSRYVARVSSNSRIFNNQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFSKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGVFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPVRVHFASPLHVAWRPP
>gnl|hbvpro|JQ687531_Pol_P-D Product feature CHAIN JQ687531_Pol_P-D of FT:mat_peptide JQ687531_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 205). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTFEKHSSSGYAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNARIINHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707476_Pol_P-D Product feature CHAIN JQ707476_Pol_P-D of FT:mat_peptide JQ707476_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C1). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGFQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707478_Pol_P-D Product feature CHAIN JQ707478_Pol_P-D of FT:mat_peptide JQ707478_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707479_Pol_P-D Product feature CHAIN JQ707479_Pol_P-D of FT:mat_peptide JQ707479_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C13). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDHCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSSTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707480_Pol_P-D Product feature CHAIN JQ707480_Pol_P-D of FT:mat_peptide JQ707480_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C14). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707481_Pol_P-D Product feature CHAIN JQ707481_Pol_P-D of FT:mat_peptide JQ707481_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C16). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYKSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707482_Pol_P-D Product feature CHAIN JQ707482_Pol_P-D of FT:mat_peptide JQ707482_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C17-2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707483_Pol_P-D Product feature CHAIN JQ707483_Pol_P-D of FT:mat_peptide JQ707483_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C18). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAHPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707485_Pol_P-D Product feature CHAIN JQ707485_Pol_P-D of FT:mat_peptide JQ707485_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C22). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVNKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDHCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707486_Pol_P-D Product feature CHAIN JQ707486_Pol_P-D of FT:mat_peptide JQ707486_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C24). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707487_Pol_P-D Product feature CHAIN JQ707487_Pol_P-D of FT:mat_peptide JQ707487_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C25). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPSVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAISTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNFYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707488_Pol_P-D Product feature CHAIN JQ707488_Pol_P-D of FT:mat_peptide JQ707488_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C26). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLEKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFRAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707489_Pol_P-D Product feature CHAIN JQ707489_Pol_P-D of FT:mat_peptide JQ707489_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C28). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707490_Pol_P-D Product feature CHAIN JQ707490_Pol_P-D of FT:mat_peptide JQ707490_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C29). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGSLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707491_Pol_P-D Product feature CHAIN JQ707491_Pol_P-D of FT:mat_peptide JQ707491_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C3). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDDAGPVEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVSHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSEHNTNLASKSASCIYQSPVRKAAYPAVSTFERHSSSGHAVELHNLPPNSARSQGEMPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPTFAVPN
LQSLTNLLSSNLTWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFPLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLLTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707493_Pol_P-D Product feature CHAIN JQ707493_Pol_P-D of FT:mat_peptide JQ707493_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C31). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRSFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLGRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707494_Pol_P-D Product feature CHAIN JQ707494_Pol_P-D of FT:mat_peptide JQ707494_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707496_Pol_P-D Product feature CHAIN JQ707496_Pol_P-D of FT:mat_peptide JQ707496_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C34-2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707497_Pol_P-D Product feature CHAIN JQ707497_Pol_P-D of FT:mat_peptide JQ707497_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C36). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQQFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707499_Pol_P-D Product feature CHAIN JQ707499_Pol_P-D of FT:mat_peptide JQ707499_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C38). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQPLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDHCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKRPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707500_Pol_P-D Product feature CHAIN JQ707500_Pol_P-D of FT:mat_peptide JQ707500_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C40). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707502_Pol_P-D Product feature CHAIN JQ707502_Pol_P-D of FT:mat_peptide JQ707502_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C42). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707503_Pol_P-D Product feature CHAIN JQ707503_Pol_P-D of FT:mat_peptide JQ707503_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C43). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707505_Pol_P-D Product feature CHAIN JQ707505_Pol_P-D of FT:mat_peptide JQ707505_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C45). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGQRPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707507_Pol_P-D Product feature CHAIN JQ707507_Pol_P-D of FT:mat_peptide JQ707507_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C48). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRQAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707508_Pol_P-D Product feature CHAIN JQ707508_Pol_P-D of FT:mat_peptide JQ707508_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKYSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707512_Pol_P-D Product feature CHAIN JQ707512_Pol_P-D of FT:mat_peptide JQ707512_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C1-22). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707513_Pol_P-D Product feature CHAIN JQ707513_Pol_P-D of FT:mat_peptide JQ707513_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C11). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707514_Pol_P-D Product feature CHAIN JQ707514_Pol_P-D of FT:mat_peptide JQ707514_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707515_Pol_P-D Product feature CHAIN JQ707515_Pol_P-D of FT:mat_peptide JQ707515_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C13). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLAKRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSVSCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707516_Pol_P-D Product feature CHAIN JQ707516_Pol_P-D of FT:mat_peptide JQ707516_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C15). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARITGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707517_Pol_P-D Product feature CHAIN JQ707517_Pol_P-D of FT:mat_peptide JQ707517_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C16). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707518_Pol_P-D Product feature CHAIN JQ707518_Pol_P-D of FT:mat_peptide JQ707518_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C17-3). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707519_Pol_P-D Product feature CHAIN JQ707519_Pol_P-D of FT:mat_peptide JQ707519_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C22). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGKHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707520_Pol_P-D Product feature CHAIN JQ707520_Pol_P-D of FT:mat_peptide JQ707520_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C24). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707521_Pol_P-D Product feature CHAIN JQ707521_Pol_P-D of FT:mat_peptide JQ707521_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707522_Pol_P-D Product feature CHAIN JQ707522_Pol_P-D of FT:mat_peptide JQ707522_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C35). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707523_Pol_P-D Product feature CHAIN JQ707523_Pol_P-D of FT:mat_peptide JQ707523_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C36). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707524_Pol_P-D Product feature CHAIN JQ707524_Pol_P-D of FT:mat_peptide JQ707524_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C4). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHGVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707525_Pol_P-D Product feature CHAIN JQ707525_Pol_P-D of FT:mat_peptide JQ707525_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C40). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHGVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYTCIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707526_Pol_P-D Product feature CHAIN JQ707526_Pol_P-D of FT:mat_peptide JQ707526_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C43). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVSVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707527_Pol_P-D Product feature CHAIN JQ707527_Pol_P-D of FT:mat_peptide JQ707527_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C44). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707528_Pol_P-D Product feature CHAIN JQ707528_Pol_P-D of FT:mat_peptide JQ707528_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C45). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707529_Pol_P-D Product feature CHAIN JQ707529_Pol_P-D of FT:mat_peptide JQ707529_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C46). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSPDVFAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707530_Pol_P-D Product feature CHAIN JQ707530_Pol_P-D of FT:mat_peptide JQ707530_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C9). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKIPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ETTRSASFCGSPYSWEQKLQHGAESVHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYVDDVVLGAKSVQHLESLFTAVT
NFLFSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLARPLLCLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JQ707682_Pol_P-D Product feature CHAIN JQ707682_Pol_P-D of FT:mat_peptide JQ707682_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_1-10). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707683_Pol_P-D Product feature CHAIN JQ707683_Pol_P-D of FT:mat_peptide JQ707683_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_10). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707684_Pol_P-D Product feature CHAIN JQ707684_Pol_P-D of FT:mat_peptide JQ707684_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_11). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707685_Pol_P-D Product feature CHAIN JQ707685_Pol_P-D of FT:mat_peptide JQ707685_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_12). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707686_Pol_P-D Product feature CHAIN JQ707686_Pol_P-D of FT:mat_peptide JQ707686_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_14). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGFQSRQGHLAGRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707687_Pol_P-D Product feature CHAIN JQ707687_Pol_P-D of FT:mat_peptide JQ707687_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_15). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLFRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707688_Pol_P-D Product feature CHAIN JQ707688_Pol_P-D of FT:mat_peptide JQ707688_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_16). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707689_Pol_P-D Product feature CHAIN JQ707689_Pol_P-D of FT:mat_peptide JQ707689_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_17). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRETMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707690_Pol_P-D Product feature CHAIN JQ707690_Pol_P-D of FT:mat_peptide JQ707690_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_20). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707691_Pol_P-D Product feature CHAIN JQ707691_Pol_P-D of FT:mat_peptide JQ707691_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_25). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707692_Pol_P-D Product feature CHAIN JQ707692_Pol_P-D of FT:mat_peptide JQ707692_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_26). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707693_Pol_P-D Product feature CHAIN JQ707693_Pol_P-D of FT:mat_peptide JQ707693_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_27). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPNWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707694_Pol_P-D Product feature CHAIN JQ707694_Pol_P-D of FT:mat_peptide JQ707694_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_28). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707695_Pol_P-D Product feature CHAIN JQ707695_Pol_P-D of FT:mat_peptide JQ707695_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_29). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707696_Pol_P-D Product feature CHAIN JQ707696_Pol_P-D of FT:mat_peptide JQ707696_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_3). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707697_Pol_P-D Product feature CHAIN JQ707697_Pol_P-D of FT:mat_peptide JQ707697_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_30). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707698_Pol_P-D Product feature CHAIN JQ707698_Pol_P-D of FT:mat_peptide JQ707698_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLYQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIVGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707699_Pol_P-D Product feature CHAIN JQ707699_Pol_P-D of FT:mat_peptide JQ707699_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_35). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCHVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707700_Pol_P-D Product feature CHAIN JQ707700_Pol_P-D of FT:mat_peptide JQ707700_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_36-11). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707701_Pol_P-D Product feature CHAIN JQ707701_Pol_P-D of FT:mat_peptide JQ707701_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_37). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLTSKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707702_Pol_P-D Product feature CHAIN JQ707702_Pol_P-D of FT:mat_peptide JQ707702_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_43). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVDRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707703_Pol_P-D Product feature CHAIN JQ707703_Pol_P-D of FT:mat_peptide JQ707703_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_45). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARXSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707704_Pol_P-D Product feature CHAIN JQ707704_Pol_P-D of FT:mat_peptide JQ707704_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_5). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707705_Pol_P-D Product feature CHAIN JQ707705_Pol_P-D of FT:mat_peptide JQ707705_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_7). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSSSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ707706_Pol_P-D Product feature CHAIN JQ707706_Pol_P-D of FT:mat_peptide JQ707706_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_8-2). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRARIHPTA
RRPFGVEPSGSGHNANLASKSASCIYQSPVRKAAYPAVSTFEKHSPSGHTVELQNLPPNSTRSQSEWPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGQKLHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYIDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYSIGCYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACTHSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JQ927384_Pol_P-D Product feature CHAIN JQ927384_Pol_P-D of FT:mat_peptide JQ927384_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KM2109). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVDIPWTHKVGNFTGLYSTTVPVFNPHWKTPSFP
NIHLHQDIIDKCEQFVGPLTVNEKRRLKLIMPARFFPKCTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ESTHSASFCGSPYSWEQELQHGAESFHQQSSGIPSRSPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGVHPTA
RRPFGVEPSGSGHSTNFASKSASCLYQSPVRTAAYPAVSTSERXSXSGHTXELHYLPTNSARSQSERPVSPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNTNKTKRWGYSLHFMGYVIGCWGSLPQDHIVHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKRAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVIGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JX096954_Pol_P-D Product feature CHAIN JX096954_Pol_P-D of FT:mat_peptide JX096954_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1-3242). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGFQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPPGSGHNTNLASKSASCIHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JX096955_Pol_P-D Product feature CHAIN JX096955_Pol_P-D of FT:mat_peptide JX096955_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2-3051). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
HQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDFCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JX096956_Pol_P-D Product feature CHAIN JX096956_Pol_P-D of FT:mat_peptide JX096956_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5-6154). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRTGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JX096957_Pol_P-D Product feature CHAIN JX096957_Pol_P-D of FT:mat_peptide JX096957_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6-2646). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGFQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPPGSGHNTNLASKSASCIHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSRQAFTFSPTYKAFLYKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JX096958_Pol_P-D Product feature CHAIN JX096958_Pol_P-D of FT:mat_peptide JX096958_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7-1276). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSRQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JX470760_Pol_P-D Product feature CHAIN JX470760_Pol_P-D of FT:mat_peptide JX470760_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H-IDU6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSVRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCIHQSQDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQGERPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRISNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIQKIKACFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGASIIGTDNSVVLSRKYTSYPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|JX898689_Pol_P-D Product feature CHAIN JX898689_Pol_P-D of FT:mat_peptide JX898689_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P29). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JX898691_Pol_P-D Product feature CHAIN JX898691_Pol_P-D of FT:mat_peptide JX898691_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P17). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JX898692_Pol_P-D Product feature CHAIN JX898692_Pol_P-D of FT:mat_peptide JX898692_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P19). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTINEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSEGPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JX898694_Pol_P-D Product feature CHAIN JX898694_Pol_P-D of FT:mat_peptide JX898694_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P24). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPTVSTFEKHSSSGHAVEFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPTKTKRWGYSLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|JX898697_Pol_P-D Product feature CHAIN JX898697_Pol_P-D of FT:mat_peptide JX898697_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQSERPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIRQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCXANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC012652_Pol_P-D Product feature CHAIN KC012652_Pol_P-D of FT:mat_peptide KC012652_Pol_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLHHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSVRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCIHQSQDRKAAYPAVSTFEKHSSSGHAVEFHNLSPNSARSQGERPVFPCWWLQFRSS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSTSRISNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKTVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGSYGSLPQEHIIQKIKACFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFADATPTGWGLAMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGASIIGTDNSVVLSRKYTSYPWLLGCTANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|KC875275_Pol_P-D Product feature CHAIN KC875275_Pol_P-D of FT:mat_peptide KC875275_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV39). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSLVGKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCCWLQFRNS
QPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875276_Pol_P-D Product feature CHAIN KC875276_Pol_P-D of FT:mat_peptide KC875276_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV6). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRSLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAACPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLCSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRVFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875277_Pol_P-D Product feature CHAIN KC875277_Pol_P-D of FT:mat_peptide KC875277_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV7). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPCGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARAQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875278_Pol_P-D Product feature CHAIN KC875278_Pol_P-D of FT:mat_peptide KC875278_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV38). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PPLMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875279_Pol_P-D Product feature CHAIN KC875279_Pol_P-D of FT:mat_peptide KC875279_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV11). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSDHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTIQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875280_Pol_P-D Product feature CHAIN KC875280_Pol_P-D of FT:mat_peptide KC875280_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV20). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRTLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875281_Pol_P-D Product feature CHAIN KC875281_Pol_P-D of FT:mat_peptide KC875281_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV32). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNPPPNSARSQSESPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875282_Pol_P-D Product feature CHAIN KC875282_Pol_P-D of FT:mat_peptide KC875282_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV13). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQTQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSRHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKPFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPA
>gnl|hbvpro|KC875283_Pol_P-D Product feature CHAIN KC875283_Pol_P-D of FT:mat_peptide KC875283_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV15). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIRPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNVLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875284_Pol_P-D Product feature CHAIN KC875284_Pol_P-D of FT:mat_peptide KC875284_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV28). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNDKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875285_Pol_P-D Product feature CHAIN KC875285_Pol_P-D of FT:mat_peptide KC875285_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV29). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSRVRKAAYPAVSTFEKDSSSGHAVELHNPPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875286_Pol_P-D Product feature CHAIN KC875286_Pol_P-D of FT:mat_peptide KC875286_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV17). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLCKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLQPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875287_Pol_P-D Product feature CHAIN KC875287_Pol_P-D of FT:mat_peptide KC875287_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV18). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSPGHAVELHNLPPNSARSQSERPVFPCWWLHFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875288_Pol_P-D Product feature CHAIN KC875288_Pol_P-D of FT:mat_peptide KC875288_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV56). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHATNLASRSASCLYQSPVRKAAYPADSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875289_Pol_P-D Product feature CHAIN KC875289_Pol_P-D of FT:mat_peptide KC875289_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV55). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSQPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHATNLASRSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875290_Pol_P-D Product feature CHAIN KC875290_Pol_P-D of FT:mat_peptide KC875290_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV57). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNPPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDLGTCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQQLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875291_Pol_P-D Product feature CHAIN KC875291_Pol_P-D of FT:mat_peptide KC875291_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV58). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKSYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPADSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHPRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875292_Pol_P-D Product feature CHAIN KC875292_Pol_P-D of FT:mat_peptide KC875292_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV21). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHHKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTSERHSSSGHAVELHNLPPNSARSQSERPVFSCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIRQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPAYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875293_Pol_P-D Product feature CHAIN KC875293_Pol_P-D of FT:mat_peptide KC875293_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV69). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDLGTCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875294_Pol_P-D Product feature CHAIN KC875294_Pol_P-D of FT:mat_peptide KC875294_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV70). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDLGTCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875295_Pol_P-D Product feature CHAIN KC875295_Pol_P-D of FT:mat_peptide KC875295_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV81). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHATNLASRSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDLGTCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875296_Pol_P-D Product feature CHAIN KC875296_Pol_P-D of FT:mat_peptide KC875296_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV82). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHATNLASRSASCLYQSPVRKAAYPADSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875297_Pol_P-D Product feature CHAIN KC875297_Pol_P-D of FT:mat_peptide KC875297_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV84). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSQPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875299_Pol_P-D Product feature CHAIN KC875299_Pol_P-D of FT:mat_peptide KC875299_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV85). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDLGTCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875300_Pol_P-D Product feature CHAIN KC875300_Pol_P-D of FT:mat_peptide KC875300_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV80). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875301_Pol_P-D Product feature CHAIN KC875301_Pol_P-D of FT:mat_peptide KC875301_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV89). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875302_Pol_P-D Product feature CHAIN KC875302_Pol_P-D of FT:mat_peptide KC875302_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV86). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSQPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPADSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875303_Pol_P-D Product feature CHAIN KC875303_Pol_P-D of FT:mat_peptide KC875303_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV92). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPADSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLHFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875304_Pol_P-D Product feature CHAIN KC875304_Pol_P-D of FT:mat_peptide KC875304_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV91). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEHELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPADSTFEKHSSSDHAVELHNLPPNSARSQSERPVFPCWWLHFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAIGSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYPDSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875305_Pol_P-D Product feature CHAIN KC875305_Pol_P-D of FT:mat_peptide KC875305_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV41). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDLGTCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYESLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875306_Pol_P-D Product feature CHAIN KC875306_Pol_P-D of FT:mat_peptide KC875306_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV71). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDLGTCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875308_Pol_P-D Product feature CHAIN KC875308_Pol_P-D of FT:mat_peptide KC875308_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV72). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDLGTCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875309_Pol_P-D Product feature CHAIN KC875309_Pol_P-D of FT:mat_peptide KC875309_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV43). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCERIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPLARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875310_Pol_P-D Product feature CHAIN KC875310_Pol_P-D of FT:mat_peptide KC875310_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV9). Complete genome. [Hepadnaviridae] (length=832 residues).
MRLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTKNLASKSASCIYQSPVRKAVYPAVSTFEKHSSSGHAVELHNLPPNSARAQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAKFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875311_Pol_P-D Product feature CHAIN KC875311_Pol_P-D of FT:mat_peptide KC875311_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV10). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRRASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLHFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875312_Pol_P-D Product feature CHAIN KC875312_Pol_P-D of FT:mat_peptide KC875312_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV22). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKSASCIYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQGERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPVHVAWRPP
>gnl|hbvpro|KC875313_Pol_P-D Product feature CHAIN KC875313_Pol_P-D of FT:mat_peptide KC875313_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV25). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVGPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPHLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875316_Pol_P-D Product feature CHAIN KC875316_Pol_P-D of FT:mat_peptide KC875316_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV16). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEIHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
RQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNVYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPSGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPCRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875317_Pol_P-D Product feature CHAIN KC875317_Pol_P-D of FT:mat_peptide KC875317_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV48). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875319_Pol_P-D Product feature CHAIN KC875319_Pol_P-D of FT:mat_peptide KC875319_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV30). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPHLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875320_Pol_P-D Product feature CHAIN KC875320_Pol_P-D of FT:mat_peptide KC875320_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV31). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAHPAVSTFEKQSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875321_Pol_P-D Product feature CHAIN KC875321_Pol_P-D of FT:mat_peptide KC875321_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV19). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQRHLARRQQGRSWTIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875322_Pol_P-D Product feature CHAIN KC875322_Pol_P-D of FT:mat_peptide KC875322_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV54). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSQPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHATNFASRSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875323_Pol_P-D Product feature CHAIN KC875323_Pol_P-D of FT:mat_peptide KC875323_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV53). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSQPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHATNFASRSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875324_Pol_P-D Product feature CHAIN KC875324_Pol_P-D of FT:mat_peptide KC875324_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV59). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPPEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEKDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPHSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875325_Pol_P-D Product feature CHAIN KC875325_Pol_P-D of FT:mat_peptide KC875325_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV60). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGGESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNPPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPHLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875328_Pol_P-D Product feature CHAIN KC875328_Pol_P-D of FT:mat_peptide KC875328_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV83). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHATNFASRSASCLHQSPVRKAAYPAVSTFEKHSFSGHAVELHNLPPNSARFQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875329_Pol_P-D Product feature CHAIN KC875329_Pol_P-D of FT:mat_peptide KC875329_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV90). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPHYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSQPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHATNFASRSASCLHQSPVRKAAYPADSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPLARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875330_Pol_P-D Product feature CHAIN KC875330_Pol_P-D of FT:mat_peptide KC875330_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV87). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHATNFASRSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECVRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875331_Pol_P-D Product feature CHAIN KC875331_Pol_P-D of FT:mat_peptide KC875331_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV88). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSAHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875332_Pol_P-D Product feature CHAIN KC875332_Pol_P-D of FT:mat_peptide KC875332_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV42). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875333_Pol_P-D Product feature CHAIN KC875333_Pol_P-D of FT:mat_peptide KC875333_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV75). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGEESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHATNFASRSASCLHQSPVRKAAYPADSTFEKHSSSRHAVELHNLPPNSARSQSERPVFPCWSLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPHLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875334_Pol_P-D Product feature CHAIN KC875334_Pol_P-D of FT:mat_peptide KC875334_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV47). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPHLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875335_Pol_P-D Product feature CHAIN KC875335_Pol_P-D of FT:mat_peptide KC875335_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV44). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPPYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875336_Pol_P-D Product feature CHAIN KC875336_Pol_P-D of FT:mat_peptide KC875336_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV45). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCRSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGLLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNFASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGQHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPDLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFSAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875337_Pol_P-D Product feature CHAIN KC875337_Pol_P-D of FT:mat_peptide KC875337_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV46). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQDLQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGFHPTA
RRPFGVEPSGSGHTTNIASKSASCLHQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPSRVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRILNHQHGTMPNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCYGSLPQEHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSPGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875340_Pol_P-D Product feature CHAIN KC875340_Pol_P-D of FT:mat_peptide KC875340_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV34). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLAVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPAGSGHTTNLASKSASCSYQSPVRKAAYPTVSTSERHSSSGHAVDFHNLPPSSARSQSERPVFPCWWLKFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCWGSLPQEHIIHKLKECFRKLPVNRPIDWKVCKRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KC875342_Pol_P-D Product feature CHAIN KC875342_Pol_P-D of FT:mat_peptide KC875342_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV79). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIINKCEQFVGPLTVNEKRRLQLIMPARFYPNFTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQKLQHGAESFHQQSSGILSRPPVGSSLQSKHQKSRLGLQSQQGHLARRQQGRSWSIRARVHPTA
RRPFGVEPAGSGHTTNLASKSASCSYQSPVRKAAYPTVSTSERHSSSGHAVDLHNLPPRSARSQSERPVFPCWWLKFRNS
KPCSDYCLSHIVNLLEDWGPCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFDHQHGTMQNLHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCWGSLAQEHIIHKLKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRPLIRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF053178_Pol_P-D Product feature CHAIN KF053178_Pol_P-D of FT:mat_peptide KF053178_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MY62981). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQRFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHIVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQKLQHGAESFHQQSSGVLSRPPIGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHNTNLASKPASCIYQSPIRKAADPAVSTFERYSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCDEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGDHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQRGTMQNMHDYCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHREALFTAVT
NFLLSLGIHLNPHKTKRWGYSLNFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF061167_Pol_P-D Product feature CHAIN KF061167_Pol_P-D of FT:mat_peptide KF061167_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_1a). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYXHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRXGIHPTA
RRPFGVEPSGPGHTTNLASTSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
RPCSDYCLSHIVNLLEDWGPCAEHGGHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKXVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQXIKECFRKLPVNRPIDWKVCQRIVGHLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|KF061168_Pol_P-D Product feature CHAIN KF061168_Pol_P-D of FT:mat_peptide KF061168_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_3a). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTX
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKXSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
RPCSDYCLSHIVNLLEDWGPCAEHGGHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGHLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|KF061169_Pol_P-D Product feature CHAIN KF061169_Pol_P-D of FT:mat_peptide KF061169_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_7a). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGXXXKR
ETTHSASFCGSPYSWEQELQHGAESFHXXSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPVGVEPSGSGHSTNLASXSASCLYQXPVRKAAYPSVSTFEXHSSSGHAVXXHNLPPNXARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGHLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|KF061170_Pol_P-D Product feature CHAIN KF061170_Pol_P-D of FT:mat_peptide KF061170_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_13a). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPXHLVNHYFQTRHXXXTLWKAGXXXKR
ETXXSASFCGSPXSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARCQQGRSWSLRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVSLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGHLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|KF192830_Pol_P-D Product feature CHAIN KF192830_Pol_P-D of FT:mat_peptide KF192830_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP71). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQNIIEKCEQFVGPLTVNEKRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNQNFQTRHYLHTLWKAGVLYKR
ESTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKFQQSRLGLQSQQGHLARRQQGRSWSIRARVHPAA
RRSFGVEPSGSGHNANLASKSASCLYQSPVRTAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGNMQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGSLPQDHIILKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRFGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDHVHFASPLHVAWRPP
>gnl|hbvpro|KF192831_Pol_P-D Product feature CHAIN KF192831_Pol_P-D of FT:mat_peptide KF192831_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP59). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQNIIEKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ESTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKFQQSRLGLQSQQGHLARRQQGRSWSIRARVHPAA
RRSFGVEPSGSGHNANLASKSASCLYQSPVRTAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGNLQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGSLPQDHIILKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRFGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDHVHFASPLHVAWRPP
>gnl|hbvpro|KF192832_Pol_P-D Product feature CHAIN KF192832_Pol_P-D of FT:mat_peptide KF192832_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP67). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQNIIEKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ESTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKFQQSRLGLQSQQGHLARRQQGRSWSIRARVHPAA
RRSFGVEPSGSGHNANLASKSASCLYQSPVRTAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGNLQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGSLPQDHIILKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRFGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDHVHFASPLHVAWRPP
>gnl|hbvpro|KF192834_Pol_P-D Product feature CHAIN KF192834_Pol_P-D of FT:mat_peptide KF192834_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP63). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQNIIEKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGVLYKR
ESTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKFQQSRLGLQSQQGHLARRQQGRSWSIRARVHPAA
RRSFGVEPSGSGHNANLASKSASCLYQSPVRTAAYPAVSTSEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSLIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGNLQNLHDSCSRNLYVSLL
LLYKTFGWKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTSIT
NFLLSLGIHLNPNKTKRWGYSLNFMGYVIGCWGSLPQDHIILKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCQQYLNLYPVARQRSGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRFGANVLGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGPCRPLLCLPFRPTTG
RTSLYADSPSVPSHLPDHVHFASPLHVAWRPP
>gnl|hbvpro|KF471640_Pol_P-D Product feature CHAIN KF471640_Pol_P-D of FT:mat_peptide KF471640_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-86). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQEIQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGPGHTTNLASKSASCLNQSPVRKAAYPTVSTFKKHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLIEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGGYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFPAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWKPP
>gnl|hbvpro|KF471641_Pol_P-D Product feature CHAIN KF471641_Pol_P-D of FT:mat_peptide KF471641_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-66). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLCLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVSTSEKHSSSGHAVELHNLPPKSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLSLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471642_Pol_P-D Product feature CHAIN KF471642_Pol_P-D of FT:mat_peptide KF471642_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-65). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNVDIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCFYQSPVRKAAYPSVSTFERHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSDLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLM
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLESLYTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471644_Pol_P-D Product feature CHAIN KF471644_Pol_P-D of FT:mat_peptide KF471644_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-52). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGSFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHSKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHITNLANKSASCLYQSSVRKAAYPSVSTFEKHTSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVGSSGLSRYVARLSYDSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVHHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCHGSLPQDHIIQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVEWRPP
>gnl|hbvpro|KF471645_Pol_P-D Product feature CHAIN KF471645_Pol_P-D of FT:mat_peptide KF471645_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-50). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIITKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSPVRKAAYPSVTTVEKHSSSGHAVELHNIPPNSARSQSERPVFTCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVDLSPFLLTQITSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471646_Pol_P-D Product feature CHAIN KF471646_Pol_P-D of FT:mat_peptide KF471646_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-37). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLYQSSVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVPHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGSYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPYYLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471647_Pol_P-D Product feature CHAIN KF471647_Pol_P-D of FT:mat_peptide KF471647_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-35). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTT
RRPFGVEPSSSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPHKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALKPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471649_Pol_P-D Product feature CHAIN KF471649_Pol_P-D of FT:mat_peptide KF471649_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-31). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGPLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTSESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYKTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471650_Pol_P-D Product feature CHAIN KF471650_Pol_P-D of FT:mat_peptide KF471650_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-25). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSASCLYQSSVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERLVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNHRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIVNHQHGIMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPINRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFQAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471651_Pol_P-D Product feature CHAIN KF471651_Pol_P-D of FT:mat_peptide KF471651_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRSPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSTSCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471652_Pol_P-D Product feature CHAIN KF471652_Pol_P-D of FT:mat_peptide KF471652_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-20). Non-functional genomic sequence. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRSPVGPSLQSKHRKSRLGLQSQQGHLARRQQGRGWSIRAGIHPTA
RRPFGVEPSGSGHTTNLASKSTSCLYQSPVRKAAYPAVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSYPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471654_Pol_P-D Product feature CHAIN KF471654_Pol_P-D of FT:mat_peptide KF471654_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-14). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTRSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTA
RRPFGVEPSGSGHTTNLANKSASCLDQSPVRKAAYPSVTTFERHASSGHAVELHNLPPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVSHLEALFTAVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471655_Pol_P-D Product feature CHAIN KF471655_Pol_P-D of FT:mat_peptide KF471655_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-11). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKKCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHSLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEXSGSGHTTNLASKSASCLYKSPVRKAAYPAVSTFERHSSSGHAVELHDFSPNSARSQSERPVFPCWWLQFRNS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNYQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTAVS
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANILGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASPLHVAWRPP
>gnl|hbvpro|KF471656_Pol_P-D Product feature CHAIN KF471656_Pol_P-D of FT:mat_peptide KF471656_Pol_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-8). Complete genome. [Hepadnaviridae] (length=832 residues).
MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFP
NIHLHQDIIKRCEQFVGPLTVNEKRRLQLIMPARFYPNVTKYLPLDKGIKPYYPEHLVNHYFQTRHYLHTLWKAGILYKR
ETTHSASFCGSPYSWEQELQHGAESFHQQSSGILSRPPVGSSLQSKHRKSRLGLQSQQGHLARRQQGRSWSIRAGIHPTS
RRPFGVEPSGSGHTTNLASKSASCLYQSPVRKAAYPSVSTFEKHSSSGHAVELHNLPPNSARSQSERPVFPCWWLQFRTS
KPCSDYCLSHIVNLLEDWGPCAEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGNYRVSWPKFAVPN
LQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIFNHQHGTMQNLHDSCSRNLYVSLL
LLYQTFGRKLHLYSHPIILGFRKIPKGVGLSPFLLVQFTSAICSVVRRAFPHCLAFSYMDDVVLGAKSVQHLESLFTSVT
NFLLSLGIHLNPNKTKRWGYSLHFMGYVIGCYGSLPQDHIIQKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCGY
PALMPLYACIQSKQAFTFSPTYKAFLCTQYLNLYPVARQRPGLCQVFADATPTGWGLVMGHQRMRGTFLAPLPIHTAELL
AACFARSRSGANIIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLSRPLLRLPFRPTTG
RTSLYADSPSVPSHLPDRVHFASP