HBVdb

Dataset for protein SHBs of genotype D

[Download (right click)] [Alignment] [Repertoires]

4583 sequence(s)

>gnl|hbvpro|AB048701_SHBs_P-D Product feature CHAIN AB048701_SHBs_P-D of FT:mat_peptide AB048701_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCVGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFYLWVYI
>gnl|hbvpro|AB078031_SHBs_P-D Product feature CHAIN AB078031_SHBs_P-D of FT:mat_peptide AB078031_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FH1-YS). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB078032_SHBs_P-D Product feature CHAIN AB078032_SHBs_P-D of FT:mat_peptide AB078032_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AH1-SY). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB078033_SHBs_P-D Product feature CHAIN AB078033_SHBs_P-D of FT:mat_peptide AB078033_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IS1-OY). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB090268_SHBs_P-D Product feature CHAIN AB090268_SHBs_P-D of FT:mat_peptide AB090268_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB090269_SHBs_P-D Product feature CHAIN AB090269_SHBs_P-D of FT:mat_peptide AB090269_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB090270_SHBs_P-D Product feature CHAIN AB090270_SHBs_P-D of FT:mat_peptide AB090270_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB104709_SHBs_P-D Product feature CHAIN AB104709_SHBs_P-D of FT:mat_peptide AB104709_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG64). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB104710_SHBs_P-D Product feature CHAIN AB104710_SHBs_P-D of FT:mat_peptide AB104710_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG105). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB104711_SHBs_P-D Product feature CHAIN AB104711_SHBs_P-D of FT:mat_peptide AB104711_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG104). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWSWGPSLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB104712_SHBs_P-D Product feature CHAIN AB104712_SHBs_P-D of FT:mat_peptide AB104712_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG75). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109475_SHBs_P-D Product feature CHAIN AB109475_SHBs_P-D of FT:mat_peptide AB109475_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109476_SHBs_P-D Product feature CHAIN AB109476_SHBs_P-D of FT:mat_peptide AB109476_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109477_SHBs_P-D Product feature CHAIN AB109477_SHBs_P-D of FT:mat_peptide AB109477_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109478_SHBs_P-D Product feature CHAIN AB109478_SHBs_P-D of FT:mat_peptide AB109478_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109479_SHBs_P-D Product feature CHAIN AB109479_SHBs_P-D of FT:mat_peptide AB109479_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109480_SHBs_P-D Product feature CHAIN AB109480_SHBs_P-D of FT:mat_peptide AB109480_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLLAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109481_SHBs_P-D Product feature CHAIN AB109481_SHBs_P-D of FT:mat_peptide AB109481_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109482_SHBs_P-D Product feature CHAIN AB109482_SHBs_P-D of FT:mat_peptide AB109482_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109483_SHBs_P-D Product feature CHAIN AB109483_SHBs_P-D of FT:mat_peptide AB109483_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLCILQLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109484_SHBs_P-D Product feature CHAIN AB109484_SHBs_P-D of FT:mat_peptide AB109484_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109485_SHBs_P-D Product feature CHAIN AB109485_SHBs_P-D of FT:mat_peptide AB109485_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109486_SHBs_P-D Product feature CHAIN AB109486_SHBs_P-D of FT:mat_peptide AB109486_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109487_SHBs_P-D Product feature CHAIN AB109487_SHBs_P-D of FT:mat_peptide AB109487_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB109488_SHBs_P-D Product feature CHAIN AB109488_SHBs_P-D of FT:mat_peptide AB109488_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB110075_SHBs_P-D Product feature CHAIN AB110075_SHBs_P-D of FT:mat_peptide AB110075_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB116266_SHBs_P-D Product feature CHAIN AB116266_SHBs_P-D of FT:mat_peptide AB116266_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119251_SHBs_P-D Product feature CHAIN AB119251_SHBs_P-D of FT:mat_peptide AB119251_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119252_SHBs_P-D Product feature CHAIN AB119252_SHBs_P-D of FT:mat_peptide AB119252_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119253_SHBs_P-D Product feature CHAIN AB119253_SHBs_P-D of FT:mat_peptide AB119253_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119254_SHBs_P-D Product feature CHAIN AB119254_SHBs_P-D of FT:mat_peptide AB119254_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119255_SHBs_P-D Product feature CHAIN AB119255_SHBs_P-D of FT:mat_peptide AB119255_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IICLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB119256_SHBs_P-D Product feature CHAIN AB119256_SHBs_P-D of FT:mat_peptide AB119256_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLLAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB120308_SHBs_P-D Product feature CHAIN AB120308_SHBs_P-D of FT:mat_peptide AB120308_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB126581_SHBs_P-D Product feature CHAIN AB126581_SHBs_P-D of FT:mat_peptide AB126581_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU301). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTWTTPGQGTSMYPSWCWTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB188241_SHBs_P-D Product feature CHAIN AB188241_SHBs_P-D of FT:mat_peptide AB188241_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVYPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB188242_SHBs_P-D Product feature CHAIN AB188242_SHBs_P-D of FT:mat_peptide AB188242_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA38). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB188244_SHBs_P-D Product feature CHAIN AB188244_SHBs_P-D of FT:mat_peptide AB188244_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZ24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMWPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB205126_SHBs_P-D Product feature CHAIN AB205126_SHBs_P-D of FT:mat_peptide AB205126_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-IF714-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205127_SHBs_P-D Product feature CHAIN AB205127_SHBs_P-D of FT:mat_peptide AB205127_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU313-2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB205128_SHBs_P-D Product feature CHAIN AB205128_SHBs_P-D of FT:mat_peptide AB205128_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU316-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRIFTIPQSLDSWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFPFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSSTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB210820_SHBs_P-D Product feature CHAIN AB210820_SHBs_P-D of FT:mat_peptide AB210820_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB210821_SHBs_P-D Product feature CHAIN AB210821_SHBs_P-D of FT:mat_peptide AB210821_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB210822_SHBs_P-D Product feature CHAIN AB210822_SHBs_P-D of FT:mat_peptide AB210822_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222709_SHBs_P-D Product feature CHAIN AB222709_SHBs_P-D of FT:mat_peptide AB222709_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222710_SHBs_P-D Product feature CHAIN AB222710_SHBs_P-D of FT:mat_peptide AB222710_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6M). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFCWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222711_SHBs_P-D Product feature CHAIN AB222711_SHBs_P-D of FT:mat_peptide AB222711_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNV24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222712_SHBs_P-D Product feature CHAIN AB222712_SHBs_P-D of FT:mat_peptide AB222712_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV61). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIXSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222713_SHBs_P-D Product feature CHAIN AB222713_SHBs_P-D of FT:mat_peptide AB222713_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB222782_SHBs_P-D Product feature CHAIN AB222782_SHBs_P-D of FT:mat_peptide AB222782_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CN608). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246347_SHBs_P-D Product feature CHAIN AB246347_SHBs_P-D of FT:mat_peptide AB246347_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB246348_SHBs_P-D Product feature CHAIN AB246348_SHBs_P-D of FT:mat_peptide AB246348_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQSSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB267090_SHBs_P-D Product feature CHAIN AB267090_SHBs_P-D of FT:mat_peptide AB267090_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ehime 22-HS). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270537_SHBs_P-D Product feature CHAIN AB270537_SHBs_P-D of FT:mat_peptide AB270537_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL22F). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270539_SHBs_P-D Product feature CHAIN AB270539_SHBs_P-D of FT:mat_peptide AB270539_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL200F). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCIKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270540_SHBs_P-D Product feature CHAIN AB270540_SHBs_P-D of FT:mat_peptide AB270540_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL241F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270541_SHBs_P-D Product feature CHAIN AB270541_SHBs_P-D of FT:mat_peptide AB270541_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL47F). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRMXSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|AB270542_SHBs_P-D Product feature CHAIN AB270542_SHBs_P-D of FT:mat_peptide AB270542_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL12F). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270543_SHBs_P-D Product feature CHAIN AB270543_SHBs_P-D of FT:mat_peptide AB270543_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL209F). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270546_SHBs_P-D Product feature CHAIN AB270546_SHBs_P-D of FT:mat_peptide AB270546_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL88F). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270547_SHBs_P-D Product feature CHAIN AB270547_SHBs_P-D of FT:mat_peptide AB270547_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL295F). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB270548_SHBs_P-D Product feature CHAIN AB270548_SHBs_P-D of FT:mat_peptide AB270548_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL207F). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB270550_SHBs_P-D Product feature CHAIN AB270550_SHBs_P-D of FT:mat_peptide AB270550_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL247F). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB330367_SHBs_P-D Product feature CHAIN AB330367_SHBs_P-D of FT:mat_peptide AB330367_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ14HBV). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRLMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB330369_SHBs_P-D Product feature CHAIN AB330369_SHBs_P-D of FT:mat_peptide AB330369_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ5HBV). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB330370_SHBs_P-D Product feature CHAIN AB330370_SHBs_P-D of FT:mat_peptide AB330370_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ6HBV). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB471856_SHBs_P-D Product feature CHAIN AB471856_SHBs_P-D of FT:mat_peptide AB471856_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB471857_SHBs_P-D Product feature CHAIN AB471857_SHBs_P-D of FT:mat_peptide AB471857_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB493846_SHBs_P-D Product feature CHAIN AB493846_SHBs_P-D of FT:mat_peptide AB493846_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17UC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB555496_SHBs_P-D Product feature CHAIN AB555496_SHBs_P-D of FT:mat_peptide AB555496_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA31). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGALLMIQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB555497_SHBs_P-D Product feature CHAIN AB555497_SHBs_P-D of FT:mat_peptide AB555497_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA37). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB555500_SHBs_P-D Product feature CHAIN AB555500_SHBs_P-D of FT:mat_peptide AB555500_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA64). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTCCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLLNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB555501_SHBs_P-D Product feature CHAIN AB555501_SHBs_P-D of FT:mat_peptide AB555501_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA65). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFLCLWVFI
>gnl|hbvpro|AB561825_SHBs_P-D Product feature CHAIN AB561825_SHBs_P-D of FT:mat_peptide AB561825_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561826_SHBs_P-D Product feature CHAIN AB561826_SHBs_P-D of FT:mat_peptide AB561826_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQCPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561827_SHBs_P-D Product feature CHAIN AB561827_SHBs_P-D of FT:mat_peptide AB561827_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ED84_PRES2+S). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561828_SHBs_P-D Product feature CHAIN AB561828_SHBs_P-D of FT:mat_peptide AB561828_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ED271). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561829_SHBs_P-D Product feature CHAIN AB561829_SHBs_P-D of FT:mat_peptide AB561829_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F34-son-c). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYSILSPFXPLLPIFFCLRVYI
>gnl|hbvpro|AB561830_SHBs_P-D Product feature CHAIN AB561830_SHBs_P-D of FT:mat_peptide AB561830_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ED226_PRES2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561831_SHBs_P-D Product feature CHAIN AB561831_SHBs_P-D of FT:mat_peptide AB561831_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ED275_PRES2+S). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561832_SHBs_P-D Product feature CHAIN AB561832_SHBs_P-D of FT:mat_peptide AB561832_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F4-daughter). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561833_SHBs_P-D Product feature CHAIN AB561833_SHBs_P-D of FT:mat_peptide AB561833_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F4-grand-duaghter). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561834_SHBs_P-D Product feature CHAIN AB561834_SHBs_P-D of FT:mat_peptide AB561834_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F4-grandmother). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPXCPLIPGSSTTSTGPCRTCTTPAQGXSMYPSXCCTKPSDGNCTCIXXXSSXAFAK
LLWEWASARFSWLXLLVPFVQWFXGLSPIVWLSVIWMMWYWGPXLYSILSPFLPLLPIIFCLWVYI
>gnl|hbvpro|AB561835_SHBs_P-D Product feature CHAIN AB561835_SHBs_P-D of FT:mat_peptide AB561835_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F4 daughter). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTXTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561836_SHBs_P-D Product feature CHAIN AB561836_SHBs_P-D of FT:mat_peptide AB561836_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ED169). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLLTFFCLWVYI
>gnl|hbvpro|AB561837_SHBs_P-D Product feature CHAIN AB561837_SHBs_P-D of FT:mat_peptide AB561837_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F37-Wife). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVXQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFAQWFVELSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561838_SHBs_P-D Product feature CHAIN AB561838_SHBs_P-D of FT:mat_peptide AB561838_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F37-Husband). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFAQWFVELSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561839_SHBs_P-D Product feature CHAIN AB561839_SHBs_P-D of FT:mat_peptide AB561839_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3-Daughter). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561840_SHBs_P-D Product feature CHAIN AB561840_SHBs_P-D of FT:mat_peptide AB561840_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3-Mother). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPXTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561842_SHBs_P-D Product feature CHAIN AB561842_SHBs_P-D of FT:mat_peptide AB561842_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ED86). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561843_SHBs_P-D Product feature CHAIN AB561843_SHBs_P-D of FT:mat_peptide AB561843_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F34-son-D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561844_SHBs_P-D Product feature CHAIN AB561844_SHBs_P-D of FT:mat_peptide AB561844_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F35-Father). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|AB561845_SHBs_P-D Product feature CHAIN AB561845_SHBs_P-D of FT:mat_peptide AB561845_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F35-Daughter). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|AB561846_SHBs_P-D Product feature CHAIN AB561846_SHBs_P-D of FT:mat_peptide AB561846_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F43-Daughter). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTAAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561847_SHBs_P-D Product feature CHAIN AB561847_SHBs_P-D of FT:mat_peptide AB561847_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F43-Father). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTAAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561848_SHBs_P-D Product feature CHAIN AB561848_SHBs_P-D of FT:mat_peptide AB561848_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F55). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561849_SHBs_P-D Product feature CHAIN AB561849_SHBs_P-D of FT:mat_peptide AB561849_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F19-Husband). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561850_SHBs_P-D Product feature CHAIN AB561850_SHBs_P-D of FT:mat_peptide AB561850_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F4-grand-daughter). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561851_SHBs_P-D Product feature CHAIN AB561851_SHBs_P-D of FT:mat_peptide AB561851_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ED124). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRTLSPYLPLLLIFFCLWVYI
>gnl|hbvpro|AB561852_SHBs_P-D Product feature CHAIN AB561852_SHBs_P-D of FT:mat_peptide AB561852_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ED161). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSNTSTGPCRTCTTTAQGTSQYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561853_SHBs_P-D Product feature CHAIN AB561853_SHBs_P-D of FT:mat_peptide AB561853_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F36-Brother). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCIKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561854_SHBs_P-D Product feature CHAIN AB561854_SHBs_P-D of FT:mat_peptide AB561854_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F45). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFSLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB561855_SHBs_P-D Product feature CHAIN AB561855_SHBs_P-D of FT:mat_peptide AB561855_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ED81). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLXFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|AB561856_SHBs_P-D Product feature CHAIN AB561856_SHBs_P-D of FT:mat_peptide AB561856_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F36-Mother). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGYFLXTRILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPICPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWXSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCTILSPYIPLLPXFFCLWVYI
>gnl|hbvpro|AB583680_SHBs_P-D Product feature CHAIN AB583680_SHBs_P-D of FT:mat_peptide AB583680_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pkst7912). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674403_SHBs_P-D Product feature CHAIN AB674403_SHBs_P-D of FT:mat_peptide AB674403_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD87). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSLTVWLSVIWMMWYWGPSLFSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|AB674405_SHBs_P-D Product feature CHAIN AB674405_SHBs_P-D of FT:mat_peptide AB674405_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraHCCA12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674406_SHBs_P-D Product feature CHAIN AB674406_SHBs_P-D of FT:mat_peptide AB674406_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGATVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674407_SHBs_P-D Product feature CHAIN AB674407_SHBs_P-D of FT:mat_peptide AB674407_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB674408_SHBs_P-D Product feature CHAIN AB674408_SHBs_P-D of FT:mat_peptide AB674408_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD83). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674409_SHBs_P-D Product feature CHAIN AB674409_SHBs_P-D of FT:mat_peptide AB674409_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD40). Partial genome (Contains: HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674411_SHBs_P-D Product feature CHAIN AB674411_SHBs_P-D of FT:mat_peptide AB674411_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD84). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWFSVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674413_SHBs_P-D Product feature CHAIN AB674413_SHBs_P-D of FT:mat_peptide AB674413_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB27). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPGLYNILSPFFPLLPPFFCLWVYI
>gnl|hbvpro|AB674414_SHBs_P-D Product feature CHAIN AB674414_SHBs_P-D of FT:mat_peptide AB674414_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE33). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AB674415_SHBs_P-D Product feature CHAIN AB674415_SHBs_P-D of FT:mat_peptide AB674415_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC24). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB674416_SHBs_P-D Product feature CHAIN AB674416_SHBs_P-D of FT:mat_peptide AB674416_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE19). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674417_SHBs_P-D Product feature CHAIN AB674417_SHBs_P-D of FT:mat_peptide AB674417_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraLCE1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674418_SHBs_P-D Product feature CHAIN AB674418_SHBs_P-D of FT:mat_peptide AB674418_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC7). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674419_SHBs_P-D Product feature CHAIN AB674419_SHBs_P-D of FT:mat_peptide AB674419_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWCWGPSLYSILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|AB674420_SHBs_P-D Product feature CHAIN AB674420_SHBs_P-D of FT:mat_peptide AB674420_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunLCD2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAK
YLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AB674422_SHBs_P-D Product feature CHAIN AB674422_SHBs_P-D of FT:mat_peptide AB674422_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE15). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674423_SHBs_P-D Product feature CHAIN AB674423_SHBs_P-D of FT:mat_peptide AB674423_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674424_SHBs_P-D Product feature CHAIN AB674424_SHBs_P-D of FT:mat_peptide AB674424_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTSPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674425_SHBs_P-D Product feature CHAIN AB674425_SHBs_P-D of FT:mat_peptide AB674425_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674426_SHBs_P-D Product feature CHAIN AB674426_SHBs_P-D of FT:mat_peptide AB674426_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD50). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674427_SHBs_P-D Product feature CHAIN AB674427_SHBs_P-D of FT:mat_peptide AB674427_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD54). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLLRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674428_SHBs_P-D Product feature CHAIN AB674428_SHBs_P-D of FT:mat_peptide AB674428_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IstambulB26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTSPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674429_SHBs_P-D Product feature CHAIN AB674429_SHBs_P-D of FT:mat_peptide AB674429_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD89). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPRIPGTSTTSTGPCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB674431_SHBs_P-D Product feature CHAIN AB674431_SHBs_P-D of FT:mat_peptide AB674431_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLGLLAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB786644_SHBs_P-D Product feature CHAIN AB786644_SHBs_P-D of FT:mat_peptide AB786644_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KE20402). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AB786650_SHBs_P-D Product feature CHAIN AB786650_SHBs_P-D of FT:mat_peptide AB786650_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KE20408). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF041251_SHBs_P-D Product feature CHAIN AF041251_SHBs_P-D of FT:mat_peptide AF041251_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCLPTCPGYRWMFLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF043593_SHBs_P-D Product feature CHAIN AF043593_SHBs_P-D of FT:mat_peptide AF043593_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6/89). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF043594_SHBs_P-D Product feature CHAIN AF043594_SHBs_P-D of FT:mat_peptide AF043594_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1/91). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF061523_SHBs_P-D Product feature CHAIN AF061523_SHBs_P-D of FT:mat_peptide AF061523_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ms8388). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF061524_SHBs_P-D Product feature CHAIN AF061524_SHBs_P-D of FT:mat_peptide AF061524_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate mb602). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLAPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF061528_SHBs_P-D Product feature CHAIN AF061528_SHBs_P-D of FT:mat_peptide AF061528_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate od2278). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF065110_SHBs_P-D Product feature CHAIN AF065110_SHBs_P-D of FT:mat_peptide AF065110_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate hb1213). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF065112_SHBs_P-D Product feature CHAIN AF065112_SHBs_P-D of FT:mat_peptide AF065112_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate sn1065). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFWLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCPKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF065117_SHBs_P-D Product feature CHAIN AF065117_SHBs_P-D of FT:mat_peptide AF065117_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate sn7099). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLLVCPLISGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF065118_SHBs_P-D Product feature CHAIN AF065118_SHBs_P-D of FT:mat_peptide AF065118_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate z12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPMDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFFPLLPIFFCLWVYI
>gnl|hbvpro|AF065119_SHBs_P-D Product feature CHAIN AF065119_SHBs_P-D of FT:mat_peptide AF065119_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate zms520). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF083640_SHBs_P-D Product feature CHAIN AF083640_SHBs_P-D of FT:mat_peptide AF083640_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 4-1991). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGTSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF083641_SHBs_P-D Product feature CHAIN AF083641_SHBs_P-D of FT:mat_peptide AF083641_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 4-1992). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGTSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF121239_SHBs_P-D Product feature CHAIN AF121239_SHBs_P-D of FT:mat_peptide AF121239_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1303). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF121240_SHBs_C-D Product feature CHAIN AF121240_SHBs_C-D of FT:mat_peptide AF121240_SHBs_C-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/11066). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF121241_SHBs_P-D Product feature CHAIN AF121241_SHBs_P-D of FT:mat_peptide AF121241_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1758). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF121242_SHBs_P-D Product feature CHAIN AF121242_SHBs_P-D of FT:mat_peptide AF121242_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1218). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF134135_SHBs_P-D Product feature CHAIN AF134135_SHBs_P-D of FT:mat_peptide AF134135_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF134136_SHBs_P-D Product feature CHAIN AF134136_SHBs_P-D of FT:mat_peptide AF134136_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSVGPCKTCTTPAQGTSINPSCCCTKSLDKNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVLFVQWFVDRSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF134140_SHBs_P-D Product feature CHAIN AF134140_SHBs_P-D of FT:mat_peptide AF134140_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRNRTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF134141_SHBs_P-D Product feature CHAIN AF134141_SHBs_P-D of FT:mat_peptide AF134141_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF134142_SHBs_P-D Product feature CHAIN AF134142_SHBs_P-D of FT:mat_peptide AF134142_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSLTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRNCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF151735_SHBs_P-D Product feature CHAIN AF151735_SHBs_P-D of FT:mat_peptide AF151735_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF208870_SHBs_P-D Product feature CHAIN AF208870_SHBs_P-D of FT:mat_peptide AF208870_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate js2617). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSDFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSLIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF208872_SHBs_P-D Product feature CHAIN AF208872_SHBs_P-D of FT:mat_peptide AF208872_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate pal3649). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPQLVLQAGFFLLTRILTIPLSLDSWWTSLNFLGGTTVCFGQNSQSPTSNHSPTSCPPTCPGYRWMSRRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTQPSDGNWTCIPIPSSWAFGK
FLWEWASARFSWLSLLVGFVQWYVGLSPTVWVLGIWMIWYWGHSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF208874_SHBs_P-D Product feature CHAIN AF208874_SHBs_P-D of FT:mat_peptide AF208874_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate pal3671). Partial genome (Contains: LHBs, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENITSDFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLPRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTALGTSMYPSCCCTKPSDGNCTCIPIASSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSLIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF208877_SHBs_P-D Product feature CHAIN AF208877_SHBs_P-D of FT:mat_peptide AF208877_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate wr2209). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF209391_SHBs_P-D Product feature CHAIN AF209391_SHBs_P-D of FT:mat_peptide AF209391_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ak009). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF209394_SHBs_P-D Product feature CHAIN AF209394_SHBs_P-D of FT:mat_peptide AF209394_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dr10039). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF209396_SHBs_P-D Product feature CHAIN AF209396_SHBs_P-D of FT:mat_peptide AF209396_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate gs). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWXMXYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AF209398_SHBs_P-D Product feature CHAIN AF209398_SHBs_P-D of FT:mat_peptide AF209398_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ls384). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF209401_SHBs_P-D Product feature CHAIN AF209401_SHBs_P-D of FT:mat_peptide AF209401_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate rb011). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AF214659_SHBs_P-D Product feature CHAIN AF214659_SHBs_P-D of FT:mat_peptide AF214659_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTRPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF214660_SHBs_P-D Product feature CHAIN AF214660_SHBs_P-D of FT:mat_peptide AF214660_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF214661_SHBs_P-D Product feature CHAIN AF214661_SHBs_P-D of FT:mat_peptide AF214661_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF229158_SHBs_P-D Product feature CHAIN AF229158_SHBs_P-D of FT:mat_peptide AF229158_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFFLWVYI
>gnl|hbvpro|AF229159_SHBs_P-D Product feature CHAIN AF229159_SHBs_P-D of FT:mat_peptide AF229159_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF280817_SHBs_P-D Product feature CHAIN AF280817_SHBs_P-D of FT:mat_peptide AF280817_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-D1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF369534_SHBs_P-D Product feature CHAIN AF369534_SHBs_P-D of FT:mat_peptide AF369534_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MEX364). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSLVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCMTTAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF372622_SHBs_P-D Product feature CHAIN AF372622_SHBs_P-D of FT:mat_peptide AF372622_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AF372623_SHBs_P-D Product feature CHAIN AF372623_SHBs_P-D of FT:mat_peptide AF372623_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ131956_SHBs_P-D Product feature CHAIN AJ131956_SHBs_P-D of FT:mat_peptide AJ131956_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ344116_SHBs_P-D Product feature CHAIN AJ344116_SHBs_P-D of FT:mat_peptide AJ344116_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBsAg negative patient GX27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ517792_SHBs_P-D Product feature CHAIN AJ517792_SHBs_P-D of FT:mat_peptide AJ517792_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate X6S3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=224 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWV
>gnl|hbvpro|AJ627215_SHBs_P-D Product feature CHAIN AJ627215_SHBs_P-D of FT:mat_peptide AJ627215_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 06115). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSRFLPLLPIFLCLWVYI
>gnl|hbvpro|AJ627216_SHBs_P-D Product feature CHAIN AJ627216_SHBs_P-D of FT:mat_peptide AJ627216_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17707). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSRFLPLLPIFXCLWVYI
>gnl|hbvpro|AJ627218_SHBs_P-D Product feature CHAIN AJ627218_SHBs_P-D of FT:mat_peptide AJ627218_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 21116). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSRFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ627219_SHBs_P-D Product feature CHAIN AJ627219_SHBs_P-D of FT:mat_peptide AJ627219_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 24039). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ627220_SHBs_P-D Product feature CHAIN AJ627220_SHBs_P-D of FT:mat_peptide AJ627220_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 29234). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ627222_SHBs_P-D Product feature CHAIN AJ627222_SHBs_P-D of FT:mat_peptide AJ627222_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 31228). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLQIFFCLWVYI
>gnl|hbvpro|AJ627223_SHBs_P-D Product feature CHAIN AJ627223_SHBs_P-D of FT:mat_peptide AJ627223_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33720). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AJ627224_SHBs_P-D Product feature CHAIN AJ627224_SHBs_P-D of FT:mat_peptide AJ627224_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33852). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AM422939_SHBs_P-D Product feature CHAIN AM422939_SHBs_P-D of FT:mat_peptide AM422939_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate X28). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AM494742_SHBs_P-D Product feature CHAIN AM494742_SHBs_P-D of FT:mat_peptide AM494742_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CAR202). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AM494749_SHBs_P-D Product feature CHAIN AM494749_SHBs_P-D of FT:mat_peptide AM494749_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CAR175). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCHIFLLVLLDYQGMLPVCPLIPGSSTTSRGPCRTCTTPAQGTSMHPSCCYSKLSDGNCTCIPIPSSWAFGN
FLWVWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AM494750_SHBs_P-D Product feature CHAIN AM494750_SHBs_P-D of FT:mat_peptide AM494750_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CAR175). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSRGPCRTCTTPAQGTSMHPSCCCTKLSDGNCTCIPIPSSWAFGN
FLWVWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AM991999_SHBs_P-D Product feature CHAIN AM991999_SHBs_P-D of FT:mat_peptide AM991999_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY090452_SHBs_P-D Product feature CHAIN AY090452_SHBs_P-D of FT:mat_peptide AY090452_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY090453_SHBs_P-D Product feature CHAIN AY090453_SHBs_P-D of FT:mat_peptide AY090453_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCKTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFFWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122551_SHBs_P-D Product feature CHAIN AY122551_SHBs_P-D of FT:mat_peptide AY122551_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F148). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122552_SHBs_P-D Product feature CHAIN AY122552_SHBs_P-D of FT:mat_peptide AY122552_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F193). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
METITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122553_SHBs_P-D Product feature CHAIN AY122553_SHBs_P-D of FT:mat_peptide AY122553_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F201). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122554_SHBs_P-D Product feature CHAIN AY122554_SHBs_P-D of FT:mat_peptide AY122554_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F203). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122555_SHBs_P-D Product feature CHAIN AY122555_SHBs_P-D of FT:mat_peptide AY122555_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F216). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCAGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122556_SHBs_P-D Product feature CHAIN AY122556_SHBs_P-D of FT:mat_peptide AY122556_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F306). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122557_SHBs_P-D Product feature CHAIN AY122557_SHBs_P-D of FT:mat_peptide AY122557_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K130). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122558_SHBs_P-D Product feature CHAIN AY122558_SHBs_P-D of FT:mat_peptide AY122558_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K198). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122559_SHBs_P-D Product feature CHAIN AY122559_SHBs_P-D of FT:mat_peptide AY122559_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K200). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122560_SHBs_P-D Product feature CHAIN AY122560_SHBs_P-D of FT:mat_peptide AY122560_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K202). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122561_SHBs_P-D Product feature CHAIN AY122561_SHBs_P-D of FT:mat_peptide AY122561_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K205). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122563_SHBs_P-D Product feature CHAIN AY122563_SHBs_P-D of FT:mat_peptide AY122563_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K219). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122564_SHBs_P-D Product feature CHAIN AY122564_SHBs_P-D of FT:mat_peptide AY122564_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K232). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122565_SHBs_P-D Product feature CHAIN AY122565_SHBs_P-D of FT:mat_peptide AY122565_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K239). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122566_SHBs_P-D Product feature CHAIN AY122566_SHBs_P-D of FT:mat_peptide AY122566_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K260). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122567_SHBs_P-D Product feature CHAIN AY122567_SHBs_P-D of FT:mat_peptide AY122567_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K276). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122568_SHBs_P-D Product feature CHAIN AY122568_SHBs_P-D of FT:mat_peptide AY122568_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K279). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122569_SHBs_P-D Product feature CHAIN AY122569_SHBs_P-D of FT:mat_peptide AY122569_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K282). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122570_SHBs_P-D Product feature CHAIN AY122570_SHBs_P-D of FT:mat_peptide AY122570_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K295). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122571_SHBs_P-D Product feature CHAIN AY122571_SHBs_P-D of FT:mat_peptide AY122571_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122572_SHBs_P-D Product feature CHAIN AY122572_SHBs_P-D of FT:mat_peptide AY122572_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate K307). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122573_SHBs_P-D Product feature CHAIN AY122573_SHBs_P-D of FT:mat_peptide AY122573_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T244). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122574_SHBs_P-D Product feature CHAIN AY122574_SHBs_P-D of FT:mat_peptide AY122574_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T251). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLLLLPIFFCLWVYI
>gnl|hbvpro|AY122575_SHBs_P-D Product feature CHAIN AY122575_SHBs_P-D of FT:mat_peptide AY122575_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T269). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122576_SHBs_P-D Product feature CHAIN AY122576_SHBs_P-D of FT:mat_peptide AY122576_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T286). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQGVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122587_SHBs_P-D Product feature CHAIN AY122587_SHBs_P-D of FT:mat_peptide AY122587_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IN0008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTGWLSVIWMMWYWGPSLYSILSPFLPLLPIFFWLWVYL
>gnl|hbvpro|AY122589_SHBs_P-D Product feature CHAIN AY122589_SHBs_P-D of FT:mat_peptide AY122589_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IN0017). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122590_SHBs_P-D Product feature CHAIN AY122590_SHBs_P-D of FT:mat_peptide AY122590_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IN0051). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTFCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCIKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122591_SHBs_P-D Product feature CHAIN AY122591_SHBs_P-D of FT:mat_peptide AY122591_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IN0062). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122592_SHBs_P-D Product feature CHAIN AY122592_SHBs_P-D of FT:mat_peptide AY122592_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IN0083). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122593_SHBs_P-D Product feature CHAIN AY122593_SHBs_P-D of FT:mat_peptide AY122593_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IN0091). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY122594_SHBs_P-D Product feature CHAIN AY122594_SHBs_P-D of FT:mat_peptide AY122594_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IN0134). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161150_SHBs_P-D Product feature CHAIN AY161150_SHBs_P-D of FT:mat_peptide AY161150_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSIHPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161153_SHBs_P-D Product feature CHAIN AY161153_SHBs_P-D of FT:mat_peptide AY161153_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSIHPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161155_SHBs_P-D Product feature CHAIN AY161155_SHBs_P-D of FT:mat_peptide AY161155_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSIHPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161157_SHBs_P-D Product feature CHAIN AY161157_SHBs_P-D of FT:mat_peptide AY161157_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPASNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161158_SHBs_P-D Product feature CHAIN AY161158_SHBs_P-D of FT:mat_peptide AY161158_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPASNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161159_SHBs_P-D Product feature CHAIN AY161159_SHBs_P-D of FT:mat_peptide AY161159_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWKWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY161160_SHBs_P-D Product feature CHAIN AY161160_SHBs_P-D of FT:mat_peptide AY161160_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWKWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY221115_SHBs_P-D Product feature CHAIN AY221115_SHBs_P-D of FT:mat_peptide AY221115_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P1008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY230116_SHBs_P-D Product feature CHAIN AY230116_SHBs_P-D of FT:mat_peptide AY230116_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLDFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY233291_SHBs_P-D Product feature CHAIN AY233291_SHBs_P-D of FT:mat_peptide AY233291_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 179). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWPFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY233292_SHBs_P-D Product feature CHAIN AY233292_SHBs_P-D of FT:mat_peptide AY233292_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 184). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY233294_SHBs_P-D Product feature CHAIN AY233294_SHBs_P-D of FT:mat_peptide AY233294_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 305). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVRLSPTVWLSAIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY233296_SHBs_P-D Product feature CHAIN AY233296_SHBs_P-D of FT:mat_peptide AY233296_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 185). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFSPLLPIFFCLWVYI
>gnl|hbvpro|AY236160_SHBs_P-D Product feature CHAIN AY236160_SHBs_P-D of FT:mat_peptide AY236160_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1A). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARSSWLSLLVPFVQGFGGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|AY236162_SHBs_P-D Product feature CHAIN AY236162_SHBs_P-D of FT:mat_peptide AY236162_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 23A). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY236164_SHBs_P-D Product feature CHAIN AY236164_SHBs_P-D of FT:mat_peptide AY236164_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 30). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWRTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRICTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|AY653804_SHBs_P-D Product feature CHAIN AY653804_SHBs_P-D of FT:mat_peptide AY653804_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 288-00). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCSTCTTTAQGTSTFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653806_SHBs_P-D Product feature CHAIN AY653806_SHBs_P-D of FT:mat_peptide AY653806_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4500-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTISAGPCRTCTTTAQGTSMYPSCCCTKPLDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653807_SHBs_P-D Product feature CHAIN AY653807_SHBs_P-D of FT:mat_peptide AY653807_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 290-00). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTIVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653808_SHBs_P-D Product feature CHAIN AY653808_SHBs_P-D of FT:mat_peptide AY653808_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4441-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWGWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653809_SHBs_P-D Product feature CHAIN AY653809_SHBs_P-D of FT:mat_peptide AY653809_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4430-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
TIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTFMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653810_SHBs_P-D Product feature CHAIN AY653810_SHBs_P-D of FT:mat_peptide AY653810_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4543-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|AY653811_SHBs_P-D Product feature CHAIN AY653811_SHBs_P-D of FT:mat_peptide AY653811_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4494-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGMLPVCPLIPGSSTISTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653812_SHBs_P-D Product feature CHAIN AY653812_SHBs_P-D of FT:mat_peptide AY653812_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3812-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSFIVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653814_SHBs_P-D Product feature CHAIN AY653814_SHBs_P-D of FT:mat_peptide AY653814_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4388-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653815_SHBs_P-D Product feature CHAIN AY653815_SHBs_P-D of FT:mat_peptide AY653815_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5946-89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653816_SHBs_P-D Product feature CHAIN AY653816_SHBs_P-D of FT:mat_peptide AY653816_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6087-89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653817_SHBs_P-D Product feature CHAIN AY653817_SHBs_P-D of FT:mat_peptide AY653817_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5552-89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653818_SHBs_P-D Product feature CHAIN AY653818_SHBs_P-D of FT:mat_peptide AY653818_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 686-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653819_SHBs_P-D Product feature CHAIN AY653819_SHBs_P-D of FT:mat_peptide AY653819_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5542-89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLKPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653821_SHBs_P-D Product feature CHAIN AY653821_SHBs_P-D of FT:mat_peptide AY653821_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4380-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653822_SHBs_P-D Product feature CHAIN AY653822_SHBs_P-D of FT:mat_peptide AY653822_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4639-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653823_SHBs_P-D Product feature CHAIN AY653823_SHBs_P-D of FT:mat_peptide AY653823_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4561-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILRIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653824_SHBs_P-D Product feature CHAIN AY653824_SHBs_P-D of FT:mat_peptide AY653824_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4556-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653825_SHBs_P-D Product feature CHAIN AY653825_SHBs_P-D of FT:mat_peptide AY653825_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4475-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653826_SHBs_P-D Product feature CHAIN AY653826_SHBs_P-D of FT:mat_peptide AY653826_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4402-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLHSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653827_SHBs_P-D Product feature CHAIN AY653827_SHBs_P-D of FT:mat_peptide AY653827_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6059-89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653828_SHBs_P-D Product feature CHAIN AY653828_SHBs_P-D of FT:mat_peptide AY653828_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4603-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653829_SHBs_P-D Product feature CHAIN AY653829_SHBs_P-D of FT:mat_peptide AY653829_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3781-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653830_SHBs_P-D Product feature CHAIN AY653830_SHBs_P-D of FT:mat_peptide AY653830_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4471-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTSSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653831_SHBs_P-D Product feature CHAIN AY653831_SHBs_P-D of FT:mat_peptide AY653831_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4534-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653832_SHBs_P-D Product feature CHAIN AY653832_SHBs_P-D of FT:mat_peptide AY653832_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6058-89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653833_SHBs_P-D Product feature CHAIN AY653833_SHBs_P-D of FT:mat_peptide AY653833_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4649-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653834_SHBs_P-D Product feature CHAIN AY653834_SHBs_P-D of FT:mat_peptide AY653834_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4492-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653838_SHBs_P-D Product feature CHAIN AY653838_SHBs_P-D of FT:mat_peptide AY653838_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5373-89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653839_SHBs_P-D Product feature CHAIN AY653839_SHBs_P-D of FT:mat_peptide AY653839_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4470-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653840_SHBs_P-D Product feature CHAIN AY653840_SHBs_P-D of FT:mat_peptide AY653840_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3789-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKLSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653841_SHBs_P-D Product feature CHAIN AY653841_SHBs_P-D of FT:mat_peptide AY653841_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1993-02). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653842_SHBs_P-D Product feature CHAIN AY653842_SHBs_P-D of FT:mat_peptide AY653842_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 283-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653843_SHBs_P-D Product feature CHAIN AY653843_SHBs_P-D of FT:mat_peptide AY653843_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4407-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653845_SHBs_P-D Product feature CHAIN AY653845_SHBs_P-D of FT:mat_peptide AY653845_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3790-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653847_SHBs_P-D Product feature CHAIN AY653847_SHBs_P-D of FT:mat_peptide AY653847_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3806-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653849_SHBs_P-D Product feature CHAIN AY653849_SHBs_P-D of FT:mat_peptide AY653849_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4483-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653850_SHBs_P-D Product feature CHAIN AY653850_SHBs_P-D of FT:mat_peptide AY653850_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4644-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGNSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653855_SHBs_P-D Product feature CHAIN AY653855_SHBs_P-D of FT:mat_peptide AY653855_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4643-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653856_SHBs_P-D Product feature CHAIN AY653856_SHBs_P-D of FT:mat_peptide AY653856_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4482-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653858_SHBs_P-D Product feature CHAIN AY653858_SHBs_P-D of FT:mat_peptide AY653858_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3786-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653859_SHBs_P-D Product feature CHAIN AY653859_SHBs_P-D of FT:mat_peptide AY653859_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4382-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653862_SHBs_P-D Product feature CHAIN AY653862_SHBs_P-D of FT:mat_peptide AY653862_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4370-97). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653866_SHBs_P-D Product feature CHAIN AY653866_SHBs_P-D of FT:mat_peptide AY653866_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4369-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653867_SHBs_P-D Product feature CHAIN AY653867_SHBs_P-D of FT:mat_peptide AY653867_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 879-96). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653868_SHBs_P-D Product feature CHAIN AY653868_SHBs_P-D of FT:mat_peptide AY653868_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 646-00). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY653870_SHBs_P-D Product feature CHAIN AY653870_SHBs_P-D of FT:mat_peptide AY653870_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4645-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FVWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653871_SHBs_P-D Product feature CHAIN AY653871_SHBs_P-D of FT:mat_peptide AY653871_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4531-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWTCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653872_SHBs_P-D Product feature CHAIN AY653872_SHBs_P-D of FT:mat_peptide AY653872_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4386-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTAVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653873_SHBs_P-D Product feature CHAIN AY653873_SHBs_P-D of FT:mat_peptide AY653873_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4381-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCMTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653874_SHBs_P-D Product feature CHAIN AY653874_SHBs_P-D of FT:mat_peptide AY653874_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 886-96). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTIVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653876_SHBs_P-D Product feature CHAIN AY653876_SHBs_P-D of FT:mat_peptide AY653876_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4637-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWLVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653878_SHBs_P-D Product feature CHAIN AY653878_SHBs_P-D of FT:mat_peptide AY653878_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4632-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653879_SHBs_P-D Product feature CHAIN AY653879_SHBs_P-D of FT:mat_peptide AY653879_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 300-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653880_SHBs_P-D Product feature CHAIN AY653880_SHBs_P-D of FT:mat_peptide AY653880_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 882-96). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVELSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653881_SHBs_P-D Product feature CHAIN AY653881_SHBs_P-D of FT:mat_peptide AY653881_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 297-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653882_SHBs_P-D Product feature CHAIN AY653882_SHBs_P-D of FT:mat_peptide AY653882_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2012-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653884_SHBs_P-D Product feature CHAIN AY653884_SHBs_P-D of FT:mat_peptide AY653884_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 292-01). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653885_SHBs_P-D Product feature CHAIN AY653885_SHBs_P-D of FT:mat_peptide AY653885_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3785-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653886_SHBs_P-D Product feature CHAIN AY653886_SHBs_P-D of FT:mat_peptide AY653886_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3783-91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653887_SHBs_P-D Product feature CHAIN AY653887_SHBs_P-D of FT:mat_peptide AY653887_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1880-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSIIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653889_SHBs_P-D Product feature CHAIN AY653889_SHBs_P-D of FT:mat_peptide AY653889_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1889-98). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653892_SHBs_P-D Product feature CHAIN AY653892_SHBs_P-D of FT:mat_peptide AY653892_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4544-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653894_SHBs_P-D Product feature CHAIN AY653894_SHBs_P-D of FT:mat_peptide AY653894_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4523-97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY653895_SHBs_P-D Product feature CHAIN AY653895_SHBs_P-D of FT:mat_peptide AY653895_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 881-96). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY661792_SHBs_P-D Product feature CHAIN AY661792_SHBs_P-D of FT:mat_peptide AY661792_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ayw). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY661793_SHBs_P-D Product feature CHAIN AY661793_SHBs_P-D of FT:mat_peptide AY661793_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721605_SHBs_P-D Product feature CHAIN AY721605_SHBs_P-D of FT:mat_peptide AY721605_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AK1.1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721606_SHBs_P-D Product feature CHAIN AY721606_SHBs_P-D of FT:mat_peptide AY721606_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AT1.2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721607_SHBs_P-D Product feature CHAIN AY721607_SHBs_P-D of FT:mat_peptide AY721607_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HIY1.3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721608_SHBs_P-D Product feature CHAIN AY721608_SHBs_P-D of FT:mat_peptide AY721608_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IB1.4). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY721612_SHBs_P-D Product feature CHAIN AY721612_SHBs_P-D of FT:mat_peptide AY721612_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BL1.8). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738848_SHBs_P-D Product feature CHAIN AY738848_SHBs_P-D of FT:mat_peptide AY738848_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLALLDYQGILPVCPLLPGSSTTSTGPCRTCMTTAQGTSMHPSCCCIKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738849_SHBs_P-D Product feature CHAIN AY738849_SHBs_P-D of FT:mat_peptide AY738849_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738850_SHBs_P-D Product feature CHAIN AY738850_SHBs_P-D of FT:mat_peptide AY738850_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738851_SHBs_P-D Product feature CHAIN AY738851_SHBs_P-D of FT:mat_peptide AY738851_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSRSPTSNHSPTSCPPTCPGYRWMFLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738852_SHBs_P-D Product feature CHAIN AY738852_SHBs_P-D of FT:mat_peptide AY738852_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLRRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPSTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYCILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738853_SHBs_P-D Product feature CHAIN AY738853_SHBs_P-D of FT:mat_peptide AY738853_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQLFVGLSPTVWLSAIWIMWYWGPSMYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738854_SHBs_P-D Product feature CHAIN AY738854_SHBs_P-D of FT:mat_peptide AY738854_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQLFVGLSPTVWLSAIWIMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738855_SHBs_P-D Product feature CHAIN AY738855_SHBs_P-D of FT:mat_peptide AY738855_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDTWWTSLNFLGGSTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738856_SHBs_P-D Product feature CHAIN AY738856_SHBs_P-D of FT:mat_peptide AY738856_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTSVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738857_SHBs_P-D Product feature CHAIN AY738857_SHBs_P-D of FT:mat_peptide AY738857_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738858_SHBs_P-D Product feature CHAIN AY738858_SHBs_P-D of FT:mat_peptide AY738858_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738859_SHBs_P-D Product feature CHAIN AY738859_SHBs_P-D of FT:mat_peptide AY738859_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738860_SHBs_P-D Product feature CHAIN AY738860_SHBs_P-D of FT:mat_peptide AY738860_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738861_SHBs_P-D Product feature CHAIN AY738861_SHBs_P-D of FT:mat_peptide AY738861_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738862_SHBs_P-D Product feature CHAIN AY738862_SHBs_P-D of FT:mat_peptide AY738862_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738863_SHBs_P-D Product feature CHAIN AY738863_SHBs_P-D of FT:mat_peptide AY738863_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPISHSWAFGK
SLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738864_SHBs_P-D Product feature CHAIN AY738864_SHBs_P-D of FT:mat_peptide AY738864_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYSILSPFLPLLPIFFCLWVSI
>gnl|hbvpro|AY738865_SHBs_P-D Product feature CHAIN AY738865_SHBs_P-D of FT:mat_peptide AY738865_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738866_SHBs_P-D Product feature CHAIN AY738866_SHBs_P-D of FT:mat_peptide AY738866_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQSFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738867_SHBs_P-D Product feature CHAIN AY738867_SHBs_P-D of FT:mat_peptide AY738867_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPYCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738868_SHBs_P-D Product feature CHAIN AY738868_SHBs_P-D of FT:mat_peptide AY738868_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738869_SHBs_P-D Product feature CHAIN AY738869_SHBs_P-D of FT:mat_peptide AY738869_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738870_SHBs_P-D Product feature CHAIN AY738870_SHBs_P-D of FT:mat_peptide AY738870_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738871_SHBs_P-D Product feature CHAIN AY738871_SHBs_P-D of FT:mat_peptide AY738871_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738872_SHBs_P-D Product feature CHAIN AY738872_SHBs_P-D of FT:mat_peptide AY738872_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738873_SHBs_P-D Product feature CHAIN AY738873_SHBs_P-D of FT:mat_peptide AY738873_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYSILSPFLPLLPIFFCLWVYL
>gnl|hbvpro|AY738874_SHBs_P-D Product feature CHAIN AY738874_SHBs_P-D of FT:mat_peptide AY738874_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYSILSPFLPLLPIFFCLWVYL
>gnl|hbvpro|AY738875_SHBs_P-D Product feature CHAIN AY738875_SHBs_P-D of FT:mat_peptide AY738875_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738876_SHBs_P-D Product feature CHAIN AY738876_SHBs_P-D of FT:mat_peptide AY738876_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738877_SHBs_P-D Product feature CHAIN AY738877_SHBs_P-D of FT:mat_peptide AY738877_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738878_SHBs_P-D Product feature CHAIN AY738878_SHBs_P-D of FT:mat_peptide AY738878_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738879_SHBs_P-D Product feature CHAIN AY738879_SHBs_P-D of FT:mat_peptide AY738879_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738880_SHBs_P-D Product feature CHAIN AY738880_SHBs_P-D of FT:mat_peptide AY738880_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738881_SHBs_P-D Product feature CHAIN AY738881_SHBs_P-D of FT:mat_peptide AY738881_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738882_SHBs_P-D Product feature CHAIN AY738882_SHBs_P-D of FT:mat_peptide AY738882_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738883_SHBs_P-D Product feature CHAIN AY738883_SHBs_P-D of FT:mat_peptide AY738883_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRCF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGTCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AY738884_SHBs_P-D Product feature CHAIN AY738884_SHBs_P-D of FT:mat_peptide AY738884_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQCFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738885_SHBs_P-D Product feature CHAIN AY738885_SHBs_P-D of FT:mat_peptide AY738885_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738886_SHBs_P-D Product feature CHAIN AY738886_SHBs_P-D of FT:mat_peptide AY738886_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738887_SHBs_P-D Product feature CHAIN AY738887_SHBs_P-D of FT:mat_peptide AY738887_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRCF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738888_SHBs_P-D Product feature CHAIN AY738888_SHBs_P-D of FT:mat_peptide AY738888_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738889_SHBs_P-D Product feature CHAIN AY738889_SHBs_P-D of FT:mat_peptide AY738889_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738890_SHBs_P-D Product feature CHAIN AY738890_SHBs_P-D of FT:mat_peptide AY738890_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738891_SHBs_P-D Product feature CHAIN AY738891_SHBs_P-D of FT:mat_peptide AY738891_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRCF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738892_SHBs_P-D Product feature CHAIN AY738892_SHBs_P-D of FT:mat_peptide AY738892_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGVSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|AY738893_SHBs_P-D Product feature CHAIN AY738893_SHBs_P-D of FT:mat_peptide AY738893_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|AY738894_SHBs_P-D Product feature CHAIN AY738894_SHBs_P-D of FT:mat_peptide AY738894_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738895_SHBs_P-D Product feature CHAIN AY738895_SHBs_P-D of FT:mat_peptide AY738895_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738896_SHBs_P-D Product feature CHAIN AY738896_SHBs_P-D of FT:mat_peptide AY738896_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVSI
>gnl|hbvpro|AY738897_SHBs_P-D Product feature CHAIN AY738897_SHBs_P-D of FT:mat_peptide AY738897_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738898_SHBs_P-D Product feature CHAIN AY738898_SHBs_P-D of FT:mat_peptide AY738898_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738899_SHBs_P-D Product feature CHAIN AY738899_SHBs_P-D of FT:mat_peptide AY738899_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQCFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738900_SHBs_P-D Product feature CHAIN AY738900_SHBs_P-D of FT:mat_peptide AY738900_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMHPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738901_SHBs_P-D Product feature CHAIN AY738901_SHBs_P-D of FT:mat_peptide AY738901_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738902_SHBs_P-D Product feature CHAIN AY738902_SHBs_P-D of FT:mat_peptide AY738902_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIKSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738903_SHBs_P-D Product feature CHAIN AY738903_SHBs_P-D of FT:mat_peptide AY738903_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLMVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FPWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738904_SHBs_P-D Product feature CHAIN AY738904_SHBs_P-D of FT:mat_peptide AY738904_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738905_SHBs_P-D Product feature CHAIN AY738905_SHBs_P-D of FT:mat_peptide AY738905_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQSGFFLLPRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738906_SHBs_P-D Product feature CHAIN AY738906_SHBs_P-D of FT:mat_peptide AY738906_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLPRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738907_SHBs_P-D Product feature CHAIN AY738907_SHBs_P-D of FT:mat_peptide AY738907_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFFWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738908_SHBs_P-D Product feature CHAIN AY738908_SHBs_P-D of FT:mat_peptide AY738908_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
LLWEWASARFFWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738909_SHBs_P-D Product feature CHAIN AY738909_SHBs_P-D of FT:mat_peptide AY738909_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIQQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738910_SHBs_P-D Product feature CHAIN AY738910_SHBs_P-D of FT:mat_peptide AY738910_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIQQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738911_SHBs_P-D Product feature CHAIN AY738911_SHBs_P-D of FT:mat_peptide AY738911_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738912_SHBs_P-D Product feature CHAIN AY738912_SHBs_P-D of FT:mat_peptide AY738912_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWIMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738913_SHBs_P-D Product feature CHAIN AY738913_SHBs_P-D of FT:mat_peptide AY738913_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738914_SHBs_P-D Product feature CHAIN AY738914_SHBs_P-D of FT:mat_peptide AY738914_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738915_SHBs_P-D Product feature CHAIN AY738915_SHBs_P-D of FT:mat_peptide AY738915_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738916_SHBs_P-D Product feature CHAIN AY738916_SHBs_P-D of FT:mat_peptide AY738916_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY738917_SHBs_P-D Product feature CHAIN AY738917_SHBs_P-D of FT:mat_peptide AY738917_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741794_SHBs_P-D Product feature CHAIN AY741794_SHBs_P-D of FT:mat_peptide AY741794_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-50). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPVPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741795_SHBs_P-D Product feature CHAIN AY741795_SHBs_P-D of FT:mat_peptide AY741795_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-Hi). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPVPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741796_SHBs_P-D Product feature CHAIN AY741796_SHBs_P-D of FT:mat_peptide AY741796_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P3). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVWPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPVPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741797_SHBs_P-D Product feature CHAIN AY741797_SHBs_P-D of FT:mat_peptide AY741797_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY741798_SHBs_P-D Product feature CHAIN AY741798_SHBs_P-D of FT:mat_peptide AY741798_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-P4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDTTVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPVIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSILRPFIPLLSIFFGLWVFI
>gnl|hbvpro|AY796030_SHBs_P-D Product feature CHAIN AY796030_SHBs_P-D of FT:mat_peptide AY796030_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FC1.9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY796031_SHBs_P-D Product feature CHAIN AY796031_SHBs_P-D of FT:mat_peptide AY796031_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RA1.10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY796032_SHBs_P-D Product feature CHAIN AY796032_SHBs_P-D of FT:mat_peptide AY796032_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NA1.11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY945307_SHBs_P-D Product feature CHAIN AY945307_SHBs_P-D of FT:mat_peptide AY945307_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|AY999088_SHBs_P-D Product feature CHAIN AY999088_SHBs_P-D of FT:mat_peptide AY999088_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PKM3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCKTNTTTAQRTSMYPSCCCTKPSDGSCTCIPIPSSWAFGK
FLWEWASARFFWLSSLVPFVQWFVELSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ111986_SHBs_P-D Product feature CHAIN DQ111986_SHBs_P-D of FT:mat_peptide DQ111986_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MBT181). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ131122_SHBs_P-D Product feature CHAIN DQ131122_SHBs_P-D of FT:mat_peptide DQ131122_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ131123_SHBs_P-D Product feature CHAIN DQ131123_SHBs_P-D of FT:mat_peptide DQ131123_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-Dstop). Partial genome (Contains: SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMHPYCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHSILSPFLPLLPIFFWLWVYI
>gnl|hbvpro|DQ131126_SHBs_P-D Product feature CHAIN DQ131126_SHBs_P-D of FT:mat_peptide DQ131126_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S-D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ236128_SHBs_P-D Product feature CHAIN DQ236128_SHBs_P-D of FT:mat_peptide DQ236128_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MEX B09). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ299408_SHBs_P-D Product feature CHAIN DQ299408_SHBs_P-D of FT:mat_peptide DQ299408_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCC_335). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGSLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFXLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ299409_SHBs_P-D Product feature CHAIN DQ299409_SHBs_P-D of FT:mat_peptide DQ299409_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCC_335). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ304547_SHBs_P-D Product feature CHAIN DQ304547_SHBs_P-D of FT:mat_peptide DQ304547_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLAVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ304548_SHBs_P-D Product feature CHAIN DQ304548_SHBs_P-D of FT:mat_peptide DQ304548_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ304549_SHBs_P-D Product feature CHAIN DQ304549_SHBs_P-D of FT:mat_peptide DQ304549_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ304550_SHBs_P-D Product feature CHAIN DQ304550_SHBs_P-D of FT:mat_peptide DQ304550_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ304551_SHBs_P-D Product feature CHAIN DQ304551_SHBs_P-D of FT:mat_peptide DQ304551_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ315776_SHBs_P-D Product feature CHAIN DQ315776_SHBs_P-D of FT:mat_peptide DQ315776_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI00615). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ315778_SHBs_P-D Product feature CHAIN DQ315778_SHBs_P-D of FT:mat_peptide DQ315778_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI0388). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ329356_SHBs_P-D Product feature CHAIN DQ329356_SHBs_P-D of FT:mat_peptide DQ329356_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ329357_SHBs_P-D Product feature CHAIN DQ329357_SHBs_P-D of FT:mat_peptide DQ329357_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336674_SHBs_P-D Product feature CHAIN DQ336674_SHBs_P-D of FT:mat_peptide DQ336674_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336675_SHBs_P-D Product feature CHAIN DQ336675_SHBs_P-D of FT:mat_peptide DQ336675_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336676_SHBs_P-D Product feature CHAIN DQ336676_SHBs_P-D of FT:mat_peptide DQ336676_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336677_SHBs_P-D Product feature CHAIN DQ336677_SHBs_P-D of FT:mat_peptide DQ336677_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336678_SHBs_P-D Product feature CHAIN DQ336678_SHBs_P-D of FT:mat_peptide DQ336678_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336679_SHBs_P-D Product feature CHAIN DQ336679_SHBs_P-D of FT:mat_peptide DQ336679_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336680_SHBs_P-D Product feature CHAIN DQ336680_SHBs_P-D of FT:mat_peptide DQ336680_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336681_SHBs_P-D Product feature CHAIN DQ336681_SHBs_P-D of FT:mat_peptide DQ336681_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336682_SHBs_P-D Product feature CHAIN DQ336682_SHBs_P-D of FT:mat_peptide DQ336682_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAMWMIWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336683_SHBs_P-D Product feature CHAIN DQ336683_SHBs_P-D of FT:mat_peptide DQ336683_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336684_SHBs_P-D Product feature CHAIN DQ336684_SHBs_P-D of FT:mat_peptide DQ336684_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336685_SHBs_P-D Product feature CHAIN DQ336685_SHBs_P-D of FT:mat_peptide DQ336685_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336686_SHBs_P-D Product feature CHAIN DQ336686_SHBs_P-D of FT:mat_peptide DQ336686_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCSRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336687_SHBs_P-D Product feature CHAIN DQ336687_SHBs_P-D of FT:mat_peptide DQ336687_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCSRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336688_SHBs_P-D Product feature CHAIN DQ336688_SHBs_P-D of FT:mat_peptide DQ336688_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCSRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336689_SHBs_P-D Product feature CHAIN DQ336689_SHBs_P-D of FT:mat_peptide DQ336689_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336690_SHBs_P-D Product feature CHAIN DQ336690_SHBs_P-D of FT:mat_peptide DQ336690_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILGPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ336691_SHBs_P-D Product feature CHAIN DQ336691_SHBs_P-D of FT:mat_peptide DQ336691_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWDWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|DQ336692_SHBs_P-D Product feature CHAIN DQ336692_SHBs_P-D of FT:mat_peptide DQ336692_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCSRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412277_SHBs_P-D Product feature CHAIN DQ412277_SHBs_P-D of FT:mat_peptide DQ412277_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02001720). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLXILLLCLIFXLVLXDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412278_SHBs_P-D Product feature CHAIN DQ412278_SHBs_P-D of FT:mat_peptide DQ412278_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S02001723). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412279_SHBs_P-D Product feature CHAIN DQ412279_SHBs_P-D of FT:mat_peptide DQ412279_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02003094). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412280_SHBs_P-D Product feature CHAIN DQ412280_SHBs_P-D of FT:mat_peptide DQ412280_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02003096). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPNLYSTLSPFSPLLLIFFCLWAYI
>gnl|hbvpro|DQ412281_SHBs_P-D Product feature CHAIN DQ412281_SHBs_P-D of FT:mat_peptide DQ412281_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02004197). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412282_SHBs_P-D Product feature CHAIN DQ412282_SHBs_P-D of FT:mat_peptide DQ412282_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02006853). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
METITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPKLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412283_SHBs_P-D Product feature CHAIN DQ412283_SHBs_P-D of FT:mat_peptide DQ412283_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02006854). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412284_SHBs_P-D Product feature CHAIN DQ412284_SHBs_P-D of FT:mat_peptide DQ412284_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02009111). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412285_SHBs_P-D Product feature CHAIN DQ412285_SHBs_P-D of FT:mat_peptide DQ412285_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02009113). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|DQ412286_SHBs_P-D Product feature CHAIN DQ412286_SHBs_P-D of FT:mat_peptide DQ412286_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02009114). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412287_SHBs_P-D Product feature CHAIN DQ412287_SHBs_P-D of FT:mat_peptide DQ412287_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02009115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412288_SHBs_P-D Product feature CHAIN DQ412288_SHBs_P-D of FT:mat_peptide DQ412288_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S02009117). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPXLYXILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412289_SHBs_P-D Product feature CHAIN DQ412289_SHBs_P-D of FT:mat_peptide DQ412289_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02009121). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWAPQLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412290_SHBs_P-D Product feature CHAIN DQ412290_SHBs_P-D of FT:mat_peptide DQ412290_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02011118). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQDSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLCNTLSPFLRLLPIFFCLWVYI
>gnl|hbvpro|DQ412291_SHBs_P-D Product feature CHAIN DQ412291_SHBs_P-D of FT:mat_peptide DQ412291_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S02011121). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTIACLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYITLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412292_SHBs_P-D Product feature CHAIN DQ412292_SHBs_P-D of FT:mat_peptide DQ412292_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02012958). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPICPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPSLYSILSPFTPLLPIFLCLWVYI
>gnl|hbvpro|DQ412293_SHBs_P-D Product feature CHAIN DQ412293_SHBs_P-D of FT:mat_peptide DQ412293_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02015692). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTXWLLVIWMMWYWAPKLHSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412294_SHBs_P-D Product feature CHAIN DQ412294_SHBs_P-D of FT:mat_peptide DQ412294_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02016136). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGILPVCPLIPGSSTTSVGTCKTCTTTVQGTSMYPFCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLLIFFCLWVYT
>gnl|hbvpro|DQ412295_SHBs_P-D Product feature CHAIN DQ412295_SHBs_P-D of FT:mat_peptide DQ412295_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02016680). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412296_SHBs_P-D Product feature CHAIN DQ412296_SHBs_P-D of FT:mat_peptide DQ412296_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S02016683). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412297_SHBs_P-D Product feature CHAIN DQ412297_SHBs_P-D of FT:mat_peptide DQ412297_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02017231). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWALARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLCNTLSPFLPLLPIFCCLWAYI
>gnl|hbvpro|DQ412298_SHBs_P-D Product feature CHAIN DQ412298_SHBs_P-D of FT:mat_peptide DQ412298_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02019163). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412299_SHBs_P-D Product feature CHAIN DQ412299_SHBs_P-D of FT:mat_peptide DQ412299_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02019168). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412300_SHBs_P-D Product feature CHAIN DQ412300_SHBs_P-D of FT:mat_peptide DQ412300_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02023959). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412301_SHBs_P-D Product feature CHAIN DQ412301_SHBs_P-D of FT:mat_peptide DQ412301_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S02023966). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412302_SHBs_P-D Product feature CHAIN DQ412302_SHBs_P-D of FT:mat_peptide DQ412302_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02023968). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLXNILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412303_SHBs_P-D Product feature CHAIN DQ412303_SHBs_P-D of FT:mat_peptide DQ412303_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02025808). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412304_SHBs_P-D Product feature CHAIN DQ412304_SHBs_P-D of FT:mat_peptide DQ412304_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S02025810). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412305_SHBs_P-D Product feature CHAIN DQ412305_SHBs_P-D of FT:mat_peptide DQ412305_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02025811). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412306_SHBs_P-D Product feature CHAIN DQ412306_SHBs_P-D of FT:mat_peptide DQ412306_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02025814). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGSCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412307_SHBs_P-D Product feature CHAIN DQ412307_SHBs_P-D of FT:mat_peptide DQ412307_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02026888). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPXDGNCTCIPIPSSWAFGK
FLWEWASARFSWXSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412308_SHBs_P-D Product feature CHAIN DQ412308_SHBs_P-D of FT:mat_peptide DQ412308_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s02026889). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMXWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412309_SHBs_P-D Product feature CHAIN DQ412309_SHBs_P-D of FT:mat_peptide DQ412309_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03001561). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFHFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412310_SHBs_P-D Product feature CHAIN DQ412310_SHBs_P-D of FT:mat_peptide DQ412310_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03001562). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGXSPXVWLXVIWTMWCWAPHLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412311_SHBs_P-D Product feature CHAIN DQ412311_SHBs_P-D of FT:mat_peptide DQ412311_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S03001563). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412312_SHBs_P-D Product feature CHAIN DQ412312_SHBs_P-D of FT:mat_peptide DQ412312_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S03003109). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412313_SHBs_P-D Product feature CHAIN DQ412313_SHBs_P-D of FT:mat_peptide DQ412313_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S03003587). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412314_SHBs_P-D Product feature CHAIN DQ412314_SHBs_P-D of FT:mat_peptide DQ412314_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03005394). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFSLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGRSPTVWLLAIWTMWYWGPNLYRILSPLLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412315_SHBs_P-D Product feature CHAIN DQ412315_SHBs_P-D of FT:mat_peptide DQ412315_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S03006195). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQSSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412316_SHBs_P-D Product feature CHAIN DQ412316_SHBs_P-D of FT:mat_peptide DQ412316_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03007590). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412317_SHBs_P-D Product feature CHAIN DQ412317_SHBs_P-D of FT:mat_peptide DQ412317_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03007591). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412319_SHBs_P-D Product feature CHAIN DQ412319_SHBs_P-D of FT:mat_peptide DQ412319_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03008344). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412320_SHBs_P-D Product feature CHAIN DQ412320_SHBs_P-D of FT:mat_peptide DQ412320_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S03008347). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412321_SHBs_P-D Product feature CHAIN DQ412321_SHBs_P-D of FT:mat_peptide DQ412321_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03009293). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFIPLLPIFFSLWVYI
>gnl|hbvpro|DQ412322_SHBs_P-D Product feature CHAIN DQ412322_SHBs_P-D of FT:mat_peptide DQ412322_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03009619). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412323_SHBs_P-D Product feature CHAIN DQ412323_SHBs_P-D of FT:mat_peptide DQ412323_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03010173). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQDSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412324_SHBs_P-D Product feature CHAIN DQ412324_SHBs_P-D of FT:mat_peptide DQ412324_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03010175). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLNPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412325_SHBs_P-D Product feature CHAIN DQ412325_SHBs_P-D of FT:mat_peptide DQ412325_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03010177). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412326_SHBs_P-D Product feature CHAIN DQ412326_SHBs_P-D of FT:mat_peptide DQ412326_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S03010574). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412327_SHBs_P-D Product feature CHAIN DQ412327_SHBs_P-D of FT:mat_peptide DQ412327_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S03013242). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFQGMLRVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412328_SHBs_P-D Product feature CHAIN DQ412328_SHBs_P-D of FT:mat_peptide DQ412328_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03013243). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412329_SHBs_P-D Product feature CHAIN DQ412329_SHBs_P-D of FT:mat_peptide DQ412329_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03014651). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEATVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412330_SHBs_P-D Product feature CHAIN DQ412330_SHBs_P-D of FT:mat_peptide DQ412330_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03015608). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWGSI
>gnl|hbvpro|DQ412331_SHBs_P-D Product feature CHAIN DQ412331_SHBs_P-D of FT:mat_peptide DQ412331_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03016102). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGHSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412332_SHBs_P-D Product feature CHAIN DQ412332_SHBs_P-D of FT:mat_peptide DQ412332_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03016103). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSXCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412333_SHBs_P-D Product feature CHAIN DQ412333_SHBs_P-D of FT:mat_peptide DQ412333_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03017506). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412334_SHBs_P-D Product feature CHAIN DQ412334_SHBs_P-D of FT:mat_peptide DQ412334_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03020210). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412335_SHBs_P-D Product feature CHAIN DQ412335_SHBs_P-D of FT:mat_peptide DQ412335_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03020211). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412336_SHBs_P-D Product feature CHAIN DQ412336_SHBs_P-D of FT:mat_peptide DQ412336_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03020383). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNXSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412337_SHBs_P-D Product feature CHAIN DQ412337_SHBs_P-D of FT:mat_peptide DQ412337_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S03020384). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412338_SHBs_P-D Product feature CHAIN DQ412338_SHBs_P-D of FT:mat_peptide DQ412338_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03021332). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412339_SHBs_P-D Product feature CHAIN DQ412339_SHBs_P-D of FT:mat_peptide DQ412339_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03021333). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412340_SHBs_P-D Product feature CHAIN DQ412340_SHBs_P-D of FT:mat_peptide DQ412340_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03021867). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412341_SHBs_P-D Product feature CHAIN DQ412341_SHBs_P-D of FT:mat_peptide DQ412341_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03024568). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCIKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412342_SHBs_P-D Product feature CHAIN DQ412342_SHBs_P-D of FT:mat_peptide DQ412342_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03024902). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTFCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGXSPTVWLXVIWMMWYWGPSLYSILSPFVPLLPIFLCLWVYI
>gnl|hbvpro|DQ412343_SHBs_P-D Product feature CHAIN DQ412343_SHBs_P-D of FT:mat_peptide DQ412343_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s03025320). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412344_SHBs_P-D Product feature CHAIN DQ412344_SHBs_P-D of FT:mat_peptide DQ412344_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04000006). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARSSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHSILSPFLPLLQIFCCLWVFI
>gnl|hbvpro|DQ412345_SHBs_P-D Product feature CHAIN DQ412345_SHBs_P-D of FT:mat_peptide DQ412345_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04000008). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412346_SHBs_P-D Product feature CHAIN DQ412346_SHBs_P-D of FT:mat_peptide DQ412346_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S04001916). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTNTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412347_SHBs_P-D Product feature CHAIN DQ412347_SHBs_P-D of FT:mat_peptide DQ412347_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04002904). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSLYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMMWYWGPSLSRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412348_SHBs_P-D Product feature CHAIN DQ412348_SHBs_P-D of FT:mat_peptide DQ412348_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04004396). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412349_SHBs_P-D Product feature CHAIN DQ412349_SHBs_P-D of FT:mat_peptide DQ412349_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04006023). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVXWMMWYWGPXLXNILXPFLXLLPIFCCLWVXI
>gnl|hbvpro|DQ412351_SHBs_P-D Product feature CHAIN DQ412351_SHBs_P-D of FT:mat_peptide DQ412351_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04007187). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412352_SHBs_P-D Product feature CHAIN DQ412352_SHBs_P-D of FT:mat_peptide DQ412352_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04008404). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNXQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412353_SHBs_P-D Product feature CHAIN DQ412353_SHBs_P-D of FT:mat_peptide DQ412353_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04008720). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412354_SHBs_P-D Product feature CHAIN DQ412354_SHBs_P-D of FT:mat_peptide DQ412354_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04008721). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412355_SHBs_P-D Product feature CHAIN DQ412355_SHBs_P-D of FT:mat_peptide DQ412355_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04009693). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412356_SHBs_P-D Product feature CHAIN DQ412356_SHBs_P-D of FT:mat_peptide DQ412356_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04010318). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVTWMMWFWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412357_SHBs_P-D Product feature CHAIN DQ412357_SHBs_P-D of FT:mat_peptide DQ412357_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04011652). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNXQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412358_SHBs_P-D Product feature CHAIN DQ412358_SHBs_P-D of FT:mat_peptide DQ412358_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04012671). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412359_SHBs_P-D Product feature CHAIN DQ412359_SHBs_P-D of FT:mat_peptide DQ412359_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04013163). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLLLLPIFFCLWVYI
>gnl|hbvpro|DQ412360_SHBs_P-D Product feature CHAIN DQ412360_SHBs_P-D of FT:mat_peptide DQ412360_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04014604). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPRIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412361_SHBs_P-D Product feature CHAIN DQ412361_SHBs_P-D of FT:mat_peptide DQ412361_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S04014605). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412362_SHBs_P-D Product feature CHAIN DQ412362_SHBs_P-D of FT:mat_peptide DQ412362_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04014918). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412363_SHBs_P-D Product feature CHAIN DQ412363_SHBs_P-D of FT:mat_peptide DQ412363_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04016708). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVRLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412364_SHBs_P-D Product feature CHAIN DQ412364_SHBs_P-D of FT:mat_peptide DQ412364_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04017584). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412365_SHBs_P-D Product feature CHAIN DQ412365_SHBs_P-D of FT:mat_peptide DQ412365_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04018170). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412366_SHBs_P-D Product feature CHAIN DQ412366_SHBs_P-D of FT:mat_peptide DQ412366_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04018171). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQDSQSPTCSHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412367_SHBs_P-D Product feature CHAIN DQ412367_SHBs_P-D of FT:mat_peptide DQ412367_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04018172). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCXGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412368_SHBs_P-D Product feature CHAIN DQ412368_SHBs_P-D of FT:mat_peptide DQ412368_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04018771). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412369_SHBs_P-D Product feature CHAIN DQ412369_SHBs_P-D of FT:mat_peptide DQ412369_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04020449). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412370_SHBs_P-D Product feature CHAIN DQ412370_SHBs_P-D of FT:mat_peptide DQ412370_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04020626). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412371_SHBs_P-D Product feature CHAIN DQ412371_SHBs_P-D of FT:mat_peptide DQ412371_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S04020968). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLLLLPIFXCLWVYI
>gnl|hbvpro|DQ412372_SHBs_P-D Product feature CHAIN DQ412372_SHBs_P-D of FT:mat_peptide DQ412372_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04021495). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412373_SHBs_P-D Product feature CHAIN DQ412373_SHBs_P-D of FT:mat_peptide DQ412373_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04021496). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412374_SHBs_P-D Product feature CHAIN DQ412374_SHBs_P-D of FT:mat_peptide DQ412374_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04021497). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMTWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412375_SHBs_P-D Product feature CHAIN DQ412375_SHBs_P-D of FT:mat_peptide DQ412375_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04021899). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412376_SHBs_P-D Product feature CHAIN DQ412376_SHBs_P-D of FT:mat_peptide DQ412376_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04023098). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412377_SHBs_P-D Product feature CHAIN DQ412377_SHBs_P-D of FT:mat_peptide DQ412377_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04023418). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412378_SHBs_P-D Product feature CHAIN DQ412378_SHBs_P-D of FT:mat_peptide DQ412378_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04024248). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412380_SHBs_P-D Product feature CHAIN DQ412380_SHBs_P-D of FT:mat_peptide DQ412380_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S04025033). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412381_SHBs_P-D Product feature CHAIN DQ412381_SHBs_P-D of FT:mat_peptide DQ412381_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04025340). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPXTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412382_SHBs_P-D Product feature CHAIN DQ412382_SHBs_P-D of FT:mat_peptide DQ412382_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S04026373). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412383_SHBs_P-D Product feature CHAIN DQ412383_SHBs_P-D of FT:mat_peptide DQ412383_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04026374). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGFRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSXYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSXLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSHFXPLLPIFLCLWVYI
>gnl|hbvpro|DQ412384_SHBs_P-D Product feature CHAIN DQ412384_SHBs_P-D of FT:mat_peptide DQ412384_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04026656). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTPVCLGQNSQSPTSNHSPTSCPPTCXGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412385_SHBs_P-D Product feature CHAIN DQ412385_SHBs_P-D of FT:mat_peptide DQ412385_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04026711). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412386_SHBs_P-D Product feature CHAIN DQ412386_SHBs_P-D of FT:mat_peptide DQ412386_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s04026934). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412387_SHBs_P-D Product feature CHAIN DQ412387_SHBs_P-D of FT:mat_peptide DQ412387_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05001607). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXXGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412388_SHBs_P-D Product feature CHAIN DQ412388_SHBs_P-D of FT:mat_peptide DQ412388_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05003969). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412389_SHBs_P-D Product feature CHAIN DQ412389_SHBs_P-D of FT:mat_peptide DQ412389_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05004339). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412390_SHBs_P-D Product feature CHAIN DQ412390_SHBs_P-D of FT:mat_peptide DQ412390_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05004615). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412391_SHBs_P-D Product feature CHAIN DQ412391_SHBs_P-D of FT:mat_peptide DQ412391_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05005494). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412392_SHBs_P-D Product feature CHAIN DQ412392_SHBs_P-D of FT:mat_peptide DQ412392_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05006103). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412393_SHBs_P-D Product feature CHAIN DQ412393_SHBs_P-D of FT:mat_peptide DQ412393_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05006872). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ412394_SHBs_P-D Product feature CHAIN DQ412394_SHBs_P-D of FT:mat_peptide DQ412394_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05007224). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412395_SHBs_P-D Product feature CHAIN DQ412395_SHBs_P-D of FT:mat_peptide DQ412395_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05008022). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFXLWVYI
>gnl|hbvpro|DQ412396_SHBs_P-D Product feature CHAIN DQ412396_SHBs_P-D of FT:mat_peptide DQ412396_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05008971). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAXGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412397_SHBs_P-D Product feature CHAIN DQ412397_SHBs_P-D of FT:mat_peptide DQ412397_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05009483). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|DQ412398_SHBs_P-D Product feature CHAIN DQ412398_SHBs_P-D of FT:mat_peptide DQ412398_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05010082). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412399_SHBs_P-D Product feature CHAIN DQ412399_SHBs_P-D of FT:mat_peptide DQ412399_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05010383). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412400_SHBs_P-D Product feature CHAIN DQ412400_SHBs_P-D of FT:mat_peptide DQ412400_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05010385). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412401_SHBs_P-D Product feature CHAIN DQ412401_SHBs_P-D of FT:mat_peptide DQ412401_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05011420). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLGQNSQCPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412402_SHBs_P-D Product feature CHAIN DQ412402_SHBs_P-D of FT:mat_peptide DQ412402_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05011423). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412403_SHBs_P-D Product feature CHAIN DQ412403_SHBs_P-D of FT:mat_peptide DQ412403_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05011424). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAXFFLXTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGXSMYPSCCCTKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNIXSHFLPLLPNSFCLWVYS
>gnl|hbvpro|DQ412404_SHBs_P-D Product feature CHAIN DQ412404_SHBs_P-D of FT:mat_peptide DQ412404_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05011855). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPKLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412405_SHBs_P-D Product feature CHAIN DQ412405_SHBs_P-D of FT:mat_peptide DQ412405_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05013273). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLLIFFCLWXYI
>gnl|hbvpro|DQ412406_SHBs_P-D Product feature CHAIN DQ412406_SHBs_P-D of FT:mat_peptide DQ412406_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05013274). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412407_SHBs_P-D Product feature CHAIN DQ412407_SHBs_P-D of FT:mat_peptide DQ412407_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05013553). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGXSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412408_SHBs_P-D Product feature CHAIN DQ412408_SHBs_P-D of FT:mat_peptide DQ412408_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05013800). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412409_SHBs_P-D Product feature CHAIN DQ412409_SHBs_P-D of FT:mat_peptide DQ412409_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05014131). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412410_SHBs_P-D Product feature CHAIN DQ412410_SHBs_P-D of FT:mat_peptide DQ412410_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05015379). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412411_SHBs_P-D Product feature CHAIN DQ412411_SHBs_P-D of FT:mat_peptide DQ412411_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05016357). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412412_SHBs_P-D Product feature CHAIN DQ412412_SHBs_P-D of FT:mat_peptide DQ412412_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05016358). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPXCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFPILSRFXPLLPIFFCLWVYI
>gnl|hbvpro|DQ412413_SHBs_P-D Product feature CHAIN DQ412413_SHBs_P-D of FT:mat_peptide DQ412413_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05016359). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412414_SHBs_P-D Product feature CHAIN DQ412414_SHBs_P-D of FT:mat_peptide DQ412414_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05016898). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWXWXPNLNNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412415_SHBs_P-D Product feature CHAIN DQ412415_SHBs_P-D of FT:mat_peptide DQ412415_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05017206). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412416_SHBs_P-D Product feature CHAIN DQ412416_SHBs_P-D of FT:mat_peptide DQ412416_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05017207). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412417_SHBs_P-D Product feature CHAIN DQ412417_SHBs_P-D of FT:mat_peptide DQ412417_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05017208). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412419_SHBs_P-D Product feature CHAIN DQ412419_SHBs_P-D of FT:mat_peptide DQ412419_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05017210). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAXGTSMYPSCCCIXPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQGFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412420_SHBs_P-D Product feature CHAIN DQ412420_SHBs_P-D of FT:mat_peptide DQ412420_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05017429). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412421_SHBs_P-D Product feature CHAIN DQ412421_SHBs_P-D of FT:mat_peptide DQ412421_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05017884). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTXCPPTCPGYRWMCLRRF
IIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412422_SHBs_P-D Product feature CHAIN DQ412422_SHBs_P-D of FT:mat_peptide DQ412422_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05017886). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412423_SHBs_P-D Product feature CHAIN DQ412423_SHBs_P-D of FT:mat_peptide DQ412423_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05018054). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSLTAWLLVIWMMWYWGRNLCIILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412424_SHBs_P-D Product feature CHAIN DQ412424_SHBs_P-D of FT:mat_peptide DQ412424_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05018056). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLXGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSXAFVK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSRFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412425_SHBs_P-D Product feature CHAIN DQ412425_SHBs_P-D of FT:mat_peptide DQ412425_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05018157). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSXIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412426_SHBs_P-D Product feature CHAIN DQ412426_SHBs_P-D of FT:mat_peptide DQ412426_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05018795). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412427_SHBs_P-D Product feature CHAIN DQ412427_SHBs_P-D of FT:mat_peptide DQ412427_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05019461). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTMPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMTSCWGPNLYNIVKPFLSLLPIFFCLWVYI
>gnl|hbvpro|DQ412428_SHBs_P-D Product feature CHAIN DQ412428_SHBs_P-D of FT:mat_peptide DQ412428_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05019462). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412429_SHBs_P-D Product feature CHAIN DQ412429_SHBs_P-D of FT:mat_peptide DQ412429_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05019937). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412430_SHBs_P-D Product feature CHAIN DQ412430_SHBs_P-D of FT:mat_peptide DQ412430_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05020593). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSXHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGXSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGXSLYSXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412431_SHBs_P-D Product feature CHAIN DQ412431_SHBs_P-D of FT:mat_peptide DQ412431_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S05021371). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412432_SHBs_P-D Product feature CHAIN DQ412432_SHBs_P-D of FT:mat_peptide DQ412432_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05021372). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412433_SHBs_P-D Product feature CHAIN DQ412433_SHBs_P-D of FT:mat_peptide DQ412433_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05021373). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMTWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412434_SHBs_P-D Product feature CHAIN DQ412434_SHBs_P-D of FT:mat_peptide DQ412434_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05021812). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412435_SHBs_P-D Product feature CHAIN DQ412435_SHBs_P-D of FT:mat_peptide DQ412435_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05023213). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412436_SHBs_P-D Product feature CHAIN DQ412436_SHBs_P-D of FT:mat_peptide DQ412436_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05024256). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQCPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|DQ412437_SHBs_P-D Product feature CHAIN DQ412437_SHBs_P-D of FT:mat_peptide DQ412437_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05024823). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412438_SHBs_P-D Product feature CHAIN DQ412438_SHBs_P-D of FT:mat_peptide DQ412438_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s05024864). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTXSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412439_SHBs_P-D Product feature CHAIN DQ412439_SHBs_P-D of FT:mat_peptide DQ412439_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s06000631). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWVWASAHFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412440_SHBs_P-D Product feature CHAIN DQ412440_SHBs_P-D of FT:mat_peptide DQ412440_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s06001114). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412441_SHBs_P-D Product feature CHAIN DQ412441_SHBs_P-D of FT:mat_peptide DQ412441_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s06001695). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ412442_SHBs_P-D Product feature CHAIN DQ412442_SHBs_P-D of FT:mat_peptide DQ412442_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate s06002113). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ459085_SHBs_P-D Product feature CHAIN DQ459085_SHBs_P-D of FT:mat_peptide DQ459085_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient ID6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSGENCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464168_SHBs_P-D Product feature CHAIN DQ464168_SHBs_P-D of FT:mat_peptide DQ464168_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGCRWVCLRRF
VSFLFSLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464169_SHBs_P-D Product feature CHAIN DQ464169_SHBs_P-D of FT:mat_peptide DQ464169_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGILGPLLVLQAGFFLLTRILTIRQSLDSWWTSLNFLGGTTVCLGENSQSPTSNHSPTSCPPTCPGYRSMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464170_SHBs_P-D Product feature CHAIN DQ464170_SHBs_P-D of FT:mat_peptide DQ464170_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGENSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464172_SHBs_P-D Product feature CHAIN DQ464172_SHBs_P-D of FT:mat_peptide DQ464172_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|DQ464173_SHBs_P-D Product feature CHAIN DQ464173_SHBs_P-D of FT:mat_peptide DQ464173_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|DQ464174_SHBs_P-D Product feature CHAIN DQ464174_SHBs_P-D of FT:mat_peptide DQ464174_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464175_SHBs_P-D Product feature CHAIN DQ464175_SHBs_P-D of FT:mat_peptide DQ464175_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILCPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464176_SHBs_P-D Product feature CHAIN DQ464176_SHBs_P-D of FT:mat_peptide DQ464176_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464177_SHBs_P-D Product feature CHAIN DQ464177_SHBs_P-D of FT:mat_peptide DQ464177_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464178_SHBs_P-D Product feature CHAIN DQ464178_SHBs_P-D of FT:mat_peptide DQ464178_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVGPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILCPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464181_SHBs_P-D Product feature CHAIN DQ464181_SHBs_P-D of FT:mat_peptide DQ464181_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S3). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGENSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIAWLSVTWMMWYWGPSLYSILSLFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ464182_SHBs_P-D Product feature CHAIN DQ464182_SHBs_P-D of FT:mat_peptide DQ464182_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTFAQGTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ486021_SHBs_P-D Product feature CHAIN DQ486021_SHBs_P-D of FT:mat_peptide DQ486021_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQCLDSWRTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFWLWVYI
>gnl|hbvpro|DQ486022_SHBs_P-D Product feature CHAIN DQ486022_SHBs_P-D of FT:mat_peptide DQ486022_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT11). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWRTSLSFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRICTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYNILSPFLPLLPIFFGLWVYI
>gnl|hbvpro|DQ486023_SHBs_P-D Product feature CHAIN DQ486023_SHBs_P-D of FT:mat_peptide DQ486023_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILVLCLIFLLGLLDYQGMLPVCPLMPGSSTTSTGPCRTCTTPAQGTSMYPSWCCTKTLDGNCTCIPIPSSWAFGK
FLWEWASACSFWLSLLVPFVQGFGGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVFF
>gnl|hbvpro|DQ486025_SHBs_P-D Product feature CHAIN DQ486025_SHBs_P-D of FT:mat_peptide DQ486025_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYNILSHFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ871265_SHBs_P-D Product feature CHAIN DQ871265_SHBs_P-D of FT:mat_peptide DQ871265_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate VIY-01-15-2004). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ871267_SHBs_P-D Product feature CHAIN DQ871267_SHBs_P-D of FT:mat_peptide DQ871267_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate VIY-06-14-2005). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ871268_SHBs_P-D Product feature CHAIN DQ871268_SHBs_P-D of FT:mat_peptide DQ871268_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate VIY-07-18-2005). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWFSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ991752_SHBs_P-D Product feature CHAIN DQ991752_SHBs_P-D of FT:mat_peptide DQ991752_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Irish-2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MGNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLITGSPTTSTGPCRTCTTPAQGTSMYPSCCCTKPSEGNCTCIPIPSSWAFGK
FLWAWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ991754_SHBs_P-D Product feature CHAIN DQ991754_SHBs_P-D of FT:mat_peptide DQ991754_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Irish-4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995809_SHBs_P-D Product feature CHAIN DQ995809_SHBs_P-D of FT:mat_peptide DQ995809_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts1_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFVGLSPXVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995810_SHBs_P-D Product feature CHAIN DQ995810_SHBs_P-D of FT:mat_peptide DQ995810_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts2_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|DQ995811_SHBs_P-D Product feature CHAIN DQ995811_SHBs_P-D of FT:mat_peptide DQ995811_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts3_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLAPFVQWFVGLSPIVWLSVMWMMWYWGPSLYSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|DQ995812_SHBs_P-D Product feature CHAIN DQ995812_SHBs_P-D of FT:mat_peptide DQ995812_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts4_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995814_SHBs_P-D Product feature CHAIN DQ995814_SHBs_P-D of FT:mat_peptide DQ995814_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts6_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYASCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPRLYSILSPFLLLLPIFLCLWVYI
>gnl|hbvpro|DQ995815_SHBs_P-D Product feature CHAIN DQ995815_SHBs_P-D of FT:mat_peptide DQ995815_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts7_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYSSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYXILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|DQ995817_SHBs_P-D Product feature CHAIN DQ995817_SHBs_P-D of FT:mat_peptide DQ995817_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts9_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPIIPGSSNTSTGPCRTCMTTAHRTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSCLSLLVPFVQWFAGLSPTVWLSAILMMWYWGPRVCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995818_SHBs_P-D Product feature CHAIN DQ995818_SHBs_P-D of FT:mat_peptide DQ995818_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts10_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995819_SHBs_P-D Product feature CHAIN DQ995819_SHBs_P-D of FT:mat_peptide DQ995819_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts11_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995820_SHBs_P-D Product feature CHAIN DQ995820_SHBs_P-D of FT:mat_peptide DQ995820_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts12_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995821_SHBs_P-D Product feature CHAIN DQ995821_SHBs_P-D of FT:mat_peptide DQ995821_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts13_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGXTTVCLGQNSQSPTSNHSPTXCPPTCXGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995823_SHBs_P-D Product feature CHAIN DQ995823_SHBs_P-D of FT:mat_peptide DQ995823_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts15_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWXYI
>gnl|hbvpro|DQ995824_SHBs_P-D Product feature CHAIN DQ995824_SHBs_P-D of FT:mat_peptide DQ995824_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts16_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSGGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995825_SHBs_P-D Product feature CHAIN DQ995825_SHBs_P-D of FT:mat_peptide DQ995825_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts17_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSXSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995826_SHBs_P-D Product feature CHAIN DQ995826_SHBs_P-D of FT:mat_peptide DQ995826_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts18_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995828_SHBs_P-D Product feature CHAIN DQ995828_SHBs_P-D of FT:mat_peptide DQ995828_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts20_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGTTVCLGQNAQSPTSNHSPTSCPPTGPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995830_SHBs_P-D Product feature CHAIN DQ995830_SHBs_P-D of FT:mat_peptide DQ995830_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts22_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKLSDGNCTCIPIPSSWAFGK
FLWEWXLARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995831_SHBs_P-D Product feature CHAIN DQ995831_SHBs_P-D of FT:mat_peptide DQ995831_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts23_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSCLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995832_SHBs_P-D Product feature CHAIN DQ995832_SHBs_P-D of FT:mat_peptide DQ995832_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts24_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLXIXRLCLIFLLVLLDYXGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSXLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFXCLWVYI
>gnl|hbvpro|DQ995835_SHBs_P-D Product feature CHAIN DQ995835_SHBs_P-D of FT:mat_peptide DQ995835_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts27_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFXLLTKILTIPQSLDSWWXSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPTDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSXLVPFVQWFVGLSPTVWLSVILMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995837_SHBs_P-D Product feature CHAIN DQ995837_SHBs_P-D of FT:mat_peptide DQ995837_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts29_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFIPLLLIFCVLWAYI
>gnl|hbvpro|DQ995838_SHBs_P-D Product feature CHAIN DQ995838_SHBs_P-D of FT:mat_peptide DQ995838_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts30_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSAISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995839_SHBs_P-D Product feature CHAIN DQ995839_SHBs_P-D of FT:mat_peptide DQ995839_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts31_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGTTVCLGRNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVMWMMWYWGPNLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995840_SHBs_P-D Product feature CHAIN DQ995840_SHBs_P-D of FT:mat_peptide DQ995840_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts32_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVMWMMWYWGPSLYSILSSFLPLLPIFLCLWVYI
>gnl|hbvpro|DQ995841_SHBs_P-D Product feature CHAIN DQ995841_SHBs_P-D of FT:mat_peptide DQ995841_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts33_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMIPSCCCTKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995842_SHBs_P-D Product feature CHAIN DQ995842_SHBs_P-D of FT:mat_peptide DQ995842_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts34_Bas). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995844_SHBs_P-D Product feature CHAIN DQ995844_SHBs_P-D of FT:mat_peptide DQ995844_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts4_24mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995845_SHBs_P-D Product feature CHAIN DQ995845_SHBs_P-D of FT:mat_peptide DQ995845_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts9_12mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPIIPGSSNTSTGPCRTCMTTAHRTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSCLSLLVPFVQWFAGLSPTVWLSAILMMWYWGPRVCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995846_SHBs_P-D Product feature CHAIN DQ995846_SHBs_P-D of FT:mat_peptide DQ995846_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts9_24mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENIISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPIIPGSSNTSTGPCRTCMTTAHRTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSCLSLLVPFVQWFAGLSPTVWLSAILMMWYWGPRVCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995847_SHBs_P-D Product feature CHAIN DQ995847_SHBs_P-D of FT:mat_peptide DQ995847_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts12_PreT). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995848_SHBs_P-D Product feature CHAIN DQ995848_SHBs_P-D of FT:mat_peptide DQ995848_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts12_3mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995849_SHBs_P-D Product feature CHAIN DQ995849_SHBs_P-D of FT:mat_peptide DQ995849_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts12_12mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995850_SHBs_P-D Product feature CHAIN DQ995850_SHBs_P-D of FT:mat_peptide DQ995850_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts12_24mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSFLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995851_SHBs_P-D Product feature CHAIN DQ995851_SHBs_P-D of FT:mat_peptide DQ995851_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts17_PreT). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSXSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995852_SHBs_P-D Product feature CHAIN DQ995852_SHBs_P-D of FT:mat_peptide DQ995852_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts17_12mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSXSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMXPSXCCTKPSDGNCTCIPIPSSWAFGK
FLWXWASARFSWLSLLVPFVQWFVGLSPTVWLLVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995853_SHBs_P-D Product feature CHAIN DQ995853_SHBs_P-D of FT:mat_peptide DQ995853_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts17_24mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGTTVCLGQNSRSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMSPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWXWASARFSWLSLLVPFVQWFVGLSPTVWLLVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995854_SHBs_P-D Product feature CHAIN DQ995854_SHBs_P-D of FT:mat_peptide DQ995854_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts23_PreT-28mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995855_SHBs_P-D Product feature CHAIN DQ995855_SHBs_P-D of FT:mat_peptide DQ995855_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts23_PreT-24mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSCLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995856_SHBs_P-D Product feature CHAIN DQ995856_SHBs_P-D of FT:mat_peptide DQ995856_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts23_12mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSCLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995857_SHBs_P-D Product feature CHAIN DQ995857_SHBs_P-D of FT:mat_peptide DQ995857_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts23_24mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMWPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSXLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|DQ995858_SHBs_P-D Product feature CHAIN DQ995858_SHBs_P-D of FT:mat_peptide DQ995858_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts27_PreT). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMNPSCCCTKPTDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPXLYNILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|DQ995861_SHBs_P-D Product feature CHAIN DQ995861_SHBs_P-D of FT:mat_peptide DQ995861_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts24_3mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLXIXRLCLIFLLVLLDYXGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSXLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFXCLWVYI
>gnl|hbvpro|DQ995862_SHBs_P-D Product feature CHAIN DQ995862_SHBs_P-D of FT:mat_peptide DQ995862_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pts24_6mo). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLXIXRLCLIFLLVLLDYXGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSXLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFXCLWVYI
>gnl|hbvpro|EF103275_SHBs_P-D Product feature CHAIN EF103275_SHBs_P-D of FT:mat_peptide EF103275_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF103276_SHBs_P-D Product feature CHAIN EF103276_SHBs_P-D of FT:mat_peptide EF103276_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQQLQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPPIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMLWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF103277_SHBs_P-D Product feature CHAIN EF103277_SHBs_P-D of FT:mat_peptide EF103277_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran33). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCVRRL
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF103279_SHBs_P-D Product feature CHAIN EF103279_SHBs_P-D of FT:mat_peptide EF103279_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran99). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF103280_SHBs_P-D Product feature CHAIN EF103280_SHBs_P-D of FT:mat_peptide EF103280_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran100). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWPSARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF103281_SHBs_P-D Product feature CHAIN EF103281_SHBs_P-D of FT:mat_peptide EF103281_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWPSARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF398036_SHBs_P-D Product feature CHAIN EF398036_SHBs_P-D of FT:mat_peptide EF398036_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Japreira 68). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTRIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF547858_SHBs_P-D Product feature CHAIN EF547858_SHBs_P-D of FT:mat_peptide EF547858_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FD09-0). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFLGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690471_SHBs_P-D Product feature CHAIN EF690471_SHBs_P-D of FT:mat_peptide EF690471_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 020-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690472_SHBs_P-D Product feature CHAIN EF690472_SHBs_P-D of FT:mat_peptide EF690472_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 328-S). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690473_SHBs_P-D Product feature CHAIN EF690473_SHBs_P-D of FT:mat_peptide EF690473_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 344-S). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSIIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690474_SHBs_P-D Product feature CHAIN EF690474_SHBs_P-D of FT:mat_peptide EF690474_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 026-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690475_SHBs_P-D Product feature CHAIN EF690475_SHBs_P-D of FT:mat_peptide EF690475_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 376-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690476_SHBs_P-D Product feature CHAIN EF690476_SHBs_P-D of FT:mat_peptide EF690476_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 141-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690477_SHBs_P-D Product feature CHAIN EF690477_SHBs_P-D of FT:mat_peptide EF690477_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 377-SE). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690478_SHBs_P-D Product feature CHAIN EF690478_SHBs_P-D of FT:mat_peptide EF690478_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 339-S). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690479_SHBs_P-D Product feature CHAIN EF690479_SHBs_P-D of FT:mat_peptide EF690479_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 041-N). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690480_SHBs_P-D Product feature CHAIN EF690480_SHBs_P-D of FT:mat_peptide EF690480_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 372-S). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690481_SHBs_P-D Product feature CHAIN EF690481_SHBs_P-D of FT:mat_peptide EF690481_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 208-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|EF690482_SHBs_P-D Product feature CHAIN EF690482_SHBs_P-D of FT:mat_peptide EF690482_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 149-CW). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EF690483_SHBs_P-D Product feature CHAIN EF690483_SHBs_P-D of FT:mat_peptide EF690483_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 189-CW). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU155893_SHBs_P-D Product feature CHAIN EU155893_SHBs_P-D of FT:mat_peptide EU155893_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4). Complete genome. [Hepadnaviridae] (length=226 residues).
MGNITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDCQGMLPVCPLISGSSTTSTGPCRPCITTAQETSMFASCCCTKPLDGNYTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFAGLSPTVWLSVIWTMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU155895_SHBs_P-D Product feature CHAIN EU155895_SHBs_P-D of FT:mat_peptide EU155895_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5b). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILRIPQSLDSWWTSLNFQGGTTVCLGQNSQSPTFNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFSLALLDYRGMLPVCPPMLASSNTSRGTCRSCMIHAPGTSMSPFCCCTKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSSLVQFVQWFVGLSPTVWLSVIWMIWYWGPSLYSILSPFLPLLPISFYLWVYI
>gnl|hbvpro|EU159677_SHBs_P-D Product feature CHAIN EU159677_SHBs_P-D of FT:mat_peptide EU159677_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Irish-3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU346890_SHBs_P-D Product feature CHAIN EU346890_SHBs_P-D of FT:mat_peptide EU346890_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVRLSPTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414105_SHBs_P-D Product feature CHAIN EU414105_SHBs_P-D of FT:mat_peptide EU414105_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSXIWMMWYWGXSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414106_SHBs_P-D Product feature CHAIN EU414106_SHBs_P-D of FT:mat_peptide EU414106_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414107_SHBs_P-D Product feature CHAIN EU414107_SHBs_P-D of FT:mat_peptide EU414107_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414108_SHBs_P-D Product feature CHAIN EU414108_SHBs_P-D of FT:mat_peptide EU414108_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414109_SHBs_P-D Product feature CHAIN EU414109_SHBs_P-D of FT:mat_peptide EU414109_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYIX
>gnl|hbvpro|EU414110_SHBs_P-D Product feature CHAIN EU414110_SHBs_P-D of FT:mat_peptide EU414110_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414111_SHBs_P-D Product feature CHAIN EU414111_SHBs_P-D of FT:mat_peptide EU414111_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414112_SHBs_P-D Product feature CHAIN EU414112_SHBs_P-D of FT:mat_peptide EU414112_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414113_SHBs_P-D Product feature CHAIN EU414113_SHBs_P-D of FT:mat_peptide EU414113_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414114_SHBs_P-D Product feature CHAIN EU414114_SHBs_P-D of FT:mat_peptide EU414114_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGENAVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414115_SHBs_P-D Product feature CHAIN EU414115_SHBs_P-D of FT:mat_peptide EU414115_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSXGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLXLLPIFFCLWVYI
>gnl|hbvpro|EU414116_SHBs_P-D Product feature CHAIN EU414116_SHBs_P-D of FT:mat_peptide EU414116_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414117_SHBs_P-D Product feature CHAIN EU414117_SHBs_P-D of FT:mat_peptide EU414117_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414118_SHBs_P-D Product feature CHAIN EU414118_SHBs_P-D of FT:mat_peptide EU414118_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414119_SHBs_P-D Product feature CHAIN EU414119_SHBs_P-D of FT:mat_peptide EU414119_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=224 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWV
>gnl|hbvpro|EU414120_SHBs_P-D Product feature CHAIN EU414120_SHBs_P-D of FT:mat_peptide EU414120_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPYRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSISSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414121_SHBs_P-D Product feature CHAIN EU414121_SHBs_P-D of FT:mat_peptide EU414121_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414122_SHBs_P-D Product feature CHAIN EU414122_SHBs_P-D of FT:mat_peptide EU414122_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414123_SHBs_P-D Product feature CHAIN EU414123_SHBs_P-D of FT:mat_peptide EU414123_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414124_SHBs_P-D Product feature CHAIN EU414124_SHBs_P-D of FT:mat_peptide EU414124_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414125_SHBs_P-D Product feature CHAIN EU414125_SHBs_P-D of FT:mat_peptide EU414125_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414126_SHBs_P-D Product feature CHAIN EU414126_SHBs_P-D of FT:mat_peptide EU414126_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414127_SHBs_P-D Product feature CHAIN EU414127_SHBs_P-D of FT:mat_peptide EU414127_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414128_SHBs_P-D Product feature CHAIN EU414128_SHBs_P-D of FT:mat_peptide EU414128_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414129_SHBs_P-D Product feature CHAIN EU414129_SHBs_P-D of FT:mat_peptide EU414129_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414130_SHBs_P-D Product feature CHAIN EU414130_SHBs_P-D of FT:mat_peptide EU414130_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPYVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414135_SHBs_P-D Product feature CHAIN EU414135_SHBs_P-D of FT:mat_peptide EU414135_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414136_SHBs_P-D Product feature CHAIN EU414136_SHBs_P-D of FT:mat_peptide EU414136_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDANCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414138_SHBs_P-D Product feature CHAIN EU414138_SHBs_P-D of FT:mat_peptide EU414138_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPYVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414139_SHBs_P-D Product feature CHAIN EU414139_SHBs_P-D of FT:mat_peptide EU414139_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414140_SHBs_P-D Product feature CHAIN EU414140_SHBs_P-D of FT:mat_peptide EU414140_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTXVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLIPGSSTTSXGPCXTCTTXXQGTSMXPSCCCXKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414141_SHBs_P-D Product feature CHAIN EU414141_SHBs_P-D of FT:mat_peptide EU414141_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414142_SHBs_P-D Product feature CHAIN EU414142_SHBs_P-D of FT:mat_peptide EU414142_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSXIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU414143_SHBs_P-D Product feature CHAIN EU414143_SHBs_P-D of FT:mat_peptide EU414143_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594382_SHBs_P-D Product feature CHAIN EU594382_SHBs_P-D of FT:mat_peptide EU594382_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594396_SHBs_P-D Product feature CHAIN EU594396_SHBs_P-D of FT:mat_peptide EU594396_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594397_SHBs_P-D Product feature CHAIN EU594397_SHBs_P-D of FT:mat_peptide EU594397_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594398_SHBs_P-D Product feature CHAIN EU594398_SHBs_P-D of FT:mat_peptide EU594398_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTAAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594399_SHBs_P-D Product feature CHAIN EU594399_SHBs_P-D of FT:mat_peptide EU594399_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594400_SHBs_P-D Product feature CHAIN EU594400_SHBs_P-D of FT:mat_peptide EU594400_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594401_SHBs_P-D Product feature CHAIN EU594401_SHBs_P-D of FT:mat_peptide EU594401_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594402_SHBs_P-D Product feature CHAIN EU594402_SHBs_P-D of FT:mat_peptide EU594402_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594403_SHBs_P-D Product feature CHAIN EU594403_SHBs_P-D of FT:mat_peptide EU594403_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594404_SHBs_P-D Product feature CHAIN EU594404_SHBs_P-D of FT:mat_peptide EU594404_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594405_SHBs_P-D Product feature CHAIN EU594405_SHBs_P-D of FT:mat_peptide EU594405_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRTLTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594407_SHBs_P-D Product feature CHAIN EU594407_SHBs_P-D of FT:mat_peptide EU594407_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594408_SHBs_P-D Product feature CHAIN EU594408_SHBs_P-D of FT:mat_peptide EU594408_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|EU594409_SHBs_P-D Product feature CHAIN EU594409_SHBs_P-D of FT:mat_peptide EU594409_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594410_SHBs_P-D Product feature CHAIN EU594410_SHBs_P-D of FT:mat_peptide EU594410_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594411_SHBs_P-D Product feature CHAIN EU594411_SHBs_P-D of FT:mat_peptide EU594411_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTIVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594412_SHBs_P-D Product feature CHAIN EU594412_SHBs_P-D of FT:mat_peptide EU594412_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTIVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594413_SHBs_P-D Product feature CHAIN EU594413_SHBs_P-D of FT:mat_peptide EU594413_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594414_SHBs_P-D Product feature CHAIN EU594414_SHBs_P-D of FT:mat_peptide EU594414_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594415_SHBs_P-D Product feature CHAIN EU594415_SHBs_P-D of FT:mat_peptide EU594415_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594416_SHBs_P-D Product feature CHAIN EU594416_SHBs_P-D of FT:mat_peptide EU594416_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594417_SHBs_P-D Product feature CHAIN EU594417_SHBs_P-D of FT:mat_peptide EU594417_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594418_SHBs_P-D Product feature CHAIN EU594418_SHBs_P-D of FT:mat_peptide EU594418_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594419_SHBs_P-D Product feature CHAIN EU594419_SHBs_P-D of FT:mat_peptide EU594419_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594420_SHBs_P-D Product feature CHAIN EU594420_SHBs_P-D of FT:mat_peptide EU594420_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594421_SHBs_P-D Product feature CHAIN EU594421_SHBs_P-D of FT:mat_peptide EU594421_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594422_SHBs_P-D Product feature CHAIN EU594422_SHBs_P-D of FT:mat_peptide EU594422_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594423_SHBs_P-D Product feature CHAIN EU594423_SHBs_P-D of FT:mat_peptide EU594423_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594424_SHBs_P-D Product feature CHAIN EU594424_SHBs_P-D of FT:mat_peptide EU594424_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594425_SHBs_P-D Product feature CHAIN EU594425_SHBs_P-D of FT:mat_peptide EU594425_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPXYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVELSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594426_SHBs_P-D Product feature CHAIN EU594426_SHBs_P-D of FT:mat_peptide EU594426_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594427_SHBs_P-D Product feature CHAIN EU594427_SHBs_P-D of FT:mat_peptide EU594427_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594428_SHBs_P-D Product feature CHAIN EU594428_SHBs_P-D of FT:mat_peptide EU594428_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594429_SHBs_P-D Product feature CHAIN EU594429_SHBs_P-D of FT:mat_peptide EU594429_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594430_SHBs_P-D Product feature CHAIN EU594430_SHBs_P-D of FT:mat_peptide EU594430_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594431_SHBs_P-D Product feature CHAIN EU594431_SHBs_P-D of FT:mat_peptide EU594431_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594432_SHBs_P-D Product feature CHAIN EU594432_SHBs_P-D of FT:mat_peptide EU594432_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594433_SHBs_P-D Product feature CHAIN EU594433_SHBs_P-D of FT:mat_peptide EU594433_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGTCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU594434_SHBs_P-D Product feature CHAIN EU594434_SHBs_P-D of FT:mat_peptide EU594434_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGPSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|EU686583_SHBs_P-D Product feature CHAIN EU686583_SHBs_P-D of FT:mat_peptide EU686583_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 72A05). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787436_SHBs_P-D Product feature CHAIN EU787436_SHBs_P-D of FT:mat_peptide EU787436_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 165). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787437_SHBs_P-D Product feature CHAIN EU787437_SHBs_P-D of FT:mat_peptide EU787437_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787438_SHBs_P-D Product feature CHAIN EU787438_SHBs_P-D of FT:mat_peptide EU787438_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787440_SHBs_P-D Product feature CHAIN EU787440_SHBs_P-D of FT:mat_peptide EU787440_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W17). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787441_SHBs_P-D Product feature CHAIN EU787441_SHBs_P-D of FT:mat_peptide EU787441_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787442_SHBs_P-D Product feature CHAIN EU787442_SHBs_P-D of FT:mat_peptide EU787442_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W37). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787443_SHBs_P-D Product feature CHAIN EU787443_SHBs_P-D of FT:mat_peptide EU787443_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate w40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|EU787446_SHBs_P-D Product feature CHAIN EU787446_SHBs_P-D of FT:mat_peptide EU787446_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W75). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU787447_SHBs_P-D Product feature CHAIN EU787447_SHBs_P-D of FT:mat_peptide EU787447_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVSLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU919197_SHBs_P-D Product feature CHAIN EU919197_SHBs_P-D of FT:mat_peptide EU919197_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJU). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
TIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPYCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU921418_SHBs_P-D Product feature CHAIN EU921418_SHBs_P-D of FT:mat_peptide EU921418_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.165.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU921419_SHBs_P-D Product feature CHAIN EU921419_SHBs_P-D of FT:mat_peptide EU921419_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22.252.07). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939680_SHBs_P-D Product feature CHAIN EU939680_SHBs_P-D of FT:mat_peptide EU939680_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C186). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTIPAQGTSMYPSCCCTKASDRNCTCIPIPSSWAFGK
FLWEWASAHFSLLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|EU939681_SHBs_P-D Product feature CHAIN EU939681_SHBs_P-D of FT:mat_peptide EU939681_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349205_SHBs_P-D Product feature CHAIN FJ349205_SHBs_P-D of FT:mat_peptide FJ349205_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H5). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349206_SHBs_P-D Product feature CHAIN FJ349206_SHBs_P-D of FT:mat_peptide FJ349206_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FJ349208_SHBs_P-D Product feature CHAIN FJ349208_SHBs_P-D of FT:mat_peptide FJ349208_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H25). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349209_SHBs_P-D Product feature CHAIN FJ349209_SHBs_P-D of FT:mat_peptide FJ349209_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H29). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349211_SHBs_P-D Product feature CHAIN FJ349211_SHBs_P-D of FT:mat_peptide FJ349211_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H34). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349213_SHBs_P-D Product feature CHAIN FJ349213_SHBs_P-D of FT:mat_peptide FJ349213_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H59). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349214_SHBs_P-D Product feature CHAIN FJ349214_SHBs_P-D of FT:mat_peptide FJ349214_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H61). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349215_SHBs_P-D Product feature CHAIN FJ349215_SHBs_P-D of FT:mat_peptide FJ349215_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H82). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVIQAGFFLLIRILTITHSLDSWWTSLNFLGGTTVCVVQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349216_SHBs_P-D Product feature CHAIN FJ349216_SHBs_P-D of FT:mat_peptide FJ349216_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H113). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349218_SHBs_P-D Product feature CHAIN FJ349218_SHBs_P-D of FT:mat_peptide FJ349218_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H135). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349219_SHBs_P-D Product feature CHAIN FJ349219_SHBs_P-D of FT:mat_peptide FJ349219_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H138). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|FJ349220_SHBs_P-D Product feature CHAIN FJ349220_SHBs_P-D of FT:mat_peptide FJ349220_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H144). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349228_SHBs_P-D Product feature CHAIN FJ349228_SHBs_P-D of FT:mat_peptide FJ349228_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C11). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349229_SHBs_P-D Product feature CHAIN FJ349229_SHBs_P-D of FT:mat_peptide FJ349229_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349230_SHBs_P-D Product feature CHAIN FJ349230_SHBs_P-D of FT:mat_peptide FJ349230_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349231_SHBs_P-D Product feature CHAIN FJ349231_SHBs_P-D of FT:mat_peptide FJ349231_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C22). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWFWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349232_SHBs_P-D Product feature CHAIN FJ349232_SHBs_P-D of FT:mat_peptide FJ349232_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C51). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTSAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349233_SHBs_P-D Product feature CHAIN FJ349233_SHBs_P-D of FT:mat_peptide FJ349233_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C54). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349234_SHBs_P-D Product feature CHAIN FJ349234_SHBs_P-D of FT:mat_peptide FJ349234_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C82). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ349235_SHBs_P-D Product feature CHAIN FJ349235_SHBs_P-D of FT:mat_peptide FJ349235_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C90). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ386590_SHBs_P-D Product feature CHAIN FJ386590_SHBs_P-D of FT:mat_peptide FJ386590_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1841). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ562338_SHBs_P-D Product feature CHAIN FJ562338_SHBs_P-D of FT:mat_peptide FJ562338_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I192). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTSAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLLLLPIFFCLWVYI
>gnl|hbvpro|FJ621799_SHBs_P-D Product feature CHAIN FJ621799_SHBs_P-D of FT:mat_peptide FJ621799_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2898). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTXVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ622444_SHBs_P-D Product feature CHAIN FJ622444_SHBs_P-D of FT:mat_peptide FJ622444_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2816). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTXTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ622867_SHBs_P-D Product feature CHAIN FJ622867_SHBs_P-D of FT:mat_peptide FJ622867_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S4534). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRXCTXPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ622869_SHBs_P-D Product feature CHAIN FJ622869_SHBs_P-D of FT:mat_peptide FJ622869_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S4146). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSXIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ622870_SHBs_P-D Product feature CHAIN FJ622870_SHBs_P-D of FT:mat_peptide FJ622870_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2786). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692502_SHBs_P-D Product feature CHAIN FJ692502_SHBs_P-D of FT:mat_peptide FJ692502_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_48020). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692505_SHBs_P-D Product feature CHAIN FJ692505_SHBs_P-D of FT:mat_peptide FJ692505_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50151). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692506_SHBs_P-D Product feature CHAIN FJ692506_SHBs_P-D of FT:mat_peptide FJ692506_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50157). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692507_SHBs_P-D Product feature CHAIN FJ692507_SHBs_P-D of FT:mat_peptide FJ692507_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50158). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692508_SHBs_P-D Product feature CHAIN FJ692508_SHBs_P-D of FT:mat_peptide FJ692508_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48050). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692509_SHBs_P-D Product feature CHAIN FJ692509_SHBs_P-D of FT:mat_peptide FJ692509_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48063). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692510_SHBs_P-D Product feature CHAIN FJ692510_SHBs_P-D of FT:mat_peptide FJ692510_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48064). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692511_SHBs_P-D Product feature CHAIN FJ692511_SHBs_P-D of FT:mat_peptide FJ692511_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48082). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692512_SHBs_P-D Product feature CHAIN FJ692512_SHBs_P-D of FT:mat_peptide FJ692512_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48092). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692513_SHBs_P-D Product feature CHAIN FJ692513_SHBs_P-D of FT:mat_peptide FJ692513_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48099). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692514_SHBs_P-D Product feature CHAIN FJ692514_SHBs_P-D of FT:mat_peptide FJ692514_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48100). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCXTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692515_SHBs_P-D Product feature CHAIN FJ692515_SHBs_P-D of FT:mat_peptide FJ692515_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48101). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGXSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692516_SHBs_P-D Product feature CHAIN FJ692516_SHBs_P-D of FT:mat_peptide FJ692516_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48102). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692517_SHBs_P-D Product feature CHAIN FJ692517_SHBs_P-D of FT:mat_peptide FJ692517_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48106). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILXPFXPLXPIFFCLWVYI
>gnl|hbvpro|FJ692518_SHBs_P-D Product feature CHAIN FJ692518_SHBs_P-D of FT:mat_peptide FJ692518_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48108). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692519_SHBs_P-D Product feature CHAIN FJ692519_SHBs_P-D of FT:mat_peptide FJ692519_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48110). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692520_SHBs_P-D Product feature CHAIN FJ692520_SHBs_P-D of FT:mat_peptide FJ692520_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48112). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692521_SHBs_P-D Product feature CHAIN FJ692521_SHBs_P-D of FT:mat_peptide FJ692521_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48114). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692522_SHBs_P-D Product feature CHAIN FJ692522_SHBs_P-D of FT:mat_peptide FJ692522_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692523_SHBs_P-D Product feature CHAIN FJ692523_SHBs_P-D of FT:mat_peptide FJ692523_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48116). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692524_SHBs_P-D Product feature CHAIN FJ692524_SHBs_P-D of FT:mat_peptide FJ692524_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48117). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692525_SHBs_P-D Product feature CHAIN FJ692525_SHBs_P-D of FT:mat_peptide FJ692525_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48118). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTAPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692526_SHBs_P-D Product feature CHAIN FJ692526_SHBs_P-D of FT:mat_peptide FJ692526_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692527_SHBs_P-D Product feature CHAIN FJ692527_SHBs_P-D of FT:mat_peptide FJ692527_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48120). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692528_SHBs_P-D Product feature CHAIN FJ692528_SHBs_P-D of FT:mat_peptide FJ692528_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_48121). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692529_SHBs_P-D Product feature CHAIN FJ692529_SHBs_P-D of FT:mat_peptide FJ692529_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50003). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPRXYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692530_SHBs_P-D Product feature CHAIN FJ692530_SHBs_P-D of FT:mat_peptide FJ692530_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50044). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPYLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692531_SHBs_P-D Product feature CHAIN FJ692531_SHBs_P-D of FT:mat_peptide FJ692531_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50051). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692532_SHBs_P-D Product feature CHAIN FJ692532_SHBs_P-D of FT:mat_peptide FJ692532_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50053). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692533_SHBs_P-D Product feature CHAIN FJ692533_SHBs_P-D of FT:mat_peptide FJ692533_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50064). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692534_SHBs_P-D Product feature CHAIN FJ692534_SHBs_P-D of FT:mat_peptide FJ692534_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50071). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692535_SHBs_P-D Product feature CHAIN FJ692535_SHBs_P-D of FT:mat_peptide FJ692535_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50072). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692537_SHBs_P-D Product feature CHAIN FJ692537_SHBs_P-D of FT:mat_peptide FJ692537_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50078). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692538_SHBs_P-D Product feature CHAIN FJ692538_SHBs_P-D of FT:mat_peptide FJ692538_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50079). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=228 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSYPPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692539_SHBs_P-D Product feature CHAIN FJ692539_SHBs_P-D of FT:mat_peptide FJ692539_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50153). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ692541_SHBs_P-D Product feature CHAIN FJ692541_SHBs_P-D of FT:mat_peptide FJ692541_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate E_48105). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MEXITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGXXVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMXPSCCCXKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|FJ709467_SHBs_P-D Product feature CHAIN FJ709467_SHBs_P-D of FT:mat_peptide FJ709467_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHI11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGILPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLLSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ709474_SHBs_P-D Product feature CHAIN FJ709474_SHBs_P-D of FT:mat_peptide FJ709474_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHI18). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ709475_SHBs_P-D Product feature CHAIN FJ709475_SHBs_P-D of FT:mat_peptide FJ709475_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHI19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ709486_SHBs_P-D Product feature CHAIN FJ709486_SHBs_P-D of FT:mat_peptide FJ709486_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHI33). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ709492_SHBs_P-D Product feature CHAIN FJ709492_SHBs_P-D of FT:mat_peptide FJ709492_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHI39). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ751383_SHBs_P-D Product feature CHAIN FJ751383_SHBs_P-D of FT:mat_peptide FJ751383_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WX39). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ899792_SHBs_P-D Product feature CHAIN FJ899792_SHBs_P-D of FT:mat_peptide FJ899792_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTGTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904395_SHBs_P-D Product feature CHAIN FJ904395_SHBs_P-D of FT:mat_peptide FJ904395_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A10a). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMLYWGPTLHNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904399_SHBs_P-D Product feature CHAIN FJ904399_SHBs_P-D of FT:mat_peptide FJ904399_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A18). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904402_SHBs_P-D Product feature CHAIN FJ904402_SHBs_P-D of FT:mat_peptide FJ904402_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904410_SHBs_P-D Product feature CHAIN FJ904410_SHBs_P-D of FT:mat_peptide FJ904410_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A54b). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTWPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904412_SHBs_P-D Product feature CHAIN FJ904412_SHBs_P-D of FT:mat_peptide FJ904412_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A56). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904415_SHBs_P-D Product feature CHAIN FJ904415_SHBs_P-D of FT:mat_peptide FJ904415_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A63). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904418_SHBs_P-D Product feature CHAIN FJ904418_SHBs_P-D of FT:mat_peptide FJ904418_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A69a). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904419_SHBs_P-D Product feature CHAIN FJ904419_SHBs_P-D of FT:mat_peptide FJ904419_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A70). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVFQAGCFLLTRILTMPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSILSPFLPLFPIFFCLWVYI
>gnl|hbvpro|FJ904420_SHBs_P-D Product feature CHAIN FJ904420_SHBs_P-D of FT:mat_peptide FJ904420_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71a). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904421_SHBs_P-D Product feature CHAIN FJ904421_SHBs_P-D of FT:mat_peptide FJ904421_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A71b). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904422_SHBs_P-D Product feature CHAIN FJ904422_SHBs_P-D of FT:mat_peptide FJ904422_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A76). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGRSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904424_SHBs_P-D Product feature CHAIN FJ904424_SHBs_P-D of FT:mat_peptide FJ904424_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A79a). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904426_SHBs_P-D Product feature CHAIN FJ904426_SHBs_P-D of FT:mat_peptide FJ904426_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B4). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|FJ904427_SHBs_P-D Product feature CHAIN FJ904427_SHBs_P-D of FT:mat_peptide FJ904427_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B6). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSERNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904429_SHBs_P-D Product feature CHAIN FJ904429_SHBs_P-D of FT:mat_peptide FJ904429_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B8). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTMPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTFCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904431_SHBs_P-D Product feature CHAIN FJ904431_SHBs_P-D of FT:mat_peptide FJ904431_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B12). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYHILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904432_SHBs_P-D Product feature CHAIN FJ904432_SHBs_P-D of FT:mat_peptide FJ904432_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B14). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904433_SHBs_C-D Product feature CHAIN FJ904433_SHBs_C-D of FT:mat_peptide FJ904433_SHBs_C-D of [Viruses] Hepatitis B Virus genotype D (isolate B15). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSPYSIXSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904435_SHBs_P-D Product feature CHAIN FJ904435_SHBs_P-D of FT:mat_peptide FJ904435_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904438_SHBs_P-D Product feature CHAIN FJ904438_SHBs_P-D of FT:mat_peptide FJ904438_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCTXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904439_SHBs_P-D Product feature CHAIN FJ904439_SHBs_P-D of FT:mat_peptide FJ904439_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904443_SHBs_P-D Product feature CHAIN FJ904443_SHBs_P-D of FT:mat_peptide FJ904443_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FJ904445_SHBs_P-D Product feature CHAIN FJ904445_SHBs_P-D of FT:mat_peptide FJ904445_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B62). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FM200190_SHBs_P-D Product feature CHAIN FM200190_SHBs_P-D of FT:mat_peptide FM200190_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FM200191_SHBs_P-D Product feature CHAIN FM200191_SHBs_P-D of FT:mat_peptide FM200191_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FM200192_SHBs_P-D Product feature CHAIN FM200192_SHBs_P-D of FT:mat_peptide FM200192_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSPNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|FM200194_SHBs_P-D Product feature CHAIN FM200194_SHBs_P-D of FT:mat_peptide FM200194_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCXTCTTPAQGTSXXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|FM200197_SHBs_P-D Product feature CHAIN FM200197_SHBs_P-D of FT:mat_peptide FM200197_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FM200205_SHBs_P-D Product feature CHAIN FM200205_SHBs_P-D of FT:mat_peptide FM200205_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FM200212_SHBs_P-D Product feature CHAIN FM200212_SHBs_P-D of FT:mat_peptide FM200212_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSIYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FM200213_SHBs_P-D Product feature CHAIN FM200213_SHBs_P-D of FT:mat_peptide FM200213_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295498_SHBs_P-D Product feature CHAIN FN295498_SHBs_P-D of FT:mat_peptide FN295498_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295500_SHBs_P-D Product feature CHAIN FN295500_SHBs_P-D of FT:mat_peptide FN295500_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVISMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295501_SHBs_P-D Product feature CHAIN FN295501_SHBs_P-D of FT:mat_peptide FN295501_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295504_SHBs_P-D Product feature CHAIN FN295504_SHBs_P-D of FT:mat_peptide FN295504_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRACTTPAQGTSIYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295506_SHBs_P-D Product feature CHAIN FN295506_SHBs_P-D of FT:mat_peptide FN295506_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGPSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295512_SHBs_P-D Product feature CHAIN FN295512_SHBs_P-D of FT:mat_peptide FN295512_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDSQGILPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKLSERNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295513_SHBs_P-D Product feature CHAIN FN295513_SHBs_P-D of FT:mat_peptide FN295513_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M21). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKLSDRNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295514_SHBs_P-D Product feature CHAIN FN295514_SHBs_P-D of FT:mat_peptide FN295514_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTIECLGQNSQSPTSKHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTAWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295515_SHBs_P-D Product feature CHAIN FN295515_SHBs_P-D of FT:mat_peptide FN295515_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295516_SHBs_P-D Product feature CHAIN FN295516_SHBs_P-D of FT:mat_peptide FN295516_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295517_SHBs_P-D Product feature CHAIN FN295517_SHBs_P-D of FT:mat_peptide FN295517_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M25). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295519_SHBs_P-D Product feature CHAIN FN295519_SHBs_P-D of FT:mat_peptide FN295519_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSAGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295523_SHBs_P-D Product feature CHAIN FN295523_SHBs_P-D of FT:mat_peptide FN295523_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M33). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSXLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295524_SHBs_P-D Product feature CHAIN FN295524_SHBs_P-D of FT:mat_peptide FN295524_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M34). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLALQAGFFLLTKILTIPQNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGLCRTCTIPAQGTSIHPSCCCTKPSVGNCTCIPIPPSWAFGK
FLWELASARFSWLSSLVPFVRWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLLLLPIFFCLWVYI
>gnl|hbvpro|FN295525_SHBs_P-D Product feature CHAIN FN295525_SHBs_P-D of FT:mat_peptide FN295525_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M35). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDSQGMLPVCPLIPGSSTTSVGPCKTCTTPAQGTSINPSCCCTKSLDKNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVLFVQWFVDRSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295526_SHBs_P-D Product feature CHAIN FN295526_SHBs_P-D of FT:mat_peptide FN295526_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295545_SHBs_P-D Product feature CHAIN FN295545_SHBs_P-D of FT:mat_peptide FN295545_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D2_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295546_SHBs_P-D Product feature CHAIN FN295546_SHBs_P-D of FT:mat_peptide FN295546_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295547_SHBs_P-D Product feature CHAIN FN295547_SHBs_P-D of FT:mat_peptide FN295547_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295548_SHBs_P-D Product feature CHAIN FN295548_SHBs_P-D of FT:mat_peptide FN295548_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D5_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|FN295549_SHBs_P-D Product feature CHAIN FN295549_SHBs_P-D of FT:mat_peptide FN295549_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D6_D). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ167301_SHBs_P-D Product feature CHAIN GQ167301_SHBs_P-D of FT:mat_peptide GQ167301_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM452). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFSLVLLDYRGMLPVCPVIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWPLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ167302_SHBs_P-D Product feature CHAIN GQ167302_SHBs_P-D of FT:mat_peptide GQ167302_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4521). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFSLVLLDYRGMLPVCPVIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWPLVIRMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183448_SHBs_P-D Product feature CHAIN GQ183448_SHBs_P-D of FT:mat_peptide GQ183448_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4629). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183449_SHBs_P-D Product feature CHAIN GQ183449_SHBs_P-D of FT:mat_peptide GQ183449_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4591). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183450_SHBs_P-D Product feature CHAIN GQ183450_SHBs_P-D of FT:mat_peptide GQ183450_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4589). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183451_SHBs_P-D Product feature CHAIN GQ183451_SHBs_P-D of FT:mat_peptide GQ183451_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4588). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183452_SHBs_P-D Product feature CHAIN GQ183452_SHBs_P-D of FT:mat_peptide GQ183452_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4590). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183453_SHBs_P-D Product feature CHAIN GQ183453_SHBs_P-D of FT:mat_peptide GQ183453_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4574). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183454_SHBs_P-D Product feature CHAIN GQ183454_SHBs_P-D of FT:mat_peptide GQ183454_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4582). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183455_SHBs_P-D Product feature CHAIN GQ183455_SHBs_P-D of FT:mat_peptide GQ183455_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4573). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183456_SHBs_P-D Product feature CHAIN GQ183456_SHBs_P-D of FT:mat_peptide GQ183456_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4572). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183457_SHBs_P-D Product feature CHAIN GQ183457_SHBs_P-D of FT:mat_peptide GQ183457_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4583). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183458_SHBs_P-D Product feature CHAIN GQ183458_SHBs_P-D of FT:mat_peptide GQ183458_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4587). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183459_SHBs_P-D Product feature CHAIN GQ183459_SHBs_P-D of FT:mat_peptide GQ183459_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4585). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183460_SHBs_P-D Product feature CHAIN GQ183460_SHBs_P-D of FT:mat_peptide GQ183460_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4584). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183461_SHBs_P-D Product feature CHAIN GQ183461_SHBs_P-D of FT:mat_peptide GQ183461_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4586). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183462_SHBs_P-D Product feature CHAIN GQ183462_SHBs_P-D of FT:mat_peptide GQ183462_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4567). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183463_SHBs_P-D Product feature CHAIN GQ183463_SHBs_P-D of FT:mat_peptide GQ183463_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4613). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183464_SHBs_P-D Product feature CHAIN GQ183464_SHBs_P-D of FT:mat_peptide GQ183464_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4703). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183465_SHBs_P-D Product feature CHAIN GQ183465_SHBs_P-D of FT:mat_peptide GQ183465_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4614). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183466_SHBs_P-D Product feature CHAIN GQ183466_SHBs_P-D of FT:mat_peptide GQ183466_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4577). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183467_SHBs_P-D Product feature CHAIN GQ183467_SHBs_P-D of FT:mat_peptide GQ183467_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4705). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCVLRG
IILLFLLLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFFLWVYI
>gnl|hbvpro|GQ183468_SHBs_P-D Product feature CHAIN GQ183468_SHBs_P-D of FT:mat_peptide GQ183468_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4632). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183469_SHBs_P-D Product feature CHAIN GQ183469_SHBs_P-D of FT:mat_peptide GQ183469_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4602). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183470_SHBs_P-D Product feature CHAIN GQ183470_SHBs_P-D of FT:mat_peptide GQ183470_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4639). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183471_SHBs_P-D Product feature CHAIN GQ183471_SHBs_P-D of FT:mat_peptide GQ183471_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4610). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTSVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183472_SHBs_P-D Product feature CHAIN GQ183472_SHBs_P-D of FT:mat_peptide GQ183472_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4691). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183473_SHBs_P-D Product feature CHAIN GQ183473_SHBs_P-D of FT:mat_peptide GQ183473_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4601). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPLLPLLPFFFCLWVYI
>gnl|hbvpro|GQ183474_SHBs_P-D Product feature CHAIN GQ183474_SHBs_P-D of FT:mat_peptide GQ183474_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4594). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183475_SHBs_P-D Product feature CHAIN GQ183475_SHBs_P-D of FT:mat_peptide GQ183475_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4575). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183476_SHBs_P-D Product feature CHAIN GQ183476_SHBs_P-D of FT:mat_peptide GQ183476_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4603). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183477_SHBs_P-D Product feature CHAIN GQ183477_SHBs_P-D of FT:mat_peptide GQ183477_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4604). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183478_SHBs_P-D Product feature CHAIN GQ183478_SHBs_P-D of FT:mat_peptide GQ183478_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4605). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183479_SHBs_P-D Product feature CHAIN GQ183479_SHBs_P-D of FT:mat_peptide GQ183479_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4607). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMRLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183480_SHBs_P-D Product feature CHAIN GQ183480_SHBs_P-D of FT:mat_peptide GQ183480_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4609). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGPSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183481_SHBs_P-D Product feature CHAIN GQ183481_SHBs_P-D of FT:mat_peptide GQ183481_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4569). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183482_SHBs_P-D Product feature CHAIN GQ183482_SHBs_P-D of FT:mat_peptide GQ183482_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4570). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183483_SHBs_P-D Product feature CHAIN GQ183483_SHBs_P-D of FT:mat_peptide GQ183483_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4566). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGASMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ183485_SHBs_P-D Product feature CHAIN GQ183485_SHBs_P-D of FT:mat_peptide GQ183485_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4599). Non-functional genomic sequence. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ184322_SHBs_P-D Product feature CHAIN GQ184322_SHBs_P-D of FT:mat_peptide GQ184322_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4522). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPVIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWPLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205380_SHBs_P-D Product feature CHAIN GQ205380_SHBs_P-D of FT:mat_peptide GQ205380_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1245). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205382_SHBs_P-D Product feature CHAIN GQ205382_SHBs_P-D of FT:mat_peptide GQ205382_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1360d). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205384_SHBs_P-D Product feature CHAIN GQ205384_SHBs_P-D of FT:mat_peptide GQ205384_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1434d). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|GQ205385_SHBs_P-D Product feature CHAIN GQ205385_SHBs_P-D of FT:mat_peptide GQ205385_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1469). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDENCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205388_SHBs_P-D Product feature CHAIN GQ205388_SHBs_P-D of FT:mat_peptide GQ205388_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1562). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ205389_SHBs_P-D Product feature CHAIN GQ205389_SHBs_P-D of FT:mat_peptide GQ205389_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1667). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDENCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ325778_SHBs_P-D Product feature CHAIN GQ325778_SHBs_P-D of FT:mat_peptide GQ325778_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVXWMMWYWGPSLYSTLKPFLPLLPIFXCLWVYI
>gnl|hbvpro|GQ353298_SHBs_P-D Product feature CHAIN GQ353298_SHBs_P-D of FT:mat_peptide GQ353298_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITLGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSHFTPLLLIFCCLWAYI
>gnl|hbvpro|GQ353299_SHBs_P-D Product feature CHAIN GQ353299_SHBs_P-D of FT:mat_peptide GQ353299_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ353300_SHBs_P-D Product feature CHAIN GQ353300_SHBs_P-D of FT:mat_peptide GQ353300_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ353301_SHBs_P-D Product feature CHAIN GQ353301_SHBs_P-D of FT:mat_peptide GQ353301_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ353303_SHBs_P-D Product feature CHAIN GQ353303_SHBs_P-D of FT:mat_peptide GQ353303_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ353304_SHBs_P-D Product feature CHAIN GQ353304_SHBs_P-D of FT:mat_peptide GQ353304_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ377589_SHBs_P-D Product feature CHAIN GQ377589_SHBs_P-D of FT:mat_peptide GQ377589_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate J145). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477452_SHBs_P-D Product feature CHAIN GQ477452_SHBs_P-D of FT:mat_peptide GQ477452_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGQSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477453_SHBs_P-D Product feature CHAIN GQ477453_SHBs_P-D of FT:mat_peptide GQ477453_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLRPFLQLLPIFFCLWVYI
>gnl|hbvpro|GQ477455_SHBs_P-D Product feature CHAIN GQ477455_SHBs_P-D of FT:mat_peptide GQ477455_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P73). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477456_SHBs_P-D Product feature CHAIN GQ477456_SHBs_P-D of FT:mat_peptide GQ477456_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P84). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477457_SHBs_P-D Product feature CHAIN GQ477457_SHBs_P-D of FT:mat_peptide GQ477457_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P118). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477458_SHBs_P-D Product feature CHAIN GQ477458_SHBs_P-D of FT:mat_peptide GQ477458_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P126). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKIIKIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCIKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ477459_SHBs_P-D Product feature CHAIN GQ477459_SHBs_P-D of FT:mat_peptide GQ477459_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P127). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486036_SHBs_P-D Product feature CHAIN GQ486036_SHBs_P-D of FT:mat_peptide GQ486036_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS1). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486037_SHBs_P-D Product feature CHAIN GQ486037_SHBs_P-D of FT:mat_peptide GQ486037_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFXLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSXGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486039_SHBs_P-D Product feature CHAIN GQ486039_SHBs_P-D of FT:mat_peptide GQ486039_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS4). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWXWGPNLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486040_SHBs_P-D Product feature CHAIN GQ486040_SHBs_P-D of FT:mat_peptide GQ486040_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486041_SHBs_P-D Product feature CHAIN GQ486041_SHBs_P-D of FT:mat_peptide GQ486041_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGXCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFXK
FLWXWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPXLPLLXIFFCLWVYI
>gnl|hbvpro|GQ486042_SHBs_P-D Product feature CHAIN GQ486042_SHBs_P-D of FT:mat_peptide GQ486042_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486043_SHBs_P-D Product feature CHAIN GQ486043_SHBs_P-D of FT:mat_peptide GQ486043_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCXTCTTXAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIXSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486044_SHBs_P-D Product feature CHAIN GQ486044_SHBs_P-D of FT:mat_peptide GQ486044_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486045_SHBs_P-D Product feature CHAIN GQ486045_SHBs_P-D of FT:mat_peptide GQ486045_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYSTLRPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486046_SHBs_P-D Product feature CHAIN GQ486046_SHBs_P-D of FT:mat_peptide GQ486046_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGXSXXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486047_SHBs_P-D Product feature CHAIN GQ486047_SHBs_P-D of FT:mat_peptide GQ486047_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGXXTVCLGQNSQSPTSNHSPTSCPPTCXGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486048_SHBs_P-D Product feature CHAIN GQ486048_SHBs_P-D of FT:mat_peptide GQ486048_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486049_SHBs_P-D Product feature CHAIN GQ486049_SHBs_P-D of FT:mat_peptide GQ486049_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQXMLPVCPLIPGSSTTSTGPCRTCTTPAQXTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486051_SHBs_P-D Product feature CHAIN GQ486051_SHBs_P-D of FT:mat_peptide GQ486051_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486052_SHBs_P-D Product feature CHAIN GQ486052_SHBs_P-D of FT:mat_peptide GQ486052_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486053_SHBs_P-D Product feature CHAIN GQ486053_SHBs_P-D of FT:mat_peptide GQ486053_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS18). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486054_SHBs_P-D Product feature CHAIN GQ486054_SHBs_P-D of FT:mat_peptide GQ486054_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFXCLWVYI
>gnl|hbvpro|GQ486055_SHBs_P-D Product feature CHAIN GQ486055_SHBs_P-D of FT:mat_peptide GQ486055_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYTTLXPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486056_SHBs_P-D Product feature CHAIN GQ486056_SHBs_P-D of FT:mat_peptide GQ486056_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS21). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQBSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWXMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486058_SHBs_P-D Product feature CHAIN GQ486058_SHBs_P-D of FT:mat_peptide GQ486058_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWYWGPSLYXXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486059_SHBs_P-D Product feature CHAIN GQ486059_SHBs_P-D of FT:mat_peptide GQ486059_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPXCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWXMWYWGPXLXRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486060_SHBs_P-D Product feature CHAIN GQ486060_SHBs_P-D of FT:mat_peptide GQ486060_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS25). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSAGPCRTCTTTAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486064_SHBs_P-D Product feature CHAIN GQ486064_SHBs_P-D of FT:mat_peptide GQ486064_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS29). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPTVWLLVXWMMWYWGPSLYNXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486065_SHBs_P-D Product feature CHAIN GQ486065_SHBs_P-D of FT:mat_peptide GQ486065_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQXPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486066_SHBs_P-D Product feature CHAIN GQ486066_SHBs_P-D of FT:mat_peptide GQ486066_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS31). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486067_SHBs_P-D Product feature CHAIN GQ486067_SHBs_P-D of FT:mat_peptide GQ486067_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS32). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLAIWMMWYWGRNLYXXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486068_SHBs_P-D Product feature CHAIN GQ486068_SHBs_P-D of FT:mat_peptide GQ486068_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS33). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486069_SHBs_P-D Product feature CHAIN GQ486069_SHBs_P-D of FT:mat_peptide GQ486069_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS34). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTXPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486070_SHBs_P-D Product feature CHAIN GQ486070_SHBs_P-D of FT:mat_peptide GQ486070_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS35). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSXLXPFIPLXPIFFCLWAYI
>gnl|hbvpro|GQ486071_SHBs_P-D Product feature CHAIN GQ486071_SHBs_P-D of FT:mat_peptide GQ486071_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS36). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486072_SHBs_P-D Product feature CHAIN GQ486072_SHBs_P-D of FT:mat_peptide GQ486072_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS37). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXXYSXLSPFLXLLPIFFCLWVYI
>gnl|hbvpro|GQ486073_SHBs_P-D Product feature CHAIN GQ486073_SHBs_P-D of FT:mat_peptide GQ486073_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS38). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLXFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486074_SHBs_P-D Product feature CHAIN GQ486074_SHBs_P-D of FT:mat_peptide GQ486074_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS39). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCXGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPRXXXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486075_SHBs_P-D Product feature CHAIN GQ486075_SHBs_P-D of FT:mat_peptide GQ486075_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS40). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486078_SHBs_P-D Product feature CHAIN GQ486078_SHBs_P-D of FT:mat_peptide GQ486078_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS43). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTYCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486080_SHBs_P-D Product feature CHAIN GQ486080_SHBs_P-D of FT:mat_peptide GQ486080_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS45). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPRLXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486085_SHBs_P-D Product feature CHAIN GQ486085_SHBs_P-D of FT:mat_peptide GQ486085_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS50). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFXWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGLSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486086_SHBs_P-D Product feature CHAIN GQ486086_SHBs_P-D of FT:mat_peptide GQ486086_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS51). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYXXLSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486087_SHBs_P-D Product feature CHAIN GQ486087_SHBs_P-D of FT:mat_peptide GQ486087_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS52). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIXLFILLLCLIFLLVLLDYXGMLPVCPLIPGSXTTSTGPCRTCTTPAQXTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARXSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486088_SHBs_P-D Product feature CHAIN GQ486088_SHBs_P-D of FT:mat_peptide GQ486088_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS53). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486094_SHBs_P-D Product feature CHAIN GQ486094_SHBs_P-D of FT:mat_peptide GQ486094_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS59). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486097_SHBs_P-D Product feature CHAIN GQ486097_SHBs_P-D of FT:mat_peptide GQ486097_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS62). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486098_SHBs_P-D Product feature CHAIN GQ486098_SHBs_P-D of FT:mat_peptide GQ486098_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS63). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENXTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486099_SHBs_P-D Product feature CHAIN GQ486099_SHBs_P-D of FT:mat_peptide GQ486099_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS64). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486100_SHBs_P-D Product feature CHAIN GQ486100_SHBs_P-D of FT:mat_peptide GQ486100_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS65). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRIXTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGXSMYPSCCCXKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPXLYSILSPFLPLLPIFXCLWXYI
>gnl|hbvpro|GQ486102_SHBs_P-D Product feature CHAIN GQ486102_SHBs_P-D of FT:mat_peptide GQ486102_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS67). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGSTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486105_SHBs_P-D Product feature CHAIN GQ486105_SHBs_P-D of FT:mat_peptide GQ486105_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS70). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQXPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486108_SHBs_P-D Product feature CHAIN GQ486108_SHBs_P-D of FT:mat_peptide GQ486108_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS73). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLXPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPXLYSXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486109_SHBs_P-D Product feature CHAIN GQ486109_SHBs_P-D of FT:mat_peptide GQ486109_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS74). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486110_SHBs_P-D Product feature CHAIN GQ486110_SHBs_P-D of FT:mat_peptide GQ486110_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS75). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486111_SHBs_P-D Product feature CHAIN GQ486111_SHBs_P-D of FT:mat_peptide GQ486111_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS76). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPMIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLSSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486112_SHBs_P-D Product feature CHAIN GQ486112_SHBs_P-D of FT:mat_peptide GQ486112_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS77). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPXXYSXLSPFLXLLPIFFCLWVYI
>gnl|hbvpro|GQ486113_SHBs_P-D Product feature CHAIN GQ486113_SHBs_P-D of FT:mat_peptide GQ486113_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS78). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSXYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486114_SHBs_P-D Product feature CHAIN GQ486114_SHBs_P-D of FT:mat_peptide GQ486114_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS79). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486115_SHBs_P-D Product feature CHAIN GQ486115_SHBs_P-D of FT:mat_peptide GQ486115_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS80). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486117_SHBs_P-D Product feature CHAIN GQ486117_SHBs_P-D of FT:mat_peptide GQ486117_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS82). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486118_SHBs_P-D Product feature CHAIN GQ486118_SHBs_P-D of FT:mat_peptide GQ486118_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS83). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGRNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTXSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLXVIWMMWYWGPSLYXXLSPFLPLXPIFFCLWXYI
>gnl|hbvpro|GQ486124_SHBs_P-D Product feature CHAIN GQ486124_SHBs_P-D of FT:mat_peptide GQ486124_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486125_SHBs_P-D Product feature CHAIN GQ486125_SHBs_P-D of FT:mat_peptide GQ486125_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS90). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQXTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWXWGPXLLNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486126_SHBs_P-D Product feature CHAIN GQ486126_SHBs_P-D of FT:mat_peptide GQ486126_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486127_SHBs_P-D Product feature CHAIN GQ486127_SHBs_P-D of FT:mat_peptide GQ486127_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS92). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MXNXTSXFLGPLLGLQAGFFLLTRILTILQSLDLWWTSLNFLGGTTVCLGQNSRSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486128_SHBs_P-D Product feature CHAIN GQ486128_SHBs_P-D of FT:mat_peptide GQ486128_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS93). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGNIVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486129_SHBs_P-D Product feature CHAIN GQ486129_SHBs_P-D of FT:mat_peptide GQ486129_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS94). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486132_SHBs_P-D Product feature CHAIN GQ486132_SHBs_P-D of FT:mat_peptide GQ486132_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS97). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPNLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486133_SHBs_P-D Product feature CHAIN GQ486133_SHBs_P-D of FT:mat_peptide GQ486133_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS98). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486134_SHBs_P-D Product feature CHAIN GQ486134_SHBs_P-D of FT:mat_peptide GQ486134_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS99). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486135_SHBs_P-D Product feature CHAIN GQ486135_SHBs_P-D of FT:mat_peptide GQ486135_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS100). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLXPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486136_SHBs_P-D Product feature CHAIN GQ486136_SHBs_P-D of FT:mat_peptide GQ486136_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS101). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSXTSKHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTTLRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486137_SHBs_P-D Product feature CHAIN GQ486137_SHBs_P-D of FT:mat_peptide GQ486137_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS102). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486138_SHBs_P-D Product feature CHAIN GQ486138_SHBs_P-D of FT:mat_peptide GQ486138_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS103). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPXVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486142_SHBs_P-D Product feature CHAIN GQ486142_SHBs_P-D of FT:mat_peptide GQ486142_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS107). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLXILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486144_SHBs_P-D Product feature CHAIN GQ486144_SHBs_P-D of FT:mat_peptide GQ486144_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS109). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSXXSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486145_SHBs_P-D Product feature CHAIN GQ486145_SHBs_P-D of FT:mat_peptide GQ486145_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS110). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLXPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486146_SHBs_P-D Product feature CHAIN GQ486146_SHBs_P-D of FT:mat_peptide GQ486146_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS111). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLAPFVQWFVGLSPTVWLSVIWMMWYWGRSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486147_SHBs_P-D Product feature CHAIN GQ486147_SHBs_P-D of FT:mat_peptide GQ486147_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS112). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCXTXAQGXSXYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLXXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486150_SHBs_P-D Product feature CHAIN GQ486150_SHBs_P-D of FT:mat_peptide GQ486150_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486152_SHBs_P-D Product feature CHAIN GQ486152_SHBs_P-D of FT:mat_peptide GQ486152_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS117). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMXPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWXXI
>gnl|hbvpro|GQ486154_SHBs_P-D Product feature CHAIN GQ486154_SHBs_P-D of FT:mat_peptide GQ486154_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGXSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486157_SHBs_P-D Product feature CHAIN GQ486157_SHBs_P-D of FT:mat_peptide GQ486157_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS122). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486158_SHBs_P-D Product feature CHAIN GQ486158_SHBs_P-D of FT:mat_peptide GQ486158_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS123). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486160_SHBs_P-D Product feature CHAIN GQ486160_SHBs_P-D of FT:mat_peptide GQ486160_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS125). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYRGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLAPFVQWFVGLSPIVWLSVIWMMWYWGPRLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486162_SHBs_P-D Product feature CHAIN GQ486162_SHBs_P-D of FT:mat_peptide GQ486162_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS127). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486163_SHBs_P-D Product feature CHAIN GQ486163_SHBs_P-D of FT:mat_peptide GQ486163_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS128). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEATVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486164_SHBs_P-D Product feature CHAIN GQ486164_SHBs_P-D of FT:mat_peptide GQ486164_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS129). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCXKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486166_SHBs_P-D Product feature CHAIN GQ486166_SHBs_P-D of FT:mat_peptide GQ486166_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS131). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGXSXXPSCCCTKPTDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRXLSPFLXLLPIFFCLWVYI
>gnl|hbvpro|GQ486167_SHBs_P-D Product feature CHAIN GQ486167_SHBs_P-D of FT:mat_peptide GQ486167_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS132). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSNTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPIVWLSVIWMMWYWGPSLYSXLXPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486168_SHBs_P-D Product feature CHAIN GQ486168_SHBs_P-D of FT:mat_peptide GQ486168_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS133). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSXGPCRTCTTXAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486169_SHBs_P-D Product feature CHAIN GQ486169_SHBs_P-D of FT:mat_peptide GQ486169_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS134). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILXLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARXSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486170_SHBs_P-D Product feature CHAIN GQ486170_SHBs_P-D of FT:mat_peptide GQ486170_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS135). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPQIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486171_SHBs_P-D Product feature CHAIN GQ486171_SHBs_P-D of FT:mat_peptide GQ486171_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS136). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXXTLRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486172_SHBs_P-D Product feature CHAIN GQ486172_SHBs_P-D of FT:mat_peptide GQ486172_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS137). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486173_SHBs_P-D Product feature CHAIN GQ486173_SHBs_P-D of FT:mat_peptide GQ486173_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS138). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLXFLGGTTVCLGQNSQSLTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTXAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGX
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486174_SHBs_P-D Product feature CHAIN GQ486174_SHBs_P-D of FT:mat_peptide GQ486174_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS139). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486175_SHBs_P-D Product feature CHAIN GQ486175_SHBs_P-D of FT:mat_peptide GQ486175_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS140). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQXXSXYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARXSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486176_SHBs_P-D Product feature CHAIN GQ486176_SHBs_P-D of FT:mat_peptide GQ486176_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS141). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486177_SHBs_P-D Product feature CHAIN GQ486177_SHBs_P-D of FT:mat_peptide GQ486177_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS142). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLCRXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486178_SHBs_P-D Product feature CHAIN GQ486178_SHBs_P-D of FT:mat_peptide GQ486178_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS143). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486179_SHBs_P-D Product feature CHAIN GQ486179_SHBs_P-D of FT:mat_peptide GQ486179_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS144). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486180_SHBs_P-D Product feature CHAIN GQ486180_SHBs_P-D of FT:mat_peptide GQ486180_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS145). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSXLSPFLPLLPIFYCLWVYI
>gnl|hbvpro|GQ486181_SHBs_P-D Product feature CHAIN GQ486181_SHBs_P-D of FT:mat_peptide GQ486181_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS146). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGXSXYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486183_SHBs_P-D Product feature CHAIN GQ486183_SHBs_P-D of FT:mat_peptide GQ486183_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS148). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSTLSPFLXLLPIFFCLWVYI
>gnl|hbvpro|GQ486184_SHBs_P-D Product feature CHAIN GQ486184_SHBs_P-D of FT:mat_peptide GQ486184_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS149). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSXXSXGPCRTCTTAAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWXSARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYXXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486185_SHBs_P-D Product feature CHAIN GQ486185_SHBs_P-D of FT:mat_peptide GQ486185_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS150). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWXWASARFSWLSLLXPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486186_SHBs_P-D Product feature CHAIN GQ486186_SHBs_P-D of FT:mat_peptide GQ486186_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS151). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486187_SHBs_P-D Product feature CHAIN GQ486187_SHBs_P-D of FT:mat_peptide GQ486187_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS152). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLXXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486191_SHBs_P-D Product feature CHAIN GQ486191_SHBs_P-D of FT:mat_peptide GQ486191_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS156). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCXTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486193_SHBs_P-D Product feature CHAIN GQ486193_SHBs_P-D of FT:mat_peptide GQ486193_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS158). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLXPLLXLQAGFFLLTXILTIPKSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPXIPGSSTTSAGPCRTCTTTAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXXTLSPFLPLLPIFFCLWVXI
>gnl|hbvpro|GQ486195_SHBs_P-D Product feature CHAIN GQ486195_SHBs_P-D of FT:mat_peptide GQ486195_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS160). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486199_SHBs_P-D Product feature CHAIN GQ486199_SHBs_P-D of FT:mat_peptide GQ486199_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS164). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFXLVLLDYQGMLPVCPLLPGSSNTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486200_SHBs_P-D Product feature CHAIN GQ486200_SHBs_P-D of FT:mat_peptide GQ486200_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS165). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486201_SHBs_P-D Product feature CHAIN GQ486201_SHBs_P-D of FT:mat_peptide GQ486201_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS166). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDXNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486202_SHBs_P-D Product feature CHAIN GQ486202_SHBs_P-D of FT:mat_peptide GQ486202_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS167). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486204_SHBs_P-D Product feature CHAIN GQ486204_SHBs_P-D of FT:mat_peptide GQ486204_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS169). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486206_SHBs_P-D Product feature CHAIN GQ486206_SHBs_P-D of FT:mat_peptide GQ486206_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS171). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRGQNSQSPTSNHSPTSCPPTCPGYRXMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPXSSTTSTGPCRTCTTTAQGXSXYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLXPFVQWFVGLSPTVWLSVIWMMWYWGPSLXRILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486207_SHBs_P-D Product feature CHAIN GQ486207_SHBs_P-D of FT:mat_peptide GQ486207_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS172). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLKPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486208_SHBs_P-D Product feature CHAIN GQ486208_SHBs_P-D of FT:mat_peptide GQ486208_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS173). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486210_SHBs_P-D Product feature CHAIN GQ486210_SHBs_P-D of FT:mat_peptide GQ486210_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS175). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSXLXPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486212_SHBs_P-D Product feature CHAIN GQ486212_SHBs_P-D of FT:mat_peptide GQ486212_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS177). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486214_SHBs_P-D Product feature CHAIN GQ486214_SHBs_P-D of FT:mat_peptide GQ486214_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS179). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSXTSTGPCRTCXTXAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPXLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486215_SHBs_P-D Product feature CHAIN GQ486215_SHBs_P-D of FT:mat_peptide GQ486215_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS180). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSTVPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486217_SHBs_P-D Product feature CHAIN GQ486217_SHBs_P-D of FT:mat_peptide GQ486217_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS182). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSXFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486218_SHBs_P-D Product feature CHAIN GQ486218_SHBs_P-D of FT:mat_peptide GQ486218_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS183). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAXGXSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486220_SHBs_P-D Product feature CHAIN GQ486220_SHBs_P-D of FT:mat_peptide GQ486220_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS185). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTXPAQGXSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486221_SHBs_P-D Product feature CHAIN GQ486221_SHBs_P-D of FT:mat_peptide GQ486221_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS186). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDXNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXSXLRPFLPLLPIFFCLWXYI
>gnl|hbvpro|GQ486224_SHBs_P-D Product feature CHAIN GQ486224_SHBs_P-D of FT:mat_peptide GQ486224_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS189). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPRSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486229_SHBs_P-D Product feature CHAIN GQ486229_SHBs_P-D of FT:mat_peptide GQ486229_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS194). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSXGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFXCLWVYI
>gnl|hbvpro|GQ486230_SHBs_P-D Product feature CHAIN GQ486230_SHBs_P-D of FT:mat_peptide GQ486230_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS195). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGXSXXPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486231_SHBs_P-D Product feature CHAIN GQ486231_SHBs_P-D of FT:mat_peptide GQ486231_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS196). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQFPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDXQGMLPVCPLIPGSSXTSTGPCRTCTTTAQGTSMYPYCCCTKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFXCLWVYI
>gnl|hbvpro|GQ486235_SHBs_P-D Product feature CHAIN GQ486235_SHBs_P-D of FT:mat_peptide GQ486235_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS200). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486237_SHBs_P-D Product feature CHAIN GQ486237_SHBs_P-D of FT:mat_peptide GQ486237_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS202). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTXNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486238_SHBs_P-D Product feature CHAIN GQ486238_SHBs_P-D of FT:mat_peptide GQ486238_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS203). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTXNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPXLXXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486239_SHBs_P-D Product feature CHAIN GQ486239_SHBs_P-D of FT:mat_peptide GQ486239_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS204). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQXTSXYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486243_SHBs_P-D Product feature CHAIN GQ486243_SHBs_P-D of FT:mat_peptide GQ486243_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS208). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486244_SHBs_P-D Product feature CHAIN GQ486244_SHBs_P-D of FT:mat_peptide GQ486244_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS209). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRXLSPFLPXXPIFFCLWVYI
>gnl|hbvpro|GQ486247_SHBs_P-D Product feature CHAIN GQ486247_SHBs_P-D of FT:mat_peptide GQ486247_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS212). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTTLSPFLPLLSTFFCLWVYI
>gnl|hbvpro|GQ486248_SHBs_P-D Product feature CHAIN GQ486248_SHBs_P-D of FT:mat_peptide GQ486248_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS213). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486250_SHBs_P-D Product feature CHAIN GQ486250_SHBs_P-D of FT:mat_peptide GQ486250_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS215). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486251_SHBs_P-D Product feature CHAIN GQ486251_SHBs_P-D of FT:mat_peptide GQ486251_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS216). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPTLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486252_SHBs_P-D Product feature CHAIN GQ486252_SHBs_P-D of FT:mat_peptide GQ486252_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS217). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPSLXSXLSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486254_SHBs_P-D Product feature CHAIN GQ486254_SHBs_P-D of FT:mat_peptide GQ486254_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS219). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486255_SHBs_P-D Product feature CHAIN GQ486255_SHBs_P-D of FT:mat_peptide GQ486255_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS220). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486256_SHBs_P-D Product feature CHAIN GQ486256_SHBs_P-D of FT:mat_peptide GQ486256_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS221). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAXFFLLTRILTIPQSLDSWWTSLNFLGGTTXCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYXGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPKLYXILSPFXPLLPIFXXLWVYI
>gnl|hbvpro|GQ486257_SHBs_P-D Product feature CHAIN GQ486257_SHBs_P-D of FT:mat_peptide GQ486257_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS222). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486259_SHBs_P-D Product feature CHAIN GQ486259_SHBs_P-D of FT:mat_peptide GQ486259_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS224). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486260_SHBs_P-D Product feature CHAIN GQ486260_SHBs_P-D of FT:mat_peptide GQ486260_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS225). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRXXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486261_SHBs_P-D Product feature CHAIN GQ486261_SHBs_P-D of FT:mat_peptide GQ486261_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS226). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPXIPGSSTTSTGPCRTCTTXAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486262_SHBs_P-D Product feature CHAIN GQ486262_SHBs_P-D of FT:mat_peptide GQ486262_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS227). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486263_SHBs_P-D Product feature CHAIN GQ486263_SHBs_P-D of FT:mat_peptide GQ486263_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS228). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGXSXTSTGPCRTCTTXAQGTSXYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGXSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486265_SHBs_P-D Product feature CHAIN GQ486265_SHBs_P-D of FT:mat_peptide GQ486265_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS230). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTGCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486266_SHBs_P-D Product feature CHAIN GQ486266_SHBs_P-D of FT:mat_peptide GQ486266_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS231). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLXVCPXIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPXLFRILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486267_SHBs_P-D Product feature CHAIN GQ486267_SHBs_P-D of FT:mat_peptide GQ486267_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS232). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486270_SHBs_P-D Product feature CHAIN GQ486270_SHBs_P-D of FT:mat_peptide GQ486270_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS235). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPSLYSXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486273_SHBs_P-D Product feature CHAIN GQ486273_SHBs_P-D of FT:mat_peptide GQ486273_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS238). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGXSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486274_SHBs_P-D Product feature CHAIN GQ486274_SHBs_P-D of FT:mat_peptide GQ486274_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS239). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486275_SHBs_P-D Product feature CHAIN GQ486275_SHBs_P-D of FT:mat_peptide GQ486275_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS240). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTAVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTXPAQGTSMYPSXCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPNLYXTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486276_SHBs_P-D Product feature CHAIN GQ486276_SHBs_P-D of FT:mat_peptide GQ486276_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS241). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLXPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486278_SHBs_P-D Product feature CHAIN GQ486278_SHBs_P-D of FT:mat_peptide GQ486278_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS243). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTXCLGQBSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486279_SHBs_P-D Product feature CHAIN GQ486279_SHBs_P-D of FT:mat_peptide GQ486279_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS244). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486280_SHBs_P-D Product feature CHAIN GQ486280_SHBs_P-D of FT:mat_peptide GQ486280_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS245). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTXXHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPXLLXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486281_SHBs_P-D Product feature CHAIN GQ486281_SHBs_P-D of FT:mat_peptide GQ486281_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS246). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
XENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTXIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSAIWMMWYWXPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486282_SHBs_P-D Product feature CHAIN GQ486282_SHBs_P-D of FT:mat_peptide GQ486282_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS247). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGXSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486283_SHBs_P-D Product feature CHAIN GQ486283_SHBs_P-D of FT:mat_peptide GQ486283_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS248). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCAGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486284_SHBs_P-D Product feature CHAIN GQ486284_SHBs_P-D of FT:mat_peptide GQ486284_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS249). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486285_SHBs_P-D Product feature CHAIN GQ486285_SHBs_P-D of FT:mat_peptide GQ486285_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS250). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFYLWVYI
>gnl|hbvpro|GQ486286_SHBs_P-D Product feature CHAIN GQ486286_SHBs_P-D of FT:mat_peptide GQ486286_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS251). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486289_SHBs_P-D Product feature CHAIN GQ486289_SHBs_P-D of FT:mat_peptide GQ486289_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS254). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSXGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486290_SHBs_P-D Product feature CHAIN GQ486290_SHBs_P-D of FT:mat_peptide GQ486290_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS255). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLXTXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486292_SHBs_P-D Product feature CHAIN GQ486292_SHBs_P-D of FT:mat_peptide GQ486292_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS257). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486293_SHBs_P-D Product feature CHAIN GQ486293_SHBs_P-D of FT:mat_peptide GQ486293_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS258). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRHFLPLLPXFXCLWVYI
>gnl|hbvpro|GQ486294_SHBs_P-D Product feature CHAIN GQ486294_SHBs_P-D of FT:mat_peptide GQ486294_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS259). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486296_SHBs_P-D Product feature CHAIN GQ486296_SHBs_P-D of FT:mat_peptide GQ486296_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS261). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486297_SHBs_P-D Product feature CHAIN GQ486297_SHBs_P-D of FT:mat_peptide GQ486297_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS262). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSXGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486298_SHBs_P-D Product feature CHAIN GQ486298_SHBs_P-D of FT:mat_peptide GQ486298_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS263). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFXLWVYI
>gnl|hbvpro|GQ486299_SHBs_P-D Product feature CHAIN GQ486299_SHBs_P-D of FT:mat_peptide GQ486299_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS264). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSXTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWXWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486301_SHBs_P-D Product feature CHAIN GQ486301_SHBs_P-D of FT:mat_peptide GQ486301_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS266). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPACCCTKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWFWXPSLXNILSPFLXLLPIFFCLWVXI
>gnl|hbvpro|GQ486302_SHBs_P-D Product feature CHAIN GQ486302_SHBs_P-D of FT:mat_peptide GQ486302_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS267). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486303_SHBs_P-D Product feature CHAIN GQ486303_SHBs_P-D of FT:mat_peptide GQ486303_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS268). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSNTSTGPCRTCTTTAQGTSXYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPXXYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486304_SHBs_P-D Product feature CHAIN GQ486304_SHBs_P-D of FT:mat_peptide GQ486304_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS269). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486308_SHBs_P-D Product feature CHAIN GQ486308_SHBs_P-D of FT:mat_peptide GQ486308_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS273). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFFWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPRLCSXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486310_SHBs_P-D Product feature CHAIN GQ486310_SHBs_P-D of FT:mat_peptide GQ486310_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS275). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQCPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486313_SHBs_P-D Product feature CHAIN GQ486313_SHBs_P-D of FT:mat_peptide GQ486313_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS278). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSXXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYXXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486316_SHBs_P-D Product feature CHAIN GQ486316_SHBs_P-D of FT:mat_peptide GQ486316_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS281). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486318_SHBs_P-D Product feature CHAIN GQ486318_SHBs_P-D of FT:mat_peptide GQ486318_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS283). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486321_SHBs_P-D Product feature CHAIN GQ486321_SHBs_P-D of FT:mat_peptide GQ486321_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS286). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGPTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLSRXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486322_SHBs_P-D Product feature CHAIN GQ486322_SHBs_P-D of FT:mat_peptide GQ486322_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS287). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGXRLXSILSPFLPLLPIFFCLWXYI
>gnl|hbvpro|GQ486323_SHBs_P-D Product feature CHAIN GQ486323_SHBs_P-D of FT:mat_peptide GQ486323_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS288). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFXK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLNSILSPFLPLLPIFFCLWXYIX
>gnl|hbvpro|GQ486324_SHBs_P-D Product feature CHAIN GQ486324_SHBs_P-D of FT:mat_peptide GQ486324_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS289). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRX
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486325_SHBs_P-D Product feature CHAIN GQ486325_SHBs_P-D of FT:mat_peptide GQ486325_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS290). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLXPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXXLSPFLPLLPIFFCLWVXI
>gnl|hbvpro|GQ486326_SHBs_P-D Product feature CHAIN GQ486326_SHBs_P-D of FT:mat_peptide GQ486326_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS291). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILRIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486328_SHBs_P-D Product feature CHAIN GQ486328_SHBs_P-D of FT:mat_peptide GQ486328_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS293). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486329_SHBs_P-D Product feature CHAIN GQ486329_SHBs_P-D of FT:mat_peptide GQ486329_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS294). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486330_SHBs_P-D Product feature CHAIN GQ486330_SHBs_P-D of FT:mat_peptide GQ486330_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS295). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWXXI
>gnl|hbvpro|GQ486331_SHBs_P-D Product feature CHAIN GQ486331_SHBs_P-D of FT:mat_peptide GQ486331_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS296). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486332_SHBs_P-D Product feature CHAIN GQ486332_SHBs_P-D of FT:mat_peptide GQ486332_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS297). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMXPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLXIFFCLWVYX
>gnl|hbvpro|GQ486336_SHBs_P-D Product feature CHAIN GQ486336_SHBs_P-D of FT:mat_peptide GQ486336_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS301). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSXGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486337_SHBs_P-D Product feature CHAIN GQ486337_SHBs_P-D of FT:mat_peptide GQ486337_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS302). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486339_SHBs_P-D Product feature CHAIN GQ486339_SHBs_P-D of FT:mat_peptide GQ486339_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS304). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMLYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486340_SHBs_P-D Product feature CHAIN GQ486340_SHBs_P-D of FT:mat_peptide GQ486340_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS305). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFXLGLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPXLYSILSPFIPLLPIFFCLWVYIX
>gnl|hbvpro|GQ486341_SHBs_P-D Product feature CHAIN GQ486341_SHBs_P-D of FT:mat_peptide GQ486341_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS306). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFFLLTRILXIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGISMYPSCCCTKPSXGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLLVIWMTWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486342_SHBs_P-D Product feature CHAIN GQ486342_SHBs_P-D of FT:mat_peptide GQ486342_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS307). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486343_SHBs_P-D Product feature CHAIN GQ486343_SHBs_P-D of FT:mat_peptide GQ486343_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS308). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQDSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWXPXLXTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486344_SHBs_P-D Product feature CHAIN GQ486344_SHBs_P-D of FT:mat_peptide GQ486344_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS309). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486345_SHBs_P-D Product feature CHAIN GQ486345_SHBs_P-D of FT:mat_peptide GQ486345_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS310). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPXTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486346_SHBs_P-D Product feature CHAIN GQ486346_SHBs_P-D of FT:mat_peptide GQ486346_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS311). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILXLCLXFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXXXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486347_SHBs_P-D Product feature CHAIN GQ486347_SHBs_P-D of FT:mat_peptide GQ486347_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS312). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPSLYXILSPFLXLLPIFFCLWVYI
>gnl|hbvpro|GQ486352_SHBs_P-D Product feature CHAIN GQ486352_SHBs_P-D of FT:mat_peptide GQ486352_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS317). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486354_SHBs_P-D Product feature CHAIN GQ486354_SHBs_P-D of FT:mat_peptide GQ486354_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS319). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPSLYXXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486355_SHBs_P-D Product feature CHAIN GQ486355_SHBs_P-D of FT:mat_peptide GQ486355_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS320). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486356_SHBs_P-D Product feature CHAIN GQ486356_SHBs_P-D of FT:mat_peptide GQ486356_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS321). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMXYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486357_SHBs_P-D Product feature CHAIN GQ486357_SHBs_P-D of FT:mat_peptide GQ486357_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS322). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSXGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486358_SHBs_P-D Product feature CHAIN GQ486358_SHBs_P-D of FT:mat_peptide GQ486358_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS323). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTACLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486361_SHBs_P-D Product feature CHAIN GQ486361_SHBs_P-D of FT:mat_peptide GQ486361_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS326). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPVIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXXXLSPFLPLLPIFFCLWXYI
>gnl|hbvpro|GQ486362_SHBs_P-D Product feature CHAIN GQ486362_SHBs_P-D of FT:mat_peptide GQ486362_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS327). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSXTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486363_SHBs_P-D Product feature CHAIN GQ486363_SHBs_P-D of FT:mat_peptide GQ486363_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS328). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARXSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486365_SHBs_P-D Product feature CHAIN GQ486365_SHBs_P-D of FT:mat_peptide GQ486365_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS330). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486367_SHBs_P-D Product feature CHAIN GQ486367_SHBs_P-D of FT:mat_peptide GQ486367_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS332). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486370_SHBs_P-D Product feature CHAIN GQ486370_SHBs_P-D of FT:mat_peptide GQ486370_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS335). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486374_SHBs_P-D Product feature CHAIN GQ486374_SHBs_P-D of FT:mat_peptide GQ486374_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS339). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTXQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWXWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486376_SHBs_P-D Product feature CHAIN GQ486376_SHBs_P-D of FT:mat_peptide GQ486376_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS341). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSXGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486378_SHBs_P-D Product feature CHAIN GQ486378_SHBs_P-D of FT:mat_peptide GQ486378_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS343). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLXFLGGXXVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWXPXLXXXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486379_SHBs_P-D Product feature CHAIN GQ486379_SHBs_P-D of FT:mat_peptide GQ486379_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS344). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAXFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486380_SHBs_P-D Product feature CHAIN GQ486380_SHBs_P-D of FT:mat_peptide GQ486380_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS345). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGXSPTVWLXVIWMMWYWGPSLFSXLSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486381_SHBs_P-D Product feature CHAIN GQ486381_SHBs_P-D of FT:mat_peptide GQ486381_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS346). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486382_SHBs_P-D Product feature CHAIN GQ486382_SHBs_P-D of FT:mat_peptide GQ486382_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS347). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486383_SHBs_P-D Product feature CHAIN GQ486383_SHBs_P-D of FT:mat_peptide GQ486383_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS348). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQCPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPRLLSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486384_SHBs_P-D Product feature CHAIN GQ486384_SHBs_P-D of FT:mat_peptide GQ486384_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS349). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDXNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXXXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486386_SHBs_P-D Product feature CHAIN GQ486386_SHBs_P-D of FT:mat_peptide GQ486386_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS351). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYSTLXPFXPLXPIFFCLWVYI
>gnl|hbvpro|GQ486392_SHBs_P-D Product feature CHAIN GQ486392_SHBs_P-D of FT:mat_peptide GQ486392_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS357). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGXTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGXSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWXSARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486398_SHBs_P-D Product feature CHAIN GQ486398_SHBs_P-D of FT:mat_peptide GQ486398_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS363). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGXSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVQFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486404_SHBs_P-D Product feature CHAIN GQ486404_SHBs_P-D of FT:mat_peptide GQ486404_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS369). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486405_SHBs_P-D Product feature CHAIN GQ486405_SHBs_P-D of FT:mat_peptide GQ486405_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS370). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486406_SHBs_P-D Product feature CHAIN GQ486406_SHBs_P-D of FT:mat_peptide GQ486406_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS371). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRXF
XIXLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486407_SHBs_P-D Product feature CHAIN GQ486407_SHBs_P-D of FT:mat_peptide GQ486407_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS372). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486412_SHBs_P-D Product feature CHAIN GQ486412_SHBs_P-D of FT:mat_peptide GQ486412_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS377). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486414_SHBs_P-D Product feature CHAIN GQ486414_SHBs_P-D of FT:mat_peptide GQ486414_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS379). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXXPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486418_SHBs_P-D Product feature CHAIN GQ486418_SHBs_P-D of FT:mat_peptide GQ486418_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS383). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486420_SHBs_P-D Product feature CHAIN GQ486420_SHBs_P-D of FT:mat_peptide GQ486420_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS385). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPRVYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486422_SHBs_P-D Product feature CHAIN GQ486422_SHBs_P-D of FT:mat_peptide GQ486422_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS387). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486428_SHBs_P-D Product feature CHAIN GQ486428_SHBs_P-D of FT:mat_peptide GQ486428_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS393). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPXTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGTCRTCTTTAQGTFMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSXILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486429_SHBs_P-D Product feature CHAIN GQ486429_SHBs_P-D of FT:mat_peptide GQ486429_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS394). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGXSMIPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWXSARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILXPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486431_SHBs_P-D Product feature CHAIN GQ486431_SHBs_P-D of FT:mat_peptide GQ486431_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS396). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486433_SHBs_P-D Product feature CHAIN GQ486433_SHBs_P-D of FT:mat_peptide GQ486433_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS398). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486434_SHBs_P-D Product feature CHAIN GQ486434_SHBs_P-D of FT:mat_peptide GQ486434_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS399). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486446_SHBs_P-D Product feature CHAIN GQ486446_SHBs_P-D of FT:mat_peptide GQ486446_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS411). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTXPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486453_SHBs_P-D Product feature CHAIN GQ486453_SHBs_P-D of FT:mat_peptide GQ486453_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS418). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILXLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCXKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486458_SHBs_P-D Product feature CHAIN GQ486458_SHBs_P-D of FT:mat_peptide GQ486458_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS423). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486465_SHBs_P-D Product feature CHAIN GQ486465_SHBs_P-D of FT:mat_peptide GQ486465_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS430). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSEGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSXFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486467_SHBs_P-D Product feature CHAIN GQ486467_SHBs_P-D of FT:mat_peptide GQ486467_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS432). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQXTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486471_SHBs_P-D Product feature CHAIN GQ486471_SHBs_P-D of FT:mat_peptide GQ486471_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS436). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFIXLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCXKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486472_SHBs_P-D Product feature CHAIN GQ486472_SHBs_P-D of FT:mat_peptide GQ486472_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS437). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWLVGLSPTVWLSVIWMMWYWGXSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486473_SHBs_P-D Product feature CHAIN GQ486473_SHBs_P-D of FT:mat_peptide GQ486473_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS438). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSXGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486475_SHBs_P-D Product feature CHAIN GQ486475_SHBs_P-D of FT:mat_peptide GQ486475_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS440). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486476_SHBs_P-D Product feature CHAIN GQ486476_SHBs_P-D of FT:mat_peptide GQ486476_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS441). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGXRLXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486477_SHBs_P-D Product feature CHAIN GQ486477_SHBs_P-D of FT:mat_peptide GQ486477_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS442). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486481_SHBs_P-D Product feature CHAIN GQ486481_SHBs_P-D of FT:mat_peptide GQ486481_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS446). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNTQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSXLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486483_SHBs_P-D Product feature CHAIN GQ486483_SHBs_P-D of FT:mat_peptide GQ486483_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS448). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486484_SHBs_P-D Product feature CHAIN GQ486484_SHBs_P-D of FT:mat_peptide GQ486484_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS449). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486485_SHBs_P-D Product feature CHAIN GQ486485_SHBs_P-D of FT:mat_peptide GQ486485_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS450). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486486_SHBs_P-D Product feature CHAIN GQ486486_SHBs_P-D of FT:mat_peptide GQ486486_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS451). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486487_SHBs_P-D Product feature CHAIN GQ486487_SHBs_P-D of FT:mat_peptide GQ486487_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS452). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPRLYSILSPFLXLLPIFFCLWVYI
>gnl|hbvpro|GQ486488_SHBs_P-D Product feature CHAIN GQ486488_SHBs_P-D of FT:mat_peptide GQ486488_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS453). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486489_SHBs_P-D Product feature CHAIN GQ486489_SHBs_P-D of FT:mat_peptide GQ486489_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS454). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGXCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486492_SHBs_P-D Product feature CHAIN GQ486492_SHBs_P-D of FT:mat_peptide GQ486492_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS457). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486496_SHBs_P-D Product feature CHAIN GQ486496_SHBs_P-D of FT:mat_peptide GQ486496_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS461). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCXKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486499_SHBs_P-D Product feature CHAIN GQ486499_SHBs_P-D of FT:mat_peptide GQ486499_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS464). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486502_SHBs_P-D Product feature CHAIN GQ486502_SHBs_P-D of FT:mat_peptide GQ486502_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS467). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLXSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486503_SHBs_P-D Product feature CHAIN GQ486503_SHBs_P-D of FT:mat_peptide GQ486503_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS468). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486504_SHBs_P-D Product feature CHAIN GQ486504_SHBs_P-D of FT:mat_peptide GQ486504_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS469). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486505_SHBs_P-D Product feature CHAIN GQ486505_SHBs_P-D of FT:mat_peptide GQ486505_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS470). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486506_SHBs_P-D Product feature CHAIN GQ486506_SHBs_P-D of FT:mat_peptide GQ486506_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS471). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXXYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486507_SHBs_P-D Product feature CHAIN GQ486507_SHBs_P-D of FT:mat_peptide GQ486507_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS472). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPYCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486513_SHBs_P-D Product feature CHAIN GQ486513_SHBs_P-D of FT:mat_peptide GQ486513_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS478). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486517_SHBs_P-D Product feature CHAIN GQ486517_SHBs_P-D of FT:mat_peptide GQ486517_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS482). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLXAGFFXLTRILTIPXSLDSWWTSLXFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPXIPGSSXTSTGPCRTCTTPAQXTSMNPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486520_SHBs_P-D Product feature CHAIN GQ486520_SHBs_P-D of FT:mat_peptide GQ486520_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS485). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486521_SHBs_P-D Product feature CHAIN GQ486521_SHBs_P-D of FT:mat_peptide GQ486521_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS486). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486525_SHBs_P-D Product feature CHAIN GQ486525_SHBs_P-D of FT:mat_peptide GQ486525_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS490). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMXLXXF
IIFLFILLLCLIFLLVLLDYQGMLXVCPLIPGSSTTSAGPCRTCTTTAXGTSMYPSCCCTKPSXGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHGILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486527_SHBs_P-D Product feature CHAIN GQ486527_SHBs_P-D of FT:mat_peptide GQ486527_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS492). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486528_SHBs_P-D Product feature CHAIN GQ486528_SHBs_P-D of FT:mat_peptide GQ486528_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS493). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486530_SHBs_P-D Product feature CHAIN GQ486530_SHBs_P-D of FT:mat_peptide GQ486530_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS495). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGASXTSAGPCRTCTTTAXGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVXI
>gnl|hbvpro|GQ486539_SHBs_P-D Product feature CHAIN GQ486539_SHBs_P-D of FT:mat_peptide GQ486539_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS504). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFIPLLPIFFCLWVFI
>gnl|hbvpro|GQ486541_SHBs_P-D Product feature CHAIN GQ486541_SHBs_P-D of FT:mat_peptide GQ486541_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS506). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486545_SHBs_P-D Product feature CHAIN GQ486545_SHBs_P-D of FT:mat_peptide GQ486545_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS510). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486546_SHBs_P-D Product feature CHAIN GQ486546_SHBs_P-D of FT:mat_peptide GQ486546_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS511). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486547_SHBs_P-D Product feature CHAIN GQ486547_SHBs_P-D of FT:mat_peptide GQ486547_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS512). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486552_SHBs_P-D Product feature CHAIN GQ486552_SHBs_P-D of FT:mat_peptide GQ486552_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS517). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486554_SHBs_P-D Product feature CHAIN GQ486554_SHBs_P-D of FT:mat_peptide GQ486554_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS519). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMTWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486555_SHBs_P-D Product feature CHAIN GQ486555_SHBs_P-D of FT:mat_peptide GQ486555_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS520). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486561_SHBs_P-D Product feature CHAIN GQ486561_SHBs_P-D of FT:mat_peptide GQ486561_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS526). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486565_SHBs_P-D Product feature CHAIN GQ486565_SHBs_P-D of FT:mat_peptide GQ486565_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS530). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486566_SHBs_P-D Product feature CHAIN GQ486566_SHBs_P-D of FT:mat_peptide GQ486566_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS531). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486572_SHBs_P-D Product feature CHAIN GQ486572_SHBs_P-D of FT:mat_peptide GQ486572_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS537). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486577_SHBs_P-D Product feature CHAIN GQ486577_SHBs_P-D of FT:mat_peptide GQ486577_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS542). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486585_SHBs_P-D Product feature CHAIN GQ486585_SHBs_P-D of FT:mat_peptide GQ486585_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS550). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486586_SHBs_P-D Product feature CHAIN GQ486586_SHBs_P-D of FT:mat_peptide GQ486586_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS551). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLXPIFFCLWVYI
>gnl|hbvpro|GQ486589_SHBs_P-D Product feature CHAIN GQ486589_SHBs_P-D of FT:mat_peptide GQ486589_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS554). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPXIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFXPLXPIFFCLWVYI
>gnl|hbvpro|GQ486593_SHBs_P-D Product feature CHAIN GQ486593_SHBs_P-D of FT:mat_peptide GQ486593_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS558). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486594_SHBs_P-D Product feature CHAIN GQ486594_SHBs_P-D of FT:mat_peptide GQ486594_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS559). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPGLYSXLSPFLPLLPIFFCLWAYI
>gnl|hbvpro|GQ486596_SHBs_P-D Product feature CHAIN GQ486596_SHBs_P-D of FT:mat_peptide GQ486596_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS561). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486602_SHBs_P-D Product feature CHAIN GQ486602_SHBs_P-D of FT:mat_peptide GQ486602_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS567). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSXFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486604_SHBs_P-D Product feature CHAIN GQ486604_SHBs_P-D of FT:mat_peptide GQ486604_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS569). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486605_SHBs_P-D Product feature CHAIN GQ486605_SHBs_P-D of FT:mat_peptide GQ486605_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS570). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486614_SHBs_P-D Product feature CHAIN GQ486614_SHBs_P-D of FT:mat_peptide GQ486614_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS579). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486627_SHBs_P-D Product feature CHAIN GQ486627_SHBs_P-D of FT:mat_peptide GQ486627_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS592). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSXIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486634_SHBs_P-D Product feature CHAIN GQ486634_SHBs_P-D of FT:mat_peptide GQ486634_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS599). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGXCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPSLYSILXPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486635_SHBs_P-D Product feature CHAIN GQ486635_SHBs_P-D of FT:mat_peptide GQ486635_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS600). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486637_SHBs_P-D Product feature CHAIN GQ486637_SHBs_P-D of FT:mat_peptide GQ486637_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS602). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGPSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486638_SHBs_P-D Product feature CHAIN GQ486638_SHBs_P-D of FT:mat_peptide GQ486638_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS603). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGPSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486639_SHBs_P-D Product feature CHAIN GQ486639_SHBs_P-D of FT:mat_peptide GQ486639_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS604). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486655_SHBs_P-D Product feature CHAIN GQ486655_SHBs_P-D of FT:mat_peptide GQ486655_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS620). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQSSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486659_SHBs_P-D Product feature CHAIN GQ486659_SHBs_P-D of FT:mat_peptide GQ486659_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS624). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486662_SHBs_P-D Product feature CHAIN GQ486662_SHBs_P-D of FT:mat_peptide GQ486662_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS627). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDXNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486670_SHBs_P-D Product feature CHAIN GQ486670_SHBs_P-D of FT:mat_peptide GQ486670_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS635). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486671_SHBs_P-D Product feature CHAIN GQ486671_SHBs_P-D of FT:mat_peptide GQ486671_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS636). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486672_SHBs_P-D Product feature CHAIN GQ486672_SHBs_P-D of FT:mat_peptide GQ486672_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS637). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVXPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486673_SHBs_P-D Product feature CHAIN GQ486673_SHBs_P-D of FT:mat_peptide GQ486673_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS638). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486674_SHBs_P-D Product feature CHAIN GQ486674_SHBs_P-D of FT:mat_peptide GQ486674_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS639). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
METITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486675_SHBs_P-D Product feature CHAIN GQ486675_SHBs_P-D of FT:mat_peptide GQ486675_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS640). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTXILTIPXSLDSWWTSLNFLGGTTACLGQNSQSPTXNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486678_SHBs_P-D Product feature CHAIN GQ486678_SHBs_P-D of FT:mat_peptide GQ486678_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS643). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486680_SHBs_P-D Product feature CHAIN GQ486680_SHBs_P-D of FT:mat_peptide GQ486680_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS645). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486681_SHBs_P-D Product feature CHAIN GQ486681_SHBs_P-D of FT:mat_peptide GQ486681_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS646). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGXCRTCTTTAXGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486698_SHBs_P-D Product feature CHAIN GQ486698_SHBs_P-D of FT:mat_peptide GQ486698_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS663). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSXTTSTGXCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWFSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPXLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486699_SHBs_P-D Product feature CHAIN GQ486699_SHBs_P-D of FT:mat_peptide GQ486699_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS664). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486700_SHBs_P-D Product feature CHAIN GQ486700_SHBs_P-D of FT:mat_peptide GQ486700_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS665). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IXFLFILLLCLXFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGXSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486704_SHBs_P-D Product feature CHAIN GQ486704_SHBs_P-D of FT:mat_peptide GQ486704_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS669). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486705_SHBs_P-D Product feature CHAIN GQ486705_SHBs_P-D of FT:mat_peptide GQ486705_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS670). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGXTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486706_SHBs_P-D Product feature CHAIN GQ486706_SHBs_P-D of FT:mat_peptide GQ486706_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS671). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWXSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486708_SHBs_P-D Product feature CHAIN GQ486708_SHBs_P-D of FT:mat_peptide GQ486708_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS673). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486709_SHBs_P-D Product feature CHAIN GQ486709_SHBs_P-D of FT:mat_peptide GQ486709_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS674). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVXLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486711_SHBs_P-D Product feature CHAIN GQ486711_SHBs_P-D of FT:mat_peptide GQ486711_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS676). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPRIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSLLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486715_SHBs_P-D Product feature CHAIN GQ486715_SHBs_P-D of FT:mat_peptide GQ486715_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS680). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486716_SHBs_P-D Product feature CHAIN GQ486716_SHBs_P-D of FT:mat_peptide GQ486716_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS681). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWFSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486717_SHBs_P-D Product feature CHAIN GQ486717_SHBs_P-D of FT:mat_peptide GQ486717_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS682). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486719_SHBs_P-D Product feature CHAIN GQ486719_SHBs_P-D of FT:mat_peptide GQ486719_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS684). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGETTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSTLSPFLLLLPIFFCLWVYI
>gnl|hbvpro|GQ486722_SHBs_P-D Product feature CHAIN GQ486722_SHBs_P-D of FT:mat_peptide GQ486722_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS687). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486729_SHBs_P-D Product feature CHAIN GQ486729_SHBs_P-D of FT:mat_peptide GQ486729_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS694). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486730_SHBs_P-D Product feature CHAIN GQ486730_SHBs_P-D of FT:mat_peptide GQ486730_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS695). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPXDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486731_SHBs_P-D Product feature CHAIN GQ486731_SHBs_P-D of FT:mat_peptide GQ486731_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS696). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLGQNSXSPTSNHSPTSCPPTCPGYRWMCLRXF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSXLSLLVPFVQWFXGLSXTVWLSVIWMMWYWGPSLYXILSXFIPLXPIFFCLWVYI
>gnl|hbvpro|GQ486735_SHBs_P-D Product feature CHAIN GQ486735_SHBs_P-D of FT:mat_peptide GQ486735_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS700). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486738_SHBs_P-D Product feature CHAIN GQ486738_SHBs_P-D of FT:mat_peptide GQ486738_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS703). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSXXSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486745_SHBs_P-D Product feature CHAIN GQ486745_SHBs_P-D of FT:mat_peptide GQ486745_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS710). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486746_SHBs_P-D Product feature CHAIN GQ486746_SHBs_P-D of FT:mat_peptide GQ486746_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS711). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTXVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTXSTGPCRTCTTXAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQXFVGLSPTVWLSVIWMMWYWGPSLYSILSPFXPLLPIFFXLWXYI
>gnl|hbvpro|GQ486748_SHBs_P-D Product feature CHAIN GQ486748_SHBs_P-D of FT:mat_peptide GQ486748_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS713). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLXVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLXXLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486755_SHBs_P-D Product feature CHAIN GQ486755_SHBs_P-D of FT:mat_peptide GQ486755_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS720). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTAAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486759_SHBs_P-D Product feature CHAIN GQ486759_SHBs_P-D of FT:mat_peptide GQ486759_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS724). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTIWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486767_SHBs_P-D Product feature CHAIN GQ486767_SHBs_P-D of FT:mat_peptide GQ486767_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS732). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486768_SHBs_P-D Product feature CHAIN GQ486768_SHBs_P-D of FT:mat_peptide GQ486768_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS733). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLGQNSQSPTSNHSPTSCPPTXPGYRWMXLRRF
IIFLFILLLCLIXLLVLLDYQGMXPVXPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILXPFXPLLPIFFCLWVYI
>gnl|hbvpro|GQ486769_SHBs_P-D Product feature CHAIN GQ486769_SHBs_P-D of FT:mat_peptide GQ486769_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS734). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLXPLLVLQAGFXLLTRILTIPQSLDSWWTSLXFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGXSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486771_SHBs_P-D Product feature CHAIN GQ486771_SHBs_P-D of FT:mat_peptide GQ486771_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS736). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486773_SHBs_P-D Product feature CHAIN GQ486773_SHBs_P-D of FT:mat_peptide GQ486773_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS738). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRLNSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486774_SHBs_P-D Product feature CHAIN GQ486774_SHBs_P-D of FT:mat_peptide GQ486774_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS739). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMXPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486781_SHBs_P-D Product feature CHAIN GQ486781_SHBs_P-D of FT:mat_peptide GQ486781_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS746). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCTTLSPFLPLLPIFXCLWVXI
>gnl|hbvpro|GQ486785_SHBs_P-D Product feature CHAIN GQ486785_SHBs_P-D of FT:mat_peptide GQ486785_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS750). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSSGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYXILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486798_SHBs_P-D Product feature CHAIN GQ486798_SHBs_P-D of FT:mat_peptide GQ486798_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS763). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGLLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGNSTYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYSILSPFLPLLXIFFCLWVYI
>gnl|hbvpro|GQ486806_SHBs_P-D Product feature CHAIN GQ486806_SHBs_P-D of FT:mat_peptide GQ486806_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS771). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLXPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486808_SHBs_P-D Product feature CHAIN GQ486808_SHBs_P-D of FT:mat_peptide GQ486808_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS773). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTILQSLDSWLTSLNFLGGTPVCLGQNSQSPTSSHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWTMWYWGPNLYSILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|GQ486815_SHBs_P-D Product feature CHAIN GQ486815_SHBs_P-D of FT:mat_peptide GQ486815_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS780). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPXTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYXGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPSLYXXLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486818_SHBs_P-D Product feature CHAIN GQ486818_SHBs_P-D of FT:mat_peptide GQ486818_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS783). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEATVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486820_SHBs_P-D Product feature CHAIN GQ486820_SHBs_P-D of FT:mat_peptide GQ486820_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS785). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLXPGXSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASXRFSWLSXLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLXSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486822_SHBs_P-D Product feature CHAIN GQ486822_SHBs_P-D of FT:mat_peptide GQ486822_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS787). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSPTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|GQ486826_SHBs_P-D Product feature CHAIN GQ486826_SHBs_P-D of FT:mat_peptide GQ486826_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS791). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486827_SHBs_P-D Product feature CHAIN GQ486827_SHBs_P-D of FT:mat_peptide GQ486827_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS792). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486842_SHBs_P-D Product feature CHAIN GQ486842_SHBs_P-D of FT:mat_peptide GQ486842_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS807). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLXXLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSLYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPXVWLSVIWMMWFWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486844_SHBs_P-D Product feature CHAIN GQ486844_SHBs_P-D of FT:mat_peptide GQ486844_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS809). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILXPFIPLLPIFFCLWVYI
>gnl|hbvpro|GQ486845_SHBs_P-D Product feature CHAIN GQ486845_SHBs_P-D of FT:mat_peptide GQ486845_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS810). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTXPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486846_SHBs_P-D Product feature CHAIN GQ486846_SHBs_P-D of FT:mat_peptide GQ486846_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS811). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=224 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFL
WEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486848_SHBs_P-D Product feature CHAIN GQ486848_SHBs_P-D of FT:mat_peptide GQ486848_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS813). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSXLSLLVPFVQWFVGLSPXVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486849_SHBs_P-D Product feature CHAIN GQ486849_SHBs_P-D of FT:mat_peptide GQ486849_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS814). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSSLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486851_SHBs_P-D Product feature CHAIN GQ486851_SHBs_P-D of FT:mat_peptide GQ486851_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS816). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGXLXPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPSLYXILSPFLPLLPIFFCLWAXI
>gnl|hbvpro|GQ486858_SHBs_P-D Product feature CHAIN GQ486858_SHBs_P-D of FT:mat_peptide GQ486858_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS823). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486866_SHBs_P-D Product feature CHAIN GQ486866_SHBs_P-D of FT:mat_peptide GQ486866_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS831). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ486867_SHBs_P-D Product feature CHAIN GQ486867_SHBs_P-D of FT:mat_peptide GQ486867_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GS832). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTSSTGPCRTCTTTAQATSTYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWFSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ491108_SHBs_P-D Product feature CHAIN GQ491108_SHBs_P-D of FT:mat_peptide GQ491108_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8800568). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMFLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ491110_SHBs_P-D Product feature CHAIN GQ491110_SHBs_P-D of FT:mat_peptide GQ491110_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8802745). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTXTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVFI
>gnl|hbvpro|GQ922000_SHBs_P-D Product feature CHAIN GQ922000_SHBs_P-D of FT:mat_peptide GQ922000_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3552). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922001_SHBs_P-D Product feature CHAIN GQ922001_SHBs_P-D of FT:mat_peptide GQ922001_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3654). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922002_SHBs_P-D Product feature CHAIN GQ922002_SHBs_P-D of FT:mat_peptide GQ922002_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3624). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922003_SHBs_P-D Product feature CHAIN GQ922003_SHBs_P-D of FT:mat_peptide GQ922003_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3225). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922004_SHBs_P-D Product feature CHAIN GQ922004_SHBs_P-D of FT:mat_peptide GQ922004_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3284). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLXLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ922005_SHBs_P-D Product feature CHAIN GQ922005_SHBs_P-D of FT:mat_peptide GQ922005_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B2894). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSHFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ924652_SHBs_P-D Product feature CHAIN GQ924652_SHBs_P-D of FT:mat_peptide GQ924652_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M89). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GQ995474_SHBs_P-D Product feature CHAIN GQ995474_SHBs_P-D of FT:mat_peptide GQ995474_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5728). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU079196_SHBs_P-D Product feature CHAIN GU079196_SHBs_P-D of FT:mat_peptide GU079196_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1174). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU357846_SHBs_P-D Product feature CHAIN GU357846_SHBs_P-D of FT:mat_peptide GU357846_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y10). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFVLLLCLIFLLVLLDYQGILPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSVIWMMWYWEPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456635_SHBs_P-D Product feature CHAIN GU456635_SHBs_P-D of FT:mat_peptide GU456635_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T26). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456636_SHBs_P-D Product feature CHAIN GU456636_SHBs_P-D of FT:mat_peptide GU456636_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T7). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456637_SHBs_P-D Product feature CHAIN GU456637_SHBs_P-D of FT:mat_peptide GU456637_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T49). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456638_SHBs_P-D Product feature CHAIN GU456638_SHBs_P-D of FT:mat_peptide GU456638_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T35). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456639_SHBs_P-D Product feature CHAIN GU456639_SHBs_P-D of FT:mat_peptide GU456639_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T129). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQCPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMIWYWGPNLNCILSPFLPLLPIFCCLWVYI
>gnl|hbvpro|GU456640_SHBs_P-D Product feature CHAIN GU456640_SHBs_P-D of FT:mat_peptide GU456640_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456641_SHBs_P-D Product feature CHAIN GU456641_SHBs_P-D of FT:mat_peptide GU456641_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T53). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSSPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456642_SHBs_P-D Product feature CHAIN GU456642_SHBs_P-D of FT:mat_peptide GU456642_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T70). Partial genome (Contains: HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFRGGTTVCLGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRF
IIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456643_SHBs_P-D Product feature CHAIN GU456643_SHBs_P-D of FT:mat_peptide GU456643_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T52). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFAGLSPIVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456645_SHBs_P-D Product feature CHAIN GU456645_SHBs_P-D of FT:mat_peptide GU456645_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T80). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWTMWCWGPNLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456646_SHBs_P-D Product feature CHAIN GU456646_SHBs_P-D of FT:mat_peptide GU456646_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T77). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456647_SHBs_P-D Product feature CHAIN GU456647_SHBs_P-D of FT:mat_peptide GU456647_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T130). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456648_SHBs_P-D Product feature CHAIN GU456648_SHBs_P-D of FT:mat_peptide GU456648_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T85). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456649_SHBs_P-D Product feature CHAIN GU456649_SHBs_P-D of FT:mat_peptide GU456649_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T57). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDWWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPYLPLLPIFFCLWVYI
>gnl|hbvpro|GU456650_SHBs_P-D Product feature CHAIN GU456650_SHBs_P-D of FT:mat_peptide GU456650_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T62). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTMPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456651_SHBs_P-D Product feature CHAIN GU456651_SHBs_P-D of FT:mat_peptide GU456651_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T34). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456652_SHBs_P-D Product feature CHAIN GU456652_SHBs_P-D of FT:mat_peptide GU456652_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T44). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYTTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456653_SHBs_P-D Product feature CHAIN GU456653_SHBs_P-D of FT:mat_peptide GU456653_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T59). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLRVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456654_SHBs_P-D Product feature CHAIN GU456654_SHBs_P-D of FT:mat_peptide GU456654_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T39). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|GU456655_SHBs_P-D Product feature CHAIN GU456655_SHBs_P-D of FT:mat_peptide GU456655_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T95). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456656_SHBs_P-D Product feature CHAIN GU456656_SHBs_P-D of FT:mat_peptide GU456656_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T9). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYPILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456657_SHBs_P-D Product feature CHAIN GU456657_SHBs_P-D of FT:mat_peptide GU456657_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T83). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCTILSPYLPLLPIFFCLWVYI
>gnl|hbvpro|GU456658_SHBs_P-D Product feature CHAIN GU456658_SHBs_P-D of FT:mat_peptide GU456658_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T114). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLGQNSQCPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456659_SHBs_P-D Product feature CHAIN GU456659_SHBs_P-D of FT:mat_peptide GU456659_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T24). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLQLLPIFFCLWVYI
>gnl|hbvpro|GU456660_SHBs_P-D Product feature CHAIN GU456660_SHBs_P-D of FT:mat_peptide GU456660_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T64). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456661_SHBs_P-D Product feature CHAIN GU456661_SHBs_P-D of FT:mat_peptide GU456661_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T99). Complete genome. [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456662_SHBs_P-D Product feature CHAIN GU456662_SHBs_P-D of FT:mat_peptide GU456662_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T23). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPLTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456663_SHBs_P-D Product feature CHAIN GU456663_SHBs_P-D of FT:mat_peptide GU456663_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T86). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456664_SHBs_P-D Product feature CHAIN GU456664_SHBs_P-D of FT:mat_peptide GU456664_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T40). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456665_SHBs_P-D Product feature CHAIN GU456665_SHBs_P-D of FT:mat_peptide GU456665_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T76). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLVVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456666_SHBs_P-D Product feature CHAIN GU456666_SHBs_P-D of FT:mat_peptide GU456666_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T2). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456667_SHBs_P-D Product feature CHAIN GU456667_SHBs_P-D of FT:mat_peptide GU456667_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T120). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFLCLWAYI
>gnl|hbvpro|GU456668_SHBs_P-D Product feature CHAIN GU456668_SHBs_P-D of FT:mat_peptide GU456668_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T21). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTCSHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456669_SHBs_P-D Product feature CHAIN GU456669_SHBs_P-D of FT:mat_peptide GU456669_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T94). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPSSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456670_SHBs_P-D Product feature CHAIN GU456670_SHBs_P-D of FT:mat_peptide GU456670_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T27). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456673_SHBs_P-D Product feature CHAIN GU456673_SHBs_P-D of FT:mat_peptide GU456673_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T75). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456674_SHBs_P-D Product feature CHAIN GU456674_SHBs_P-D of FT:mat_peptide GU456674_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T16). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456675_SHBs_P-D Product feature CHAIN GU456675_SHBs_P-D of FT:mat_peptide GU456675_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T13). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456676_SHBs_P-D Product feature CHAIN GU456676_SHBs_P-D of FT:mat_peptide GU456676_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T98). Partial genome (Contains: HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456677_SHBs_P-D Product feature CHAIN GU456677_SHBs_P-D of FT:mat_peptide GU456677_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T46). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456678_SHBs_P-D Product feature CHAIN GU456678_SHBs_P-D of FT:mat_peptide GU456678_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T97). Complete genome. [Hepadnaviridae] (length=228 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLALLDCQGMLPVCPLTAANGSSTTSTEQCRTCTTPAQGTSMYLSCCCTKPSGGNCTCIPIPSSWAF
AKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456679_SHBs_P-D Product feature CHAIN GU456679_SHBs_P-D of FT:mat_peptide GU456679_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T63). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWAYI
>gnl|hbvpro|GU456680_SHBs_P-D Product feature CHAIN GU456680_SHBs_P-D of FT:mat_peptide GU456680_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T88). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456681_SHBs_P-D Product feature CHAIN GU456681_SHBs_P-D of FT:mat_peptide GU456681_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T79). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456682_SHBs_P-D Product feature CHAIN GU456682_SHBs_P-D of FT:mat_peptide GU456682_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T42). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFVGCSPTVWLLVTWMMWYWGLNPFHIFSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456683_SHBs_P-D Product feature CHAIN GU456683_SHBs_P-D of FT:mat_peptide GU456683_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T101). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLGLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLFSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU456684_SHBs_P-D Product feature CHAIN GU456684_SHBs_P-D of FT:mat_peptide GU456684_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T60). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPTLYNILKPFLPLLPIFFCLWAYI
>gnl|hbvpro|GU798966_SHBs_P-D Product feature CHAIN GU798966_SHBs_P-D of FT:mat_peptide GU798966_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_593). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798967_SHBs_P-D Product feature CHAIN GU798967_SHBs_P-D of FT:mat_peptide GU798967_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_610). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|GU798969_SHBs_P-D Product feature CHAIN GU798969_SHBs_P-D of FT:mat_peptide GU798969_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_937). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPSLYSILSPSLPLLPIFFCLWAYI
>gnl|hbvpro|GU798971_SHBs_P-D Product feature CHAIN GU798971_SHBs_P-D of FT:mat_peptide GU798971_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1211). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXGQNSQSPTSNHSPTSCPPTXPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCXTCTTTVQGTSMXPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798972_SHBs_P-D Product feature CHAIN GU798972_SHBs_P-D of FT:mat_peptide GU798972_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_646). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|GU798974_SHBs_P-D Product feature CHAIN GU798974_SHBs_P-D of FT:mat_peptide GU798974_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1067). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798980_SHBs_P-D Product feature CHAIN GU798980_SHBs_P-D of FT:mat_peptide GU798980_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1551). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTGCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCIKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798982_SHBs_P-D Product feature CHAIN GU798982_SHBs_P-D of FT:mat_peptide GU798982_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_539). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798983_SHBs_P-D Product feature CHAIN GU798983_SHBs_P-D of FT:mat_peptide GU798983_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_540). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798985_SHBs_P-D Product feature CHAIN GU798985_SHBs_P-D of FT:mat_peptide GU798985_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1600). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSIVRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798988_SHBs_P-D Product feature CHAIN GU798988_SHBs_P-D of FT:mat_peptide GU798988_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1671). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFGGLSPIVWPSVIWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798989_SHBs_P-D Product feature CHAIN GU798989_SHBs_P-D of FT:mat_peptide GU798989_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1542). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798991_SHBs_P-D Product feature CHAIN GU798991_SHBs_P-D of FT:mat_peptide GU798991_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1599). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU798995_SHBs_P-D Product feature CHAIN GU798995_SHBs_P-D of FT:mat_peptide GU798995_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1797). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPRVYSTLSPFLLLLPIFFCLWVYI
>gnl|hbvpro|GU798997_SHBs_P-D Product feature CHAIN GU798997_SHBs_P-D of FT:mat_peptide GU798997_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1852). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPACPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799000_SHBs_P-D Product feature CHAIN GU799000_SHBs_P-D of FT:mat_peptide GU799000_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1320). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799001_SHBs_P-D Product feature CHAIN GU799001_SHBs_P-D of FT:mat_peptide GU799001_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1212). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799002_SHBs_P-D Product feature CHAIN GU799002_SHBs_P-D of FT:mat_peptide GU799002_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1213). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799003_SHBs_P-D Product feature CHAIN GU799003_SHBs_P-D of FT:mat_peptide GU799003_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1342). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMLYWGPSLFTILSPFLPLLPIFFCLWAYI
>gnl|hbvpro|GU799005_SHBs_P-D Product feature CHAIN GU799005_SHBs_P-D of FT:mat_peptide GU799005_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_798). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGTCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799006_SHBs_P-D Product feature CHAIN GU799006_SHBs_P-D of FT:mat_peptide GU799006_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_69). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799007_SHBs_P-D Product feature CHAIN GU799007_SHBs_P-D of FT:mat_peptide GU799007_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_2038). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799008_SHBs_P-D Product feature CHAIN GU799008_SHBs_P-D of FT:mat_peptide GU799008_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_998). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799012_SHBs_P-D Product feature CHAIN GU799012_SHBs_P-D of FT:mat_peptide GU799012_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1541). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799013_SHBs_P-D Product feature CHAIN GU799013_SHBs_P-D of FT:mat_peptide GU799013_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1716). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799014_SHBs_P-D Product feature CHAIN GU799014_SHBs_P-D of FT:mat_peptide GU799014_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1290). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799016_SHBs_P-D Product feature CHAIN GU799016_SHBs_P-D of FT:mat_peptide GU799016_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1592). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799017_SHBs_P-D Product feature CHAIN GU799017_SHBs_P-D of FT:mat_peptide GU799017_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1594). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799018_SHBs_P-D Product feature CHAIN GU799018_SHBs_P-D of FT:mat_peptide GU799018_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1718). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSVGSCRTCTTTVPGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799019_SHBs_P-D Product feature CHAIN GU799019_SHBs_P-D of FT:mat_peptide GU799019_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_230). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799021_SHBs_P-D Product feature CHAIN GU799021_SHBs_P-D of FT:mat_peptide GU799021_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_270). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799022_SHBs_P-D Product feature CHAIN GU799022_SHBs_P-D of FT:mat_peptide GU799022_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_276). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQNNSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLNSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799023_SHBs_P-D Product feature CHAIN GU799023_SHBs_P-D of FT:mat_peptide GU799023_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_277). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799024_SHBs_P-D Product feature CHAIN GU799024_SHBs_P-D of FT:mat_peptide GU799024_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_977). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLLAGFSSLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCTGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSRYNILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|GU799026_SHBs_P-D Product feature CHAIN GU799026_SHBs_P-D of FT:mat_peptide GU799026_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 07/H_1026). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799028_SHBs_P-D Product feature CHAIN GU799028_SHBs_P-D of FT:mat_peptide GU799028_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 07/H_1105). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799029_SHBs_P-D Product feature CHAIN GU799029_SHBs_P-D of FT:mat_peptide GU799029_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 07/H_1129). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGASTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFVK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799034_SHBs_P-D Product feature CHAIN GU799034_SHBs_P-D of FT:mat_peptide GU799034_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_836). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799035_SHBs_P-D Product feature CHAIN GU799035_SHBs_P-D of FT:mat_peptide GU799035_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_956). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPRMHSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799036_SHBs_P-D Product feature CHAIN GU799036_SHBs_P-D of FT:mat_peptide GU799036_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1314). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTSTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799037_SHBs_P-D Product feature CHAIN GU799037_SHBs_P-D of FT:mat_peptide GU799037_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1517). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799038_SHBs_P-D Product feature CHAIN GU799038_SHBs_P-D of FT:mat_peptide GU799038_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_235). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799041_SHBs_P-D Product feature CHAIN GU799041_SHBs_P-D of FT:mat_peptide GU799041_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_1162). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLXVIWMMWYWGPKLCSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|GU799042_SHBs_P-D Product feature CHAIN GU799042_SHBs_P-D of FT:mat_peptide GU799042_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_294). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFXGLSPTVWLSVIWMMWYWGPSLYSIVRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799043_SHBs_P-D Product feature CHAIN GU799043_SHBs_P-D of FT:mat_peptide GU799043_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_401). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799044_SHBs_P-D Product feature CHAIN GU799044_SHBs_P-D of FT:mat_peptide GU799044_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_599). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799045_SHBs_P-D Product feature CHAIN GU799045_SHBs_P-D of FT:mat_peptide GU799045_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_600). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSXGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799049_SHBs_P-D Product feature CHAIN GU799049_SHBs_P-D of FT:mat_peptide GU799049_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_191). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799050_SHBs_P-D Product feature CHAIN GU799050_SHBs_P-D of FT:mat_peptide GU799050_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_395). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799051_SHBs_P-D Product feature CHAIN GU799051_SHBs_P-D of FT:mat_peptide GU799051_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 07/H_386). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799053_SHBs_P-D Product feature CHAIN GU799053_SHBs_P-D of FT:mat_peptide GU799053_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 07/H_821). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
YLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799054_SHBs_P-D Product feature CHAIN GU799054_SHBs_P-D of FT:mat_peptide GU799054_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_377). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799056_SHBs_P-D Product feature CHAIN GU799056_SHBs_P-D of FT:mat_peptide GU799056_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_1392). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPXSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799058_SHBs_P-D Product feature CHAIN GU799058_SHBs_P-D of FT:mat_peptide GU799058_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09/H_1435). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSXFLPLLPIFFCLWVYI
>gnl|hbvpro|GU799059_SHBs_P-D Product feature CHAIN GU799059_SHBs_P-D of FT:mat_peptide GU799059_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 08/H_707). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938305_SHBs_P-D Product feature CHAIN GU938305_SHBs_P-D of FT:mat_peptide GU938305_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 308). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938306_SHBs_P-D Product feature CHAIN GU938306_SHBs_P-D of FT:mat_peptide GU938306_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 309). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938307_SHBs_P-D Product feature CHAIN GU938307_SHBs_P-D of FT:mat_peptide GU938307_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 310). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938308_SHBs_P-D Product feature CHAIN GU938308_SHBs_P-D of FT:mat_peptide GU938308_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938309_SHBs_P-D Product feature CHAIN GU938309_SHBs_P-D of FT:mat_peptide GU938309_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 313). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSLFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938310_SHBs_P-D Product feature CHAIN GU938310_SHBs_P-D of FT:mat_peptide GU938310_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 318). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFAK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLLAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938311_SHBs_P-D Product feature CHAIN GU938311_SHBs_P-D of FT:mat_peptide GU938311_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 319). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPVLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938312_SHBs_P-D Product feature CHAIN GU938312_SHBs_P-D of FT:mat_peptide GU938312_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 321). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLAVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938313_SHBs_P-D Product feature CHAIN GU938313_SHBs_P-D of FT:mat_peptide GU938313_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 324). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=227 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPNKNSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFG
KFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938314_SHBs_P-D Product feature CHAIN GU938314_SHBs_P-D of FT:mat_peptide GU938314_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 325). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938315_SHBs_P-D Product feature CHAIN GU938315_SHBs_P-D of FT:mat_peptide GU938315_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 335). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938316_SHBs_P-D Product feature CHAIN GU938316_SHBs_P-D of FT:mat_peptide GU938316_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 336). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVCLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938317_SHBs_P-D Product feature CHAIN GU938317_SHBs_P-D of FT:mat_peptide GU938317_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 337). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938318_SHBs_P-D Product feature CHAIN GU938318_SHBs_P-D of FT:mat_peptide GU938318_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 338). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938319_SHBs_P-D Product feature CHAIN GU938319_SHBs_P-D of FT:mat_peptide GU938319_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 354). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLCIILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938320_SHBs_P-D Product feature CHAIN GU938320_SHBs_P-D of FT:mat_peptide GU938320_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 356). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938321_SHBs_P-D Product feature CHAIN GU938321_SHBs_P-D of FT:mat_peptide GU938321_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 357). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938322_SHBs_P-D Product feature CHAIN GU938322_SHBs_P-D of FT:mat_peptide GU938322_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 358). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVCLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938324_SHBs_P-D Product feature CHAIN GU938324_SHBs_P-D of FT:mat_peptide GU938324_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 186). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938325_SHBs_P-D Product feature CHAIN GU938325_SHBs_P-D of FT:mat_peptide GU938325_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 187). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWDWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938327_SHBs_P-D Product feature CHAIN GU938327_SHBs_P-D of FT:mat_peptide GU938327_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 189). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938328_SHBs_P-D Product feature CHAIN GU938328_SHBs_P-D of FT:mat_peptide GU938328_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 194). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938330_SHBs_P-D Product feature CHAIN GU938330_SHBs_P-D of FT:mat_peptide GU938330_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 203). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938331_SHBs_P-D Product feature CHAIN GU938331_SHBs_P-D of FT:mat_peptide GU938331_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 205). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938332_SHBs_P-D Product feature CHAIN GU938332_SHBs_P-D of FT:mat_peptide GU938332_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 207). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938333_SHBs_P-D Product feature CHAIN GU938333_SHBs_P-D of FT:mat_peptide GU938333_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 210). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938334_SHBs_P-D Product feature CHAIN GU938334_SHBs_P-D of FT:mat_peptide GU938334_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 211). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938335_SHBs_P-D Product feature CHAIN GU938335_SHBs_P-D of FT:mat_peptide GU938335_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 212). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938337_SHBs_P-D Product feature CHAIN GU938337_SHBs_P-D of FT:mat_peptide GU938337_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 214). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938338_SHBs_P-D Product feature CHAIN GU938338_SHBs_P-D of FT:mat_peptide GU938338_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 215). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938339_SHBs_P-D Product feature CHAIN GU938339_SHBs_P-D of FT:mat_peptide GU938339_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 228). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938340_SHBs_P-D Product feature CHAIN GU938340_SHBs_P-D of FT:mat_peptide GU938340_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 229). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938341_SHBs_P-D Product feature CHAIN GU938341_SHBs_P-D of FT:mat_peptide GU938341_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 230). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938342_SHBs_P-D Product feature CHAIN GU938342_SHBs_P-D of FT:mat_peptide GU938342_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 11). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938343_SHBs_P-D Product feature CHAIN GU938343_SHBs_P-D of FT:mat_peptide GU938343_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 12). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938344_SHBs_P-D Product feature CHAIN GU938344_SHBs_P-D of FT:mat_peptide GU938344_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 13). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938345_SHBs_P-D Product feature CHAIN GU938345_SHBs_P-D of FT:mat_peptide GU938345_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 14). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938346_SHBs_P-D Product feature CHAIN GU938346_SHBs_P-D of FT:mat_peptide GU938346_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 15). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938347_SHBs_P-D Product feature CHAIN GU938347_SHBs_P-D of FT:mat_peptide GU938347_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 16). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938348_SHBs_P-D Product feature CHAIN GU938348_SHBs_P-D of FT:mat_peptide GU938348_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938349_SHBs_P-D Product feature CHAIN GU938349_SHBs_P-D of FT:mat_peptide GU938349_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 18). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938350_SHBs_P-D Product feature CHAIN GU938350_SHBs_P-D of FT:mat_peptide GU938350_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 19). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938351_SHBs_P-D Product feature CHAIN GU938351_SHBs_P-D of FT:mat_peptide GU938351_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 20). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938352_SHBs_P-D Product feature CHAIN GU938352_SHBs_P-D of FT:mat_peptide GU938352_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 21). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938353_SHBs_P-D Product feature CHAIN GU938353_SHBs_P-D of FT:mat_peptide GU938353_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 22). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938354_SHBs_P-D Product feature CHAIN GU938354_SHBs_P-D of FT:mat_peptide GU938354_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 23). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938355_SHBs_P-D Product feature CHAIN GU938355_SHBs_P-D of FT:mat_peptide GU938355_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 24). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938356_SHBs_P-D Product feature CHAIN GU938356_SHBs_P-D of FT:mat_peptide GU938356_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 25). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLRDYQGMLPVCPLIPGSSTTSTRPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938357_SHBs_P-D Product feature CHAIN GU938357_SHBs_P-D of FT:mat_peptide GU938357_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 27). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938358_SHBs_P-D Product feature CHAIN GU938358_SHBs_P-D of FT:mat_peptide GU938358_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 29). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938359_SHBs_P-D Product feature CHAIN GU938359_SHBs_P-D of FT:mat_peptide GU938359_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 32). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938360_SHBs_P-D Product feature CHAIN GU938360_SHBs_P-D of FT:mat_peptide GU938360_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938361_SHBs_P-D Product feature CHAIN GU938361_SHBs_P-D of FT:mat_peptide GU938361_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 108). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938362_SHBs_P-D Product feature CHAIN GU938362_SHBs_P-D of FT:mat_peptide GU938362_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 110). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938363_SHBs_P-D Product feature CHAIN GU938363_SHBs_P-D of FT:mat_peptide GU938363_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|GU938364_SHBs_P-D Product feature CHAIN GU938364_SHBs_P-D of FT:mat_peptide GU938364_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 112). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101101_SHBs_P-D Product feature CHAIN HM101101_SHBs_P-D of FT:mat_peptide HM101101_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 37_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101103_SHBs_P-D Product feature CHAIN HM101103_SHBs_P-D of FT:mat_peptide HM101103_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 40_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101104_SHBs_P-D Product feature CHAIN HM101104_SHBs_P-D of FT:mat_peptide HM101104_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 25_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101105_SHBs_P-D Product feature CHAIN HM101105_SHBs_P-D of FT:mat_peptide HM101105_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 31_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101106_SHBs_P-D Product feature CHAIN HM101106_SHBs_P-D of FT:mat_peptide HM101106_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 07_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101107_SHBs_P-D Product feature CHAIN HM101107_SHBs_P-D of FT:mat_peptide HM101107_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 32_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101108_SHBs_P-D Product feature CHAIN HM101108_SHBs_P-D of FT:mat_peptide HM101108_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 03_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101109_SHBs_P-D Product feature CHAIN HM101109_SHBs_P-D of FT:mat_peptide HM101109_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 41_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101110_SHBs_P-D Product feature CHAIN HM101110_SHBs_P-D of FT:mat_peptide HM101110_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 39_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101111_SHBs_P-D Product feature CHAIN HM101111_SHBs_P-D of FT:mat_peptide HM101111_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101112_SHBs_P-D Product feature CHAIN HM101112_SHBs_P-D of FT:mat_peptide HM101112_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 28_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101126_SHBs_P-D Product feature CHAIN HM101126_SHBs_P-D of FT:mat_peptide HM101126_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 04_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101127_SHBs_P-D Product feature CHAIN HM101127_SHBs_P-D of FT:mat_peptide HM101127_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 05_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM101128_SHBs_P-D Product feature CHAIN HM101128_SHBs_P-D of FT:mat_peptide HM101128_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 06_HBVpv_1300). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229699_SHBs_P-D Product feature CHAIN HM229699_SHBs_P-D of FT:mat_peptide HM229699_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC15-02(4c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229700_SHBs_P-D Product feature CHAIN HM229700_SHBs_P-D of FT:mat_peptide HM229700_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC16_02(6c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229701_SHBs_P-D Product feature CHAIN HM229701_SHBs_P-D of FT:mat_peptide HM229701_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC17_02(7c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSISRPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229702_SHBs_P-D Product feature CHAIN HM229702_SHBs_P-D of FT:mat_peptide HM229702_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC19_02(8c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229704_SHBs_P-D Product feature CHAIN HM229704_SHBs_P-D of FT:mat_peptide HM229704_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC21_02(10c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229705_SHBs_P-D Product feature CHAIN HM229705_SHBs_P-D of FT:mat_peptide HM229705_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC22_02(11c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTCNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229707_SHBs_P-D Product feature CHAIN HM229707_SHBs_P-D of FT:mat_peptide HM229707_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC24_02(13c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229708_SHBs_P-D Product feature CHAIN HM229708_SHBs_P-D of FT:mat_peptide HM229708_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC28_02(15c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229709_SHBs_P-D Product feature CHAIN HM229709_SHBs_P-D of FT:mat_peptide HM229709_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC29_02(16c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLNSILSPFLLLLPIFFCLWVYI
>gnl|hbvpro|HM229710_SHBs_P-D Product feature CHAIN HM229710_SHBs_P-D of FT:mat_peptide HM229710_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC31_02(17c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229711_SHBs_P-D Product feature CHAIN HM229711_SHBs_P-D of FT:mat_peptide HM229711_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC32-02(18c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVIWMMWYWGPKLCSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229712_SHBs_P-D Product feature CHAIN HM229712_SHBs_P-D of FT:mat_peptide HM229712_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC33_02(19c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229713_SHBs_P-D Product feature CHAIN HM229713_SHBs_P-D of FT:mat_peptide HM229713_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC34-02(20c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSLTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229714_SHBs_P-D Product feature CHAIN HM229714_SHBs_P-D of FT:mat_peptide HM229714_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC35_02(21c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLNSILSPLIPLLPIFLCLWVYI
>gnl|hbvpro|HM229715_SHBs_P-D Product feature CHAIN HM229715_SHBs_P-D of FT:mat_peptide HM229715_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC36_02(22c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSRTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWCWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229717_SHBs_P-D Product feature CHAIN HM229717_SHBs_P-D of FT:mat_peptide HM229717_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC39-02(24c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229719_SHBs_P-D Product feature CHAIN HM229719_SHBs_P-D of FT:mat_peptide HM229719_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC42-02(27c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFTPLLPIFFCLWVYI
>gnl|hbvpro|HM229720_SHBs_P-D Product feature CHAIN HM229720_SHBs_P-D of FT:mat_peptide HM229720_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC43_02(28c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229721_SHBs_P-D Product feature CHAIN HM229721_SHBs_P-D of FT:mat_peptide HM229721_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC44_02(29c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229722_SHBs_P-D Product feature CHAIN HM229722_SHBs_P-D of FT:mat_peptide HM229722_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC45-02(30c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229723_SHBs_P-D Product feature CHAIN HM229723_SHBs_P-D of FT:mat_peptide HM229723_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC46-02(31c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSTLSPFLPLLLIFFCLWVYI
>gnl|hbvpro|HM229725_SHBs_P-D Product feature CHAIN HM229725_SHBs_P-D of FT:mat_peptide HM229725_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC48-02(33c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229726_SHBs_P-D Product feature CHAIN HM229726_SHBs_P-D of FT:mat_peptide HM229726_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC49_02(34c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229728_SHBs_P-D Product feature CHAIN HM229728_SHBs_P-D of FT:mat_peptide HM229728_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC51-02(36c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229729_SHBs_P-D Product feature CHAIN HM229729_SHBs_P-D of FT:mat_peptide HM229729_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC53-02(38c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229730_SHBs_P-D Product feature CHAIN HM229730_SHBs_P-D of FT:mat_peptide HM229730_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC54_02(39c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229731_SHBs_P-D Product feature CHAIN HM229731_SHBs_P-D of FT:mat_peptide HM229731_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC55_02(40c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRMYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229732_SHBs_P-D Product feature CHAIN HM229732_SHBs_P-D of FT:mat_peptide HM229732_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC56-02(41c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229733_SHBs_P-D Product feature CHAIN HM229733_SHBs_P-D of FT:mat_peptide HM229733_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC57_02(42c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229734_SHBs_P-D Product feature CHAIN HM229734_SHBs_P-D of FT:mat_peptide HM229734_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC58_02(43c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229735_SHBs_P-D Product feature CHAIN HM229735_SHBs_P-D of FT:mat_peptide HM229735_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC59-02(44c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229737_SHBs_P-D Product feature CHAIN HM229737_SHBs_P-D of FT:mat_peptide HM229737_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC61-02(46c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229739_SHBs_P-D Product feature CHAIN HM229739_SHBs_P-D of FT:mat_peptide HM229739_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC63-02(48c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229740_SHBs_P-D Product feature CHAIN HM229740_SHBs_P-D of FT:mat_peptide HM229740_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC64_02(49c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPKMYSILSPFLPPLLIFFCLWVYI
>gnl|hbvpro|HM229742_SHBs_P-D Product feature CHAIN HM229742_SHBs_P-D of FT:mat_peptide HM229742_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC66-02(50c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229743_SHBs_P-D Product feature CHAIN HM229743_SHBs_P-D of FT:mat_peptide HM229743_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC67-02(51c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWALGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229744_SHBs_P-D Product feature CHAIN HM229744_SHBs_P-D of FT:mat_peptide HM229744_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC68_02(52c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229745_SHBs_P-D Product feature CHAIN HM229745_SHBs_P-D of FT:mat_peptide HM229745_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC70-02(54c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229747_SHBs_P-D Product feature CHAIN HM229747_SHBs_P-D of FT:mat_peptide HM229747_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC72_02(56c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLTFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229748_SHBs_P-D Product feature CHAIN HM229748_SHBs_P-D of FT:mat_peptide HM229748_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC73_02(57c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQNNSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229749_SHBs_P-D Product feature CHAIN HM229749_SHBs_P-D of FT:mat_peptide HM229749_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC74_02(59c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQNNSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229750_SHBs_P-D Product feature CHAIN HM229750_SHBs_P-D of FT:mat_peptide HM229750_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC75_02(60c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPKLCSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229751_SHBs_P-D Product feature CHAIN HM229751_SHBs_P-D of FT:mat_peptide HM229751_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC76_02(61c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLLIFFCLWVYI
>gnl|hbvpro|HM229752_SHBs_P-D Product feature CHAIN HM229752_SHBs_P-D of FT:mat_peptide HM229752_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC77_02(62c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229753_SHBs_P-D Product feature CHAIN HM229753_SHBs_P-D of FT:mat_peptide HM229753_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC78-02(63c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229754_SHBs_P-D Product feature CHAIN HM229754_SHBs_P-D of FT:mat_peptide HM229754_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC79_02(64c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229755_SHBs_P-D Product feature CHAIN HM229755_SHBs_P-D of FT:mat_peptide HM229755_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC80-02(65c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPYCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229756_SHBs_P-D Product feature CHAIN HM229756_SHBs_P-D of FT:mat_peptide HM229756_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC81-02(66c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPKLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229757_SHBs_P-D Product feature CHAIN HM229757_SHBs_P-D of FT:mat_peptide HM229757_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC82_02(67c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYRTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229758_SHBs_P-D Product feature CHAIN HM229758_SHBs_P-D of FT:mat_peptide HM229758_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC83-02(68c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229759_SHBs_P-D Product feature CHAIN HM229759_SHBs_P-D of FT:mat_peptide HM229759_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC84_02(69c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229760_SHBs_P-D Product feature CHAIN HM229760_SHBs_P-D of FT:mat_peptide HM229760_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC85-02(70c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRVYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229762_SHBs_P-D Product feature CHAIN HM229762_SHBs_P-D of FT:mat_peptide HM229762_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC87_02(72c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229763_SHBs_P-D Product feature CHAIN HM229763_SHBs_P-D of FT:mat_peptide HM229763_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC88-02(73c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229764_SHBs_P-D Product feature CHAIN HM229764_SHBs_P-D of FT:mat_peptide HM229764_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC89_02(74c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229765_SHBs_P-D Product feature CHAIN HM229765_SHBs_P-D of FT:mat_peptide HM229765_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC90_02(75c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPKLCSILSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM229767_SHBs_P-D Product feature CHAIN HM229767_SHBs_P-D of FT:mat_peptide HM229767_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC93-02(78c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGN
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229768_SHBs_P-D Product feature CHAIN HM229768_SHBs_P-D of FT:mat_peptide HM229768_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC94-02(79c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229769_SHBs_P-D Product feature CHAIN HM229769_SHBs_P-D of FT:mat_peptide HM229769_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC95-02(80c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229770_SHBs_P-D Product feature CHAIN HM229770_SHBs_P-D of FT:mat_peptide HM229770_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC96_02(81c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229771_SHBs_P-D Product feature CHAIN HM229771_SHBs_P-D of FT:mat_peptide HM229771_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC97_02(82c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229772_SHBs_P-D Product feature CHAIN HM229772_SHBs_P-D of FT:mat_peptide HM229772_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC98_02(83c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229773_SHBs_P-D Product feature CHAIN HM229773_SHBs_P-D of FT:mat_peptide HM229773_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC99_02(84c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229774_SHBs_P-D Product feature CHAIN HM229774_SHBs_P-D of FT:mat_peptide HM229774_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC100-02(85c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM229775_SHBs_P-D Product feature CHAIN HM229775_SHBs_P-D of FT:mat_peptide HM229775_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M-DDRC101-02(86c)). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348619_SHBs_P-D Product feature CHAIN HM348619_SHBs_P-D of FT:mat_peptide HM348619_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 34). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348620_SHBs_P-D Product feature CHAIN HM348620_SHBs_P-D of FT:mat_peptide HM348620_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 35). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348621_SHBs_P-D Product feature CHAIN HM348621_SHBs_P-D of FT:mat_peptide HM348621_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 39). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLMPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348622_SHBs_P-D Product feature CHAIN HM348622_SHBs_P-D of FT:mat_peptide HM348622_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 40). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348623_SHBs_P-D Product feature CHAIN HM348623_SHBs_P-D of FT:mat_peptide HM348623_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 44). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348624_SHBs_P-D Product feature CHAIN HM348624_SHBs_P-D of FT:mat_peptide HM348624_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 45). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348625_SHBs_P-D Product feature CHAIN HM348625_SHBs_P-D of FT:mat_peptide HM348625_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 46). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348626_SHBs_P-D Product feature CHAIN HM348626_SHBs_P-D of FT:mat_peptide HM348626_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 47). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348627_SHBs_P-D Product feature CHAIN HM348627_SHBs_P-D of FT:mat_peptide HM348627_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 48). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348628_SHBs_P-D Product feature CHAIN HM348628_SHBs_P-D of FT:mat_peptide HM348628_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 56). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348629_SHBs_P-D Product feature CHAIN HM348629_SHBs_P-D of FT:mat_peptide HM348629_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 59). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGTCRTCTTPAHGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348630_SHBs_P-D Product feature CHAIN HM348630_SHBs_P-D of FT:mat_peptide HM348630_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 147). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348631_SHBs_P-D Product feature CHAIN HM348631_SHBs_P-D of FT:mat_peptide HM348631_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 148). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348632_SHBs_P-D Product feature CHAIN HM348632_SHBs_P-D of FT:mat_peptide HM348632_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 149). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWGWASARFSWLSLLVPFVQWFVGLSPTVWLSVMWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348633_SHBs_P-D Product feature CHAIN HM348633_SHBs_P-D of FT:mat_peptide HM348633_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 150). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348634_SHBs_P-D Product feature CHAIN HM348634_SHBs_P-D of FT:mat_peptide HM348634_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 151). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPRLCSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348635_SHBs_P-D Product feature CHAIN HM348635_SHBs_P-D of FT:mat_peptide HM348635_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 345). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLCRTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348636_SHBs_P-D Product feature CHAIN HM348636_SHBs_P-D of FT:mat_peptide HM348636_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 78). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSTLSPFLLLLPIFFCLWVYI
>gnl|hbvpro|HM348637_SHBs_P-D Product feature CHAIN HM348637_SHBs_P-D of FT:mat_peptide HM348637_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 79). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348638_SHBs_P-D Product feature CHAIN HM348638_SHBs_P-D of FT:mat_peptide HM348638_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 80). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348639_SHBs_P-D Product feature CHAIN HM348639_SHBs_P-D of FT:mat_peptide HM348639_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 81). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348640_SHBs_P-D Product feature CHAIN HM348640_SHBs_P-D of FT:mat_peptide HM348640_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 82). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTAAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILKPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348641_SHBs_P-D Product feature CHAIN HM348641_SHBs_P-D of FT:mat_peptide HM348641_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 83). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348642_SHBs_P-D Product feature CHAIN HM348642_SHBs_P-D of FT:mat_peptide HM348642_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 84). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348643_SHBs_P-D Product feature CHAIN HM348643_SHBs_P-D of FT:mat_peptide HM348643_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 85). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348644_SHBs_P-D Product feature CHAIN HM348644_SHBs_P-D of FT:mat_peptide HM348644_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 86). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348645_SHBs_P-D Product feature CHAIN HM348645_SHBs_P-D of FT:mat_peptide HM348645_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 87). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348646_SHBs_P-D Product feature CHAIN HM348646_SHBs_P-D of FT:mat_peptide HM348646_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 88). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348647_SHBs_P-D Product feature CHAIN HM348647_SHBs_P-D of FT:mat_peptide HM348647_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 89). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348648_SHBs_P-D Product feature CHAIN HM348648_SHBs_P-D of FT:mat_peptide HM348648_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 90). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348649_SHBs_P-D Product feature CHAIN HM348649_SHBs_P-D of FT:mat_peptide HM348649_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 91). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348650_SHBs_P-D Product feature CHAIN HM348650_SHBs_P-D of FT:mat_peptide HM348650_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 92). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348651_SHBs_P-D Product feature CHAIN HM348651_SHBs_P-D of FT:mat_peptide HM348651_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 126). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348652_SHBs_P-D Product feature CHAIN HM348652_SHBs_P-D of FT:mat_peptide HM348652_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 155). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348653_SHBs_P-D Product feature CHAIN HM348653_SHBs_P-D of FT:mat_peptide HM348653_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 156). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQDSQSPTCNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348654_SHBs_P-D Product feature CHAIN HM348654_SHBs_P-D of FT:mat_peptide HM348654_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 158). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348655_SHBs_P-D Product feature CHAIN HM348655_SHBs_P-D of FT:mat_peptide HM348655_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 159). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLHSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348656_SHBs_P-D Product feature CHAIN HM348656_SHBs_P-D of FT:mat_peptide HM348656_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 160). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348658_SHBs_P-D Product feature CHAIN HM348658_SHBs_P-D of FT:mat_peptide HM348658_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 234). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348659_SHBs_P-D Product feature CHAIN HM348659_SHBs_P-D of FT:mat_peptide HM348659_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 235). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348660_SHBs_P-D Product feature CHAIN HM348660_SHBs_P-D of FT:mat_peptide HM348660_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 236). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348661_SHBs_P-D Product feature CHAIN HM348661_SHBs_P-D of FT:mat_peptide HM348661_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 237). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348662_SHBs_P-D Product feature CHAIN HM348662_SHBs_P-D of FT:mat_peptide HM348662_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 238). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348663_SHBs_P-D Product feature CHAIN HM348663_SHBs_P-D of FT:mat_peptide HM348663_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 239). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348664_SHBs_P-D Product feature CHAIN HM348664_SHBs_P-D of FT:mat_peptide HM348664_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 241). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348665_SHBs_P-D Product feature CHAIN HM348665_SHBs_P-D of FT:mat_peptide HM348665_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 242). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFLCLWVYI
>gnl|hbvpro|HM348666_SHBs_P-D Product feature CHAIN HM348666_SHBs_P-D of FT:mat_peptide HM348666_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 243). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348667_SHBs_P-D Product feature CHAIN HM348667_SHBs_P-D of FT:mat_peptide HM348667_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 244). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348668_SHBs_P-D Product feature CHAIN HM348668_SHBs_P-D of FT:mat_peptide HM348668_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 245). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348669_SHBs_P-D Product feature CHAIN HM348669_SHBs_P-D of FT:mat_peptide HM348669_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 246). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPTLYNILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348670_SHBs_P-D Product feature CHAIN HM348670_SHBs_P-D of FT:mat_peptide HM348670_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 248). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348672_SHBs_P-D Product feature CHAIN HM348672_SHBs_P-D of FT:mat_peptide HM348672_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 251). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348673_SHBs_P-D Product feature CHAIN HM348673_SHBs_P-D of FT:mat_peptide HM348673_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 252). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLFSILSLFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348674_SHBs_P-D Product feature CHAIN HM348674_SHBs_P-D of FT:mat_peptide HM348674_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 253). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348675_SHBs_P-D Product feature CHAIN HM348675_SHBs_P-D of FT:mat_peptide HM348675_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 254). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348676_SHBs_P-D Product feature CHAIN HM348676_SHBs_P-D of FT:mat_peptide HM348676_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 255). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348677_SHBs_P-D Product feature CHAIN HM348677_SHBs_P-D of FT:mat_peptide HM348677_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 256). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPNLCRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348678_SHBs_P-D Product feature CHAIN HM348678_SHBs_P-D of FT:mat_peptide HM348678_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 257). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348679_SHBs_P-D Product feature CHAIN HM348679_SHBs_P-D of FT:mat_peptide HM348679_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 258). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTTLSPFIPLLPIFFCLWVYI
>gnl|hbvpro|HM348680_SHBs_P-D Product feature CHAIN HM348680_SHBs_P-D of FT:mat_peptide HM348680_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 259). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348681_SHBs_P-D Product feature CHAIN HM348681_SHBs_P-D of FT:mat_peptide HM348681_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 260). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRTLSPFLLLLPIFFCLWVYI
>gnl|hbvpro|HM348683_SHBs_P-D Product feature CHAIN HM348683_SHBs_P-D of FT:mat_peptide HM348683_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 168). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348684_SHBs_P-D Product feature CHAIN HM348684_SHBs_P-D of FT:mat_peptide HM348684_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 169). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348685_SHBs_P-D Product feature CHAIN HM348685_SHBs_P-D of FT:mat_peptide HM348685_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 170). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYTILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348686_SHBs_P-D Product feature CHAIN HM348686_SHBs_P-D of FT:mat_peptide HM348686_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 171). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348687_SHBs_P-D Product feature CHAIN HM348687_SHBs_P-D of FT:mat_peptide HM348687_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 172). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348688_SHBs_P-D Product feature CHAIN HM348688_SHBs_P-D of FT:mat_peptide HM348688_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 174). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348689_SHBs_P-D Product feature CHAIN HM348689_SHBs_P-D of FT:mat_peptide HM348689_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 176). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348690_SHBs_P-D Product feature CHAIN HM348690_SHBs_P-D of FT:mat_peptide HM348690_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 177). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348691_SHBs_P-D Product feature CHAIN HM348691_SHBs_P-D of FT:mat_peptide HM348691_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 178). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348692_SHBs_P-D Product feature CHAIN HM348692_SHBs_P-D of FT:mat_peptide HM348692_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 179). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGTSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348693_SHBs_P-D Product feature CHAIN HM348693_SHBs_P-D of FT:mat_peptide HM348693_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 180). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGPCRTCTTPAQGTSMDPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348694_SHBs_P-D Product feature CHAIN HM348694_SHBs_P-D of FT:mat_peptide HM348694_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348695_SHBs_P-D Product feature CHAIN HM348695_SHBs_P-D of FT:mat_peptide HM348695_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTRPCRTCTTLAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348696_SHBs_P-D Product feature CHAIN HM348696_SHBs_P-D of FT:mat_peptide HM348696_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348697_SHBs_P-D Product feature CHAIN HM348697_SHBs_P-D of FT:mat_peptide HM348697_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 9). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348698_SHBs_P-D Product feature CHAIN HM348698_SHBs_P-D of FT:mat_peptide HM348698_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 113). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348699_SHBs_P-D Product feature CHAIN HM348699_SHBs_P-D of FT:mat_peptide HM348699_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 114). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348700_SHBs_P-D Product feature CHAIN HM348700_SHBs_P-D of FT:mat_peptide HM348700_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 115). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348701_SHBs_P-D Product feature CHAIN HM348701_SHBs_P-D of FT:mat_peptide HM348701_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 116). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348702_SHBs_P-D Product feature CHAIN HM348702_SHBs_P-D of FT:mat_peptide HM348702_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348706_SHBs_P-D Product feature CHAIN HM348706_SHBs_P-D of FT:mat_peptide HM348706_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 270). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348707_SHBs_P-D Product feature CHAIN HM348707_SHBs_P-D of FT:mat_peptide HM348707_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 271). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMHPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348708_SHBs_P-D Product feature CHAIN HM348708_SHBs_P-D of FT:mat_peptide HM348708_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 272). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348709_SHBs_P-D Product feature CHAIN HM348709_SHBs_P-D of FT:mat_peptide HM348709_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 273). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348710_SHBs_P-D Product feature CHAIN HM348710_SHBs_P-D of FT:mat_peptide HM348710_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 274). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348711_SHBs_P-D Product feature CHAIN HM348711_SHBs_P-D of FT:mat_peptide HM348711_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 275). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348712_SHBs_P-D Product feature CHAIN HM348712_SHBs_P-D of FT:mat_peptide HM348712_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 276). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348713_SHBs_P-D Product feature CHAIN HM348713_SHBs_P-D of FT:mat_peptide HM348713_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 277). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM348714_SHBs_P-D Product feature CHAIN HM348714_SHBs_P-D of FT:mat_peptide HM348714_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 278). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358277_SHBs_P-D Product feature CHAIN HM358277_SHBs_P-D of FT:mat_peptide HM358277_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 129). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358278_SHBs_P-D Product feature CHAIN HM358278_SHBs_P-D of FT:mat_peptide HM358278_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 130). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358279_SHBs_P-D Product feature CHAIN HM358279_SHBs_P-D of FT:mat_peptide HM358279_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 131). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358280_SHBs_P-D Product feature CHAIN HM358280_SHBs_P-D of FT:mat_peptide HM358280_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 134). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358282_SHBs_P-D Product feature CHAIN HM358282_SHBs_P-D of FT:mat_peptide HM358282_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 136). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRS
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWSWGLNPFNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358283_SHBs_P-D Product feature CHAIN HM358283_SHBs_P-D of FT:mat_peptide HM358283_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 137). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358284_SHBs_P-D Product feature CHAIN HM358284_SHBs_P-D of FT:mat_peptide HM358284_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 140). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358285_SHBs_P-D Product feature CHAIN HM358285_SHBs_P-D of FT:mat_peptide HM358285_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 141). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358286_SHBs_P-D Product feature CHAIN HM358286_SHBs_P-D of FT:mat_peptide HM358286_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 142). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358287_SHBs_P-D Product feature CHAIN HM358287_SHBs_P-D of FT:mat_peptide HM358287_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 143). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358288_SHBs_P-D Product feature CHAIN HM358288_SHBs_P-D of FT:mat_peptide HM358288_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 145). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSLTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGTCRTCTTPAQRTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVILMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358289_SHBs_P-D Product feature CHAIN HM358289_SHBs_P-D of FT:mat_peptide HM358289_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 146). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358290_SHBs_P-D Product feature CHAIN HM358290_SHBs_P-D of FT:mat_peptide HM358290_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 261). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358291_SHBs_P-D Product feature CHAIN HM358291_SHBs_P-D of FT:mat_peptide HM358291_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 285). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358292_SHBs_P-D Product feature CHAIN HM358292_SHBs_P-D of FT:mat_peptide HM358292_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 287). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASSRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358293_SHBs_P-D Product feature CHAIN HM358293_SHBs_P-D of FT:mat_peptide HM358293_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 288). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGRSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358294_SHBs_P-D Product feature CHAIN HM358294_SHBs_P-D of FT:mat_peptide HM358294_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 289). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358295_SHBs_P-D Product feature CHAIN HM358295_SHBs_P-D of FT:mat_peptide HM358295_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 290). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358297_SHBs_P-D Product feature CHAIN HM358297_SHBs_P-D of FT:mat_peptide HM358297_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 292). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358298_SHBs_P-D Product feature CHAIN HM358298_SHBs_P-D of FT:mat_peptide HM358298_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358299_SHBs_P-D Product feature CHAIN HM358299_SHBs_P-D of FT:mat_peptide HM358299_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358300_SHBs_P-D Product feature CHAIN HM358300_SHBs_P-D of FT:mat_peptide HM358300_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358301_SHBs_P-D Product feature CHAIN HM358301_SHBs_P-D of FT:mat_peptide HM358301_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358302_SHBs_P-D Product feature CHAIN HM358302_SHBs_P-D of FT:mat_peptide HM358302_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358303_SHBs_P-D Product feature CHAIN HM358303_SHBs_P-D of FT:mat_peptide HM358303_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358304_SHBs_P-D Product feature CHAIN HM358304_SHBs_P-D of FT:mat_peptide HM358304_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358305_SHBs_P-D Product feature CHAIN HM358305_SHBs_P-D of FT:mat_peptide HM358305_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358306_SHBs_P-D Product feature CHAIN HM358306_SHBs_P-D of FT:mat_peptide HM358306_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPQIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358307_SHBs_P-D Product feature CHAIN HM358307_SHBs_P-D of FT:mat_peptide HM358307_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLNLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLRPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358308_SHBs_P-D Product feature CHAIN HM358308_SHBs_P-D of FT:mat_peptide HM358308_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358309_SHBs_P-D Product feature CHAIN HM358309_SHBs_P-D of FT:mat_peptide HM358309_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358310_SHBs_P-D Product feature CHAIN HM358310_SHBs_P-D of FT:mat_peptide HM358310_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLMTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358311_SHBs_P-D Product feature CHAIN HM358311_SHBs_P-D of FT:mat_peptide HM358311_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358312_SHBs_P-D Product feature CHAIN HM358312_SHBs_P-D of FT:mat_peptide HM358312_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358313_SHBs_P-D Product feature CHAIN HM358313_SHBs_P-D of FT:mat_peptide HM358313_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358314_SHBs_P-D Product feature CHAIN HM358314_SHBs_P-D of FT:mat_peptide HM358314_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 9a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358315_SHBs_P-D Product feature CHAIN HM358315_SHBs_P-D of FT:mat_peptide HM358315_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 9b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSTLSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358316_SHBs_P-D Product feature CHAIN HM358316_SHBs_P-D of FT:mat_peptide HM358316_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 10a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358317_SHBs_P-D Product feature CHAIN HM358317_SHBs_P-D of FT:mat_peptide HM358317_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 10b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMISYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358318_SHBs_P-D Product feature CHAIN HM358318_SHBs_P-D of FT:mat_peptide HM358318_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 11a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358319_SHBs_P-D Product feature CHAIN HM358319_SHBs_P-D of FT:mat_peptide HM358319_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 11b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILRPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358320_SHBs_P-D Product feature CHAIN HM358320_SHBs_P-D of FT:mat_peptide HM358320_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 12a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358321_SHBs_P-D Product feature CHAIN HM358321_SHBs_P-D of FT:mat_peptide HM358321_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 12b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358322_SHBs_P-D Product feature CHAIN HM358322_SHBs_P-D of FT:mat_peptide HM358322_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 13a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358323_SHBs_P-D Product feature CHAIN HM358323_SHBs_P-D of FT:mat_peptide HM358323_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 13b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358324_SHBs_P-D Product feature CHAIN HM358324_SHBs_P-D of FT:mat_peptide HM358324_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 14a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPNLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358325_SHBs_P-D Product feature CHAIN HM358325_SHBs_P-D of FT:mat_peptide HM358325_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 14b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPNLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358326_SHBs_P-D Product feature CHAIN HM358326_SHBs_P-D of FT:mat_peptide HM358326_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 15a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358327_SHBs_P-D Product feature CHAIN HM358327_SHBs_P-D of FT:mat_peptide HM358327_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 15b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358328_SHBs_P-D Product feature CHAIN HM358328_SHBs_P-D of FT:mat_peptide HM358328_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 16a). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358329_SHBs_P-D Product feature CHAIN HM358329_SHBs_P-D of FT:mat_peptide HM358329_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 16b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPNLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358330_SHBs_P-D Product feature CHAIN HM358330_SHBs_P-D of FT:mat_peptide HM358330_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358331_SHBs_P-D Product feature CHAIN HM358331_SHBs_P-D of FT:mat_peptide HM358331_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFQGMLLVCPIIPGSLTNSTGPCRTCTTPAQGTSMHPFCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358332_SHBs_P-D Product feature CHAIN HM358332_SHBs_P-D of FT:mat_peptide HM358332_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5MH). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358333_SHBs_P-D Product feature CHAIN HM358333_SHBs_P-D of FT:mat_peptide HM358333_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6MH). Partial genome (Contains: LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=226 residues).
MENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDFQGMLLVCPIIPGSLTNSTGPCRTCTTPAQGTSMHPFCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWFWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358334_SHBs_P-D Product feature CHAIN HM358334_SHBs_P-D of FT:mat_peptide HM358334_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 111). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358335_SHBs_P-D Product feature CHAIN HM358335_SHBs_P-D of FT:mat_peptide HM358335_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358336_SHBs_P-D Product feature CHAIN HM358336_SHBs_P-D of FT:mat_peptide HM358336_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate J). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358337_SHBs_P-D Product feature CHAIN HM358337_SHBs_P-D of FT:mat_peptide HM358337_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate b). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358338_SHBs_P-D Product feature CHAIN HM358338_SHBs_P-D of FT:mat_peptide HM358338_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate G). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM358339_SHBs_P-D Product feature CHAIN HM358339_SHBs_P-D of FT:mat_peptide HM358339_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM439434_SHBs_P-D Product feature CHAIN HM439434_SHBs_P-D of FT:mat_peptide HM439434_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMMWYWGPSLYRILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750151_SHBs_P-D Product feature CHAIN HM750151_SHBs_P-D of FT:mat_peptide HM750151_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSD-8). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750152_SHBs_P-D Product feature CHAIN HM750152_SHBs_P-D of FT:mat_peptide HM750152_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate QHN-99). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750153_SHBs_P-D Product feature CHAIN HM750153_SHBs_P-D of FT:mat_peptide HM750153_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJW-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750154_SHBs_P-D Product feature CHAIN HM750154_SHBs_P-D of FT:mat_peptide HM750154_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XGW-23). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYRGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750155_SHBs_P-D Product feature CHAIN HM750155_SHBs_P-D of FT:mat_peptide HM750155_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-1). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPRLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HM750156_SHBs_P-D Product feature CHAIN HM750156_SHBs_P-D of FT:mat_peptide HM750156_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-12). Complete genome. [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ008866_SHBs_P-D Product feature CHAIN HQ008866_SHBs_P-D of FT:mat_peptide HQ008866_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 26). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ008867_SHBs_P-D Product feature CHAIN HQ008867_SHBs_P-D of FT:mat_peptide HQ008867_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 30). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ008868_SHBs_P-D Product feature CHAIN HQ008868_SHBs_P-D of FT:mat_peptide HQ008868_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 31). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185213_SHBs_P-D Product feature CHAIN HQ185213_SHBs_P-D of FT:mat_peptide HQ185213_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6556). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLSTRILTIPKSLDSWRTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGASTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSLLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185214_SHBs_P-D Product feature CHAIN HQ185214_SHBs_P-D of FT:mat_peptide HQ185214_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5991). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGFLGPLLVLQAGFFLSTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYRILSPSLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185215_SHBs_P-D Product feature CHAIN HQ185215_SHBs_P-D of FT:mat_peptide HQ185215_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6572). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPTFFCLWVYI
>gnl|hbvpro|HQ185216_SHBs_P-D Product feature CHAIN HQ185216_SHBs_P-D of FT:mat_peptide HQ185216_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5663). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGPQGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFPGGTTVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSSNTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSRFLPLLLIFFCLWVYI
>gnl|hbvpro|HQ185217_SHBs_P-D Product feature CHAIN HQ185217_SHBs_P-D of FT:mat_peptide HQ185217_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6924). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESTASGPLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFPGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYKGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWAPSLYSILSRSLPLLLIFFCLWVYI
>gnl|hbvpro|HQ185218_SHBs_P-D Product feature CHAIN HQ185218_SHBs_P-D of FT:mat_peptide HQ185218_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6624). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSDHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185219_SHBs_P-D Product feature CHAIN HQ185219_SHBs_P-D of FT:mat_peptide HQ185219_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5944). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185220_SHBs_P-D Product feature CHAIN HQ185220_SHBs_P-D of FT:mat_peptide HQ185220_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6625). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENISSGFLGPLPVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWVWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185221_SHBs_P-D Product feature CHAIN HQ185221_SHBs_P-D of FT:mat_peptide HQ185221_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6509). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWERASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185222_SHBs_P-D Product feature CHAIN HQ185222_SHBs_P-D of FT:mat_peptide HQ185222_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6662). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185223_SHBs_P-D Product feature CHAIN HQ185223_SHBs_P-D of FT:mat_peptide HQ185223_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6685). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLLVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185224_SHBs_P-D Product feature CHAIN HQ185224_SHBs_P-D of FT:mat_peptide HQ185224_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6819). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGRNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185225_SHBs_P-D Product feature CHAIN HQ185225_SHBs_P-D of FT:mat_peptide HQ185225_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5119). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MESITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGASTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSLLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185226_SHBs_P-D Product feature CHAIN HQ185226_SHBs_P-D of FT:mat_peptide HQ185226_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5851). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGFSTTSVGTCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>gnl|hbvpro|HQ185227_SHBs_P-D Product feature CHAIN HQ185227_SHBs_P-D of FT:mat_peptide HQ185227_SHBs_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5229). Partial genome (Contains: LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=226 residues).
MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
IIFLFILLLCLIFLLVLLDYHGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGK
FLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
>