HBVdb

Dataset for protein HBc of genotype E

[Download (right click)] [Alignment] [Repertoires]

521 sequence(s)

>gnl|hbvpro|AB091255_HBc_P-E Product feature CHAIN AB091255_HBc_P-E of FT:mat_peptide AB091255_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-129). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB091256_HBc_P-E Product feature CHAIN AB091256_HBc_P-E of FT:mat_peptide AB091256_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-212). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB106564_HBc_C-E Product feature CHAIN AB106564_HBc_C-E of FT:mat_peptide AB106564_HBc_C-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA325). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVWIPTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB194947_HBc_P-E Product feature CHAIN AB194947_HBc_P-E of FT:mat_peptide AB194947_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR954). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB194948_HBc_P-E Product feature CHAIN AB194948_HBc_P-E of FT:mat_peptide AB194948_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR936). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVDLLSFLPADFFPSVRDLLDTASALYRDALESHEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB201287_HBc_P-E Product feature CHAIN AB201287_HBc_P-E of FT:mat_peptide AB201287_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin11). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB201288_HBc_P-E Product feature CHAIN AB201288_HBc_P-E of FT:mat_peptide AB201288_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin89). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB201289_HBc_P-E Product feature CHAIN AB201289_HBc_P-E of FT:mat_peptide AB201289_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin269). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB201290_HBc_P-E Product feature CHAIN AB201290_HBc_P-E of FT:mat_peptide AB201290_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin293). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQVILCWGDLMTLATWVGVNLDDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205129_HBc_P-E Product feature CHAIN AB205129_HBc_P-E of FT:mat_peptide AB205129_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758-2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205188_HBc_P-E Product feature CHAIN AB205188_HBc_P-E of FT:mat_peptide AB205188_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA283). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLGTWVGGNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPIVSTLPENTVVRRRSRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205189_HBc_P-E Product feature CHAIN AB205189_HBc_P-E of FT:mat_peptide AB205189_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G138). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205190_HBc_P-E Product feature CHAIN AB205190_HBc_P-E of FT:mat_peptide AB205190_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G123). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205191_HBc_P-E Product feature CHAIN AB205191_HBc_P-E of FT:mat_peptide AB205191_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G166). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205192_HBc_P-E Product feature CHAIN AB205192_HBc_P-E of FT:mat_peptide AB205192_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB219529_HBc_P-E Product feature CHAIN AB219529_HBc_P-E of FT:mat_peptide AB219529_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate UK1). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATLQLLSFLPGDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQVILCWGDLMNLATWVGGNLQDPA
SRDLVVNYVNINMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB219533_HBc_P-E Product feature CHAIN AB219533_HBc_P-E of FT:mat_peptide AB219533_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate UK5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESSQHCSPHHTALRQAILCWGDIMTIATWVGVNLQDQE
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB219534_HBc_P-E Product feature CHAIN AB219534_HBc_P-E of FT:mat_peptide AB219534_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate UK6). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMSLATWVGANLQDPA
SRDQVVTYVNTNMGTKFRQLLWFHISCITFGREIVVEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRCGGRTSRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|AB274969_HBc_P-E Product feature CHAIN AB274969_HBc_P-E of FT:mat_peptide AB274969_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274970_HBc_P-E Product feature CHAIN AB274970_HBc_P-E of FT:mat_peptide AB274970_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274971_HBc_P-E Product feature CHAIN AB274971_HBc_P-E of FT:mat_peptide AB274971_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274972_HBc_P-E Product feature CHAIN AB274972_HBc_P-E of FT:mat_peptide AB274972_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALREAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274973_HBc_P-E Product feature CHAIN AB274973_HBc_P-E of FT:mat_peptide AB274973_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274974_HBc_P-E Product feature CHAIN AB274974_HBc_P-E of FT:mat_peptide AB274974_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274975_HBc_P-E Product feature CHAIN AB274975_HBc_P-E of FT:mat_peptide AB274975_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPVDFYPSVRDLLDTASALFRDALQSPEHCSPHHTALRQAILCWGDVMNLATWVGANLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSKSPSRRRSQSPASQC
>gnl|hbvpro|AB274976_HBc_P-E Product feature CHAIN AB274976_HBc_P-E of FT:mat_peptide AB274976_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPQHCSPHHTALRQAILCWGELMTLATWVGVNLEDPS
SRDLVVGYVNSNMGLKFRQLLWFHISCLTFGREIVLEFLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274977_HBc_P-E Product feature CHAIN AB274977_HBc_P-E of FT:mat_peptide AB274977_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNNNMGLKFRQLLWFHTSCITFGRDIVLEYLVSFGVWIRTPPPYRPANAPILSTLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274978_HBc_P-E Product feature CHAIN AB274978_HBc_P-E of FT:mat_peptide AB274978_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274979_HBc_P-E Product feature CHAIN AB274979_HBc_P-E of FT:mat_peptide AB274979_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPGEFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPS
SRDLVVSYVNDNMGLKFRQLLWFHISCLTFGRDVVLEFLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274980_HBc_P-E Product feature CHAIN AB274980_HBc_P-E of FT:mat_peptide AB274980_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFXPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGENLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274981_HBc_P-E Product feature CHAIN AB274981_HBc_P-E of FT:mat_peptide AB274981_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPLNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274982_HBc_P-E Product feature CHAIN AB274982_HBc_P-E of FT:mat_peptide AB274982_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHSSPHHTALRQAILCWGDLMSLATWVGANLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274984_HBc_P-E Product feature CHAIN AB274984_HBc_P-E of FT:mat_peptide AB274984_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFYPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|AB274985_HBc_P-E Product feature CHAIN AB274985_HBc_P-E of FT:mat_peptide AB274985_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASHC
>gnl|hbvpro|AB915175_HBc_P-E Product feature CHAIN AB915175_HBc_P-E of FT:mat_peptide AB915175_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB915178_HBc_P-E Product feature CHAIN AB915178_HBc_P-E of FT:mat_peptide AB915178_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDAIESPEHCSPHHTALRQAIICWGDLMSLATWVGENLQDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPLNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB915180_HBc_P-E Product feature CHAIN AB915180_HBc_P-E of FT:mat_peptide AB915180_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA6). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALFRDALESSEHCSPHHTALRQAVLCWGDIMNIATWVGANLEDPA
SRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSRGAQC
>gnl|hbvpro|AF350099_HBc_P-E Product feature CHAIN AF350099_HBc_P-E of FT:mat_peptide AF350099_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4102). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350100_HBc_P-E Product feature CHAIN AF350100_HBc_P-E of FT:mat_peptide AF350100_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350101_HBc_P-E Product feature CHAIN AF350101_HBc_P-E of FT:mat_peptide AF350101_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4527). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETAIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350102_HBc_P-E Product feature CHAIN AF350102_HBc_P-E of FT:mat_peptide AF350102_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4537). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350103_HBc_P-E Product feature CHAIN AF350103_HBc_P-E of FT:mat_peptide AF350103_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4531). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350104_HBc_P-E Product feature CHAIN AF350104_HBc_P-E of FT:mat_peptide AF350104_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4579). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350105_HBc_P-E Product feature CHAIN AF350105_HBc_P-E of FT:mat_peptide AF350105_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4550). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHRSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SKDLVVSYANTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350106_HBc_P-E Product feature CHAIN AF350106_HBc_P-E of FT:mat_peptide AF350106_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4607). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350107_HBc_P-E Product feature CHAIN AF350107_HBc_P-E of FT:mat_peptide AF350107_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4625). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPNHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350108_HBc_P-E Product feature CHAIN AF350108_HBc_P-E of FT:mat_peptide AF350108_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4628). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350109_HBc_P-E Product feature CHAIN AF350109_HBc_P-E of FT:mat_peptide AF350109_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4640). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREPVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350110_HBc_P-E Product feature CHAIN AF350110_HBc_P-E of FT:mat_peptide AF350110_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4644). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350111_HBc_P-E Product feature CHAIN AF350111_HBc_P-E of FT:mat_peptide AF350111_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4539). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVRRRGRPPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350112_HBc_P-E Product feature CHAIN AF350112_HBc_P-E of FT:mat_peptide AF350112_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4618). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVEILSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350113_HBc_P-E Product feature CHAIN AF350113_HBc_P-E of FT:mat_peptide AF350113_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4690). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350114_HBc_P-E Product feature CHAIN AF350114_HBc_P-E of FT:mat_peptide AF350114_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4697). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVCIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350115_HBc_P-E Product feature CHAIN AF350115_HBc_P-E of FT:mat_peptide AF350115_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1001F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350116_HBc_P-E Product feature CHAIN AF350116_HBc_P-E of FT:mat_peptide AF350116_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1002F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350117_HBc_P-E Product feature CHAIN AF350117_HBc_P-E of FT:mat_peptide AF350117_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1003F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHGSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350118_HBc_P-E Product feature CHAIN AF350118_HBc_P-E of FT:mat_peptide AF350118_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1011F5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350119_HBc_P-E Product feature CHAIN AF350119_HBc_P-E of FT:mat_peptide AF350119_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1013F5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350120_HBc_P-E Product feature CHAIN AF350120_HBc_P-E of FT:mat_peptide AF350120_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1073F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350121_HBc_P-E Product feature CHAIN AF350121_HBc_P-E of FT:mat_peptide AF350121_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1074F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350122_HBc_P-E Product feature CHAIN AF350122_HBc_P-E of FT:mat_peptide AF350122_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1076F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350123_HBc_P-E Product feature CHAIN AF350123_HBc_P-E of FT:mat_peptide AF350123_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1081F20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSRHHIALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350124_HBc_P-E Product feature CHAIN AF350124_HBc_P-E of FT:mat_peptide AF350124_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1099F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350125_HBc_P-E Product feature CHAIN AF350125_HBc_P-E of FT:mat_peptide AF350125_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1100F20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350126_HBc_P-E Product feature CHAIN AF350126_HBc_P-E of FT:mat_peptide AF350126_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350127_HBc_P-E Product feature CHAIN AF350127_HBc_P-E of FT:mat_peptide AF350127_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1119F29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350128_HBc_P-E Product feature CHAIN AF350128_HBc_P-E of FT:mat_peptide AF350128_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1121F29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350130_HBc_P-E Product feature CHAIN AF350130_HBc_P-E of FT:mat_peptide AF350130_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1127F28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350131_HBc_P-E Product feature CHAIN AF350131_HBc_P-E of FT:mat_peptide AF350131_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1129). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWISTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350132_HBc_P-E Product feature CHAIN AF350132_HBc_P-E of FT:mat_peptide AF350132_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1131F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350133_HBc_P-E Product feature CHAIN AF350133_HBc_P-E of FT:mat_peptide AF350133_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1132F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350134_HBc_P-E Product feature CHAIN AF350134_HBc_P-E of FT:mat_peptide AF350134_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1135F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350135_HBc_P-E Product feature CHAIN AF350135_HBc_P-E of FT:mat_peptide AF350135_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1136F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENIVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350136_HBc_P-E Product feature CHAIN AF350136_HBc_P-E of FT:mat_peptide AF350136_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1139). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350137_HBc_P-E Product feature CHAIN AF350137_HBc_P-E of FT:mat_peptide AF350137_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1142F33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350138_HBc_P-E Product feature CHAIN AF350138_HBc_P-E of FT:mat_peptide AF350138_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1143F33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350139_HBc_P-E Product feature CHAIN AF350139_HBc_P-E of FT:mat_peptide AF350139_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1145F33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350140_HBc_P-E Product feature CHAIN AF350140_HBc_P-E of FT:mat_peptide AF350140_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1149F34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350141_HBc_P-E Product feature CHAIN AF350141_HBc_P-E of FT:mat_peptide AF350141_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1152F34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350142_HBc_P-E Product feature CHAIN AF350142_HBc_P-E of FT:mat_peptide AF350142_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1157F35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350143_HBc_P-E Product feature CHAIN AF350143_HBc_P-E of FT:mat_peptide AF350143_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1158F35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350144_HBc_P-E Product feature CHAIN AF350144_HBc_P-E of FT:mat_peptide AF350144_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1159F36). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLGTWVGGNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350145_HBc_P-E Product feature CHAIN AF350145_HBc_P-E of FT:mat_peptide AF350145_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1162F36). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350146_HBc_P-E Product feature CHAIN AF350146_HBc_P-E of FT:mat_peptide AF350146_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1167). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPYHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350147_HBc_P-E Product feature CHAIN AF350147_HBc_P-E of FT:mat_peptide AF350147_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1175F40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350148_HBc_P-E Product feature CHAIN AF350148_HBc_P-E of FT:mat_peptide AF350148_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1179F42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350149_HBc_P-E Product feature CHAIN AF350149_HBc_P-E of FT:mat_peptide AF350149_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1181F41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350150_HBc_P-E Product feature CHAIN AF350150_HBc_P-E of FT:mat_peptide AF350150_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1182F41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350151_HBc_P-E Product feature CHAIN AF350151_HBc_P-E of FT:mat_peptide AF350151_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1184F41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350152_HBc_P-E Product feature CHAIN AF350152_HBc_P-E of FT:mat_peptide AF350152_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1187F42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350153_HBc_P-E Product feature CHAIN AF350153_HBc_P-E of FT:mat_peptide AF350153_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1194). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTIGRETVIEYLVSFGVWIRTPPAYRPPNAPISSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350154_HBc_P-E Product feature CHAIN AF350154_HBc_P-E of FT:mat_peptide AF350154_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1208). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVESLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350155_HBc_P-E Product feature CHAIN AF350155_HBc_P-E of FT:mat_peptide AF350155_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1211). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350156_HBc_P-E Product feature CHAIN AF350156_HBc_P-E of FT:mat_peptide AF350156_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1246F53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350157_HBc_P-E Product feature CHAIN AF350157_HBc_P-E of FT:mat_peptide AF350157_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1247F53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350158_HBc_P-E Product feature CHAIN AF350158_HBc_P-E of FT:mat_peptide AF350158_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1249F53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRST
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350159_HBc_P-E Product feature CHAIN AF350159_HBc_P-E of FT:mat_peptide AF350159_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1285). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350160_HBc_P-E Product feature CHAIN AF350160_HBc_P-E of FT:mat_peptide AF350160_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1288F61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350161_HBc_P-E Product feature CHAIN AF350161_HBc_P-E of FT:mat_peptide AF350161_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1307). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALKQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350162_HBc_P-E Product feature CHAIN AF350162_HBc_P-E of FT:mat_peptide AF350162_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1325F81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350163_HBc_P-E Product feature CHAIN AF350163_HBc_P-E of FT:mat_peptide AF350163_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1326F81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350164_HBc_P-E Product feature CHAIN AF350164_HBc_P-E of FT:mat_peptide AF350164_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1327F81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYSVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350165_HBc_P-E Product feature CHAIN AF350165_HBc_P-E of FT:mat_peptide AF350165_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1328F82). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350166_HBc_P-E Product feature CHAIN AF350166_HBc_P-E of FT:mat_peptide AF350166_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1331). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350167_HBc_P-E Product feature CHAIN AF350167_HBc_P-E of FT:mat_peptide AF350167_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1348F82). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRGRRSQSRESQC
>gnl|hbvpro|AF350168_HBc_P-E Product feature CHAIN AF350168_HBc_P-E of FT:mat_peptide AF350168_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1349F90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDSYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPS
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350169_HBc_P-E Product feature CHAIN AF350169_HBc_P-E of FT:mat_peptide AF350169_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1352F90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350170_HBc_P-E Product feature CHAIN AF350170_HBc_P-E of FT:mat_peptide AF350170_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1353F89). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350171_HBc_P-E Product feature CHAIN AF350171_HBc_P-E of FT:mat_peptide AF350171_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1374). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350172_HBc_P-E Product feature CHAIN AF350172_HBc_P-E of FT:mat_peptide AF350172_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1376). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350173_HBc_P-E Product feature CHAIN AF350173_HBc_P-E of FT:mat_peptide AF350173_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1442). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSRRRRRSQSRESQC
>gnl|hbvpro|AF350174_HBc_P-E Product feature CHAIN AF350174_HBc_P-E of FT:mat_peptide AF350174_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1444). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350175_HBc_P-E Product feature CHAIN AF350175_HBc_P-E of FT:mat_peptide AF350175_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1453). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAIVCWGDIMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350176_HBc_P-E Product feature CHAIN AF350176_HBc_P-E of FT:mat_peptide AF350176_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1456). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350177_HBc_P-E Product feature CHAIN AF350177_HBc_P-E of FT:mat_peptide AF350177_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1461). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350178_HBc_P-E Product feature CHAIN AF350178_HBc_P-E of FT:mat_peptide AF350178_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1482F89). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350179_HBc_P-E Product feature CHAIN AF350179_HBc_P-E of FT:mat_peptide AF350179_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1520). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350180_HBc_P-E Product feature CHAIN AF350180_HBc_P-E of FT:mat_peptide AF350180_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1522F137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
PRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350181_HBc_P-E Product feature CHAIN AF350181_HBc_P-E of FT:mat_peptide AF350181_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1524F137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350182_HBc_P-E Product feature CHAIN AF350182_HBc_P-E of FT:mat_peptide AF350182_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1525F137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350183_HBc_P-E Product feature CHAIN AF350183_HBc_P-E of FT:mat_peptide AF350183_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1535). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350184_HBc_P-E Product feature CHAIN AF350184_HBc_P-E of FT:mat_peptide AF350184_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1540). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRHAVLCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350185_HBc_P-E Product feature CHAIN AF350185_HBc_P-E of FT:mat_peptide AF350185_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1557F61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350186_HBc_P-E Product feature CHAIN AF350186_HBc_P-E of FT:mat_peptide AF350186_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1560). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350187_HBc_P-E Product feature CHAIN AF350187_HBc_P-E of FT:mat_peptide AF350187_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1577). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTAIRQAILCWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQFLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350188_HBc_P-E Product feature CHAIN AF350188_HBc_P-E of FT:mat_peptide AF350188_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1590). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRIRSQSRESQC
>gnl|hbvpro|AF350189_HBc_P-E Product feature CHAIN AF350189_HBc_P-E of FT:mat_peptide AF350189_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1594). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350190_HBc_P-E Product feature CHAIN AF350190_HBc_P-E of FT:mat_peptide AF350190_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1615). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350191_HBc_P-E Product feature CHAIN AF350191_HBc_P-E of FT:mat_peptide AF350191_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1654F172). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350192_HBc_P-E Product feature CHAIN AF350192_HBc_P-E of FT:mat_peptide AF350192_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1660F173). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350193_HBc_P-E Product feature CHAIN AF350193_HBc_P-E of FT:mat_peptide AF350193_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1664F174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350194_HBc_P-E Product feature CHAIN AF350194_HBc_P-E of FT:mat_peptide AF350194_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1665F174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350195_HBc_P-E Product feature CHAIN AF350195_HBc_P-E of FT:mat_peptide AF350195_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1670F172). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350196_HBc_P-E Product feature CHAIN AF350196_HBc_P-E of FT:mat_peptide AF350196_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1676F174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350197_HBc_P-E Product feature CHAIN AF350197_HBc_P-E of FT:mat_peptide AF350197_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1678). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350198_HBc_P-E Product feature CHAIN AF350198_HBc_P-E of FT:mat_peptide AF350198_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1682). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350199_HBc_P-E Product feature CHAIN AF350199_HBc_P-E of FT:mat_peptide AF350199_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1691). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350200_HBc_P-E Product feature CHAIN AF350200_HBc_P-E of FT:mat_peptide AF350200_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1713). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350201_HBc_P-E Product feature CHAIN AF350201_HBc_P-E of FT:mat_peptide AF350201_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1720). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350202_HBc_P-E Product feature CHAIN AF350202_HBc_P-E of FT:mat_peptide AF350202_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1722). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350203_HBc_P-E Product feature CHAIN AF350203_HBc_P-E of FT:mat_peptide AF350203_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1729F202). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350204_HBc_P-E Product feature CHAIN AF350204_HBc_P-E of FT:mat_peptide AF350204_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1741F173). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350205_HBc_P-E Product feature CHAIN AF350205_HBc_P-E of FT:mat_peptide AF350205_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1821F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350206_HBc_P-E Product feature CHAIN AF350206_HBc_P-E of FT:mat_peptide AF350206_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1822F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCVTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350207_HBc_P-E Product feature CHAIN AF350207_HBc_P-E of FT:mat_peptide AF350207_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1824F218). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLITLSTWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350208_HBc_P-E Product feature CHAIN AF350208_HBc_P-E of FT:mat_peptide AF350208_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1825F218). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPPNAPILSSLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350209_HBc_P-E Product feature CHAIN AF350209_HBc_P-E of FT:mat_peptide AF350209_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1827F218). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350210_HBc_P-E Product feature CHAIN AF350210_HBc_P-E of FT:mat_peptide AF350210_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1828F219). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350211_HBc_P-E Product feature CHAIN AF350211_HBc_P-E of FT:mat_peptide AF350211_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1831F219). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPQHHSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRN
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350212_HBc_P-E Product feature CHAIN AF350212_HBc_P-E of FT:mat_peptide AF350212_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1833F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350213_HBc_P-E Product feature CHAIN AF350213_HBc_P-E of FT:mat_peptide AF350213_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1834F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350214_HBc_P-E Product feature CHAIN AF350214_HBc_P-E of FT:mat_peptide AF350214_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1842). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350215_HBc_P-E Product feature CHAIN AF350215_HBc_P-E of FT:mat_peptide AF350215_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1847). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFWPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350216_HBc_P-E Product feature CHAIN AF350216_HBc_P-E of FT:mat_peptide AF350216_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1862F231). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350217_HBc_P-E Product feature CHAIN AF350217_HBc_P-E of FT:mat_peptide AF350217_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1863F231). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350218_HBc_P-E Product feature CHAIN AF350218_HBc_P-E of FT:mat_peptide AF350218_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1872). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350219_HBc_P-E Product feature CHAIN AF350219_HBc_P-E of FT:mat_peptide AF350219_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1874F238). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTIATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350220_HBc_P-E Product feature CHAIN AF350220_HBc_P-E of FT:mat_peptide AF350220_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1876F238). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTIATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM494689_HBc_P-E Product feature CHAIN AM494689_HBc_P-E of FT:mat_peptide AM494689_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR006). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494690_HBc_P-E Product feature CHAIN AM494690_HBc_P-E of FT:mat_peptide AM494690_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR008). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494691_HBc_P-E Product feature CHAIN AM494691_HBc_P-E of FT:mat_peptide AM494691_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR024). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|AM494692_HBc_P-E Product feature CHAIN AM494692_HBc_P-E of FT:mat_peptide AM494692_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR026). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTALALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494693_HBc_P-E Product feature CHAIN AM494693_HBc_P-E of FT:mat_peptide AM494693_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR039). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494694_HBc_P-E Product feature CHAIN AM494694_HBc_P-E of FT:mat_peptide AM494694_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR047). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494695_HBc_P-E Product feature CHAIN AM494695_HBc_P-E of FT:mat_peptide AM494695_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR053). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRHRGRSTRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494696_HBc_P-E Product feature CHAIN AM494696_HBc_P-E of FT:mat_peptide AM494696_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR060). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494697_HBc_P-E Product feature CHAIN AM494697_HBc_P-E of FT:mat_peptide AM494697_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR063). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494698_HBc_P-E Product feature CHAIN AM494698_HBc_P-E of FT:mat_peptide AM494698_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR066). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494699_HBc_P-E Product feature CHAIN AM494699_HBc_P-E of FT:mat_peptide AM494699_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR082). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494700_HBc_P-E Product feature CHAIN AM494700_HBc_P-E of FT:mat_peptide AM494700_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR083). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494701_HBc_P-E Product feature CHAIN AM494701_HBc_P-E of FT:mat_peptide AM494701_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR097). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494702_HBc_P-E Product feature CHAIN AM494702_HBc_P-E of FT:mat_peptide AM494702_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR106). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494703_HBc_P-E Product feature CHAIN AM494703_HBc_P-E of FT:mat_peptide AM494703_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR107). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMTLATWVGVNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPKRRT
PSPRRRRSQSPRRRRSQSPSSQC
>gnl|hbvpro|AM494704_HBc_P-E Product feature CHAIN AM494704_HBc_P-E of FT:mat_peptide AM494704_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR112). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494705_HBc_P-E Product feature CHAIN AM494705_HBc_P-E of FT:mat_peptide AM494705_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR115). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494706_HBc_P-E Product feature CHAIN AM494706_HBc_P-E of FT:mat_peptide AM494706_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR131). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494707_HBc_P-E Product feature CHAIN AM494707_HBc_P-E of FT:mat_peptide AM494707_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR137). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494708_HBc_P-E Product feature CHAIN AM494708_HBc_P-E of FT:mat_peptide AM494708_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494709_HBc_P-E Product feature CHAIN AM494709_HBc_P-E of FT:mat_peptide AM494709_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR143). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494710_HBc_P-E Product feature CHAIN AM494710_HBc_P-E of FT:mat_peptide AM494710_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR144). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494711_HBc_P-E Product feature CHAIN AM494711_HBc_P-E of FT:mat_peptide AM494711_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR146). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494712_HBc_P-E Product feature CHAIN AM494712_HBc_P-E of FT:mat_peptide AM494712_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR150). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494713_HBc_P-E Product feature CHAIN AM494713_HBc_P-E of FT:mat_peptide AM494713_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR154). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494714_HBc_P-E Product feature CHAIN AM494714_HBc_P-E of FT:mat_peptide AM494714_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR165). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPSSQC
>gnl|hbvpro|AM494715_HBc_P-E Product feature CHAIN AM494715_HBc_P-E of FT:mat_peptide AM494715_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR171). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494717_HBc_P-E Product feature CHAIN AM494717_HBc_P-E of FT:mat_peptide AM494717_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR187). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494786_HBc_P-E Product feature CHAIN AM494786_HBc_P-E of FT:mat_peptide AM494786_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR081). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGANLQDPA
SRDQVVSYVNTTAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494787_HBc_P-E Product feature CHAIN AM494787_HBc_P-E of FT:mat_peptide AM494787_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR087). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTALALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494788_HBc_P-E Product feature CHAIN AM494788_HBc_P-E of FT:mat_peptide AM494788_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR145). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494789_HBc_P-E Product feature CHAIN AM494789_HBc_P-E of FT:mat_peptide AM494789_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR198). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494790_HBc_P-E Product feature CHAIN AM494790_HBc_P-E of FT:mat_peptide AM494790_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR234). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494791_HBc_P-E Product feature CHAIN AM494791_HBc_P-E of FT:mat_peptide AM494791_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR001-1). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHWSPHHSAIRQAILCWGELMTLATWVGVKLEDPA
SRDLVVSYVNTNLGLKFQQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPENTVVRRRGRSPRRRT
SSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|AM494792_HBc_P-E Product feature CHAIN AM494792_HBc_P-E of FT:mat_peptide AM494792_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR001-2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALKSPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494793_HBc_P-E Product feature CHAIN AM494793_HBc_P-E of FT:mat_peptide AM494793_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR001-3). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDAVESPEHWSPHHSAIRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNLGLQFQQLLGFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPENTVVRRRGRSPRRRT
SSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|AM494794_HBc_P-E Product feature CHAIN AM494794_HBc_P-E of FT:mat_peptide AM494794_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR039-1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHYTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRFQSPRRRRSQSPASQC
>gnl|hbvpro|AM494795_HBc_P-E Product feature CHAIN AM494795_HBc_P-E of FT:mat_peptide AM494795_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR039-2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494796_HBc_P-E Product feature CHAIN AM494796_HBc_P-E of FT:mat_peptide AM494796_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR067-1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLSENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494797_HBc_P-E Product feature CHAIN AM494797_HBc_P-E of FT:mat_peptide AM494797_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR067-2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPAVRDLLDTASALYRDALESPEPCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFGQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494798_HBc_P-E Product feature CHAIN AM494798_HBc_P-E of FT:mat_peptide AM494798_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR106-1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494799_HBc_P-E Product feature CHAIN AM494799_HBc_P-E of FT:mat_peptide AM494799_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR106-2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494800_HBc_P-E Product feature CHAIN AM494800_HBc_P-E of FT:mat_peptide AM494800_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR107). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMTLATWVGVNLEGPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPSSQC
>gnl|hbvpro|AM494801_HBc_P-E Product feature CHAIN AM494801_HBc_P-E of FT:mat_peptide AM494801_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR115). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494802_HBc_P-E Product feature CHAIN AM494802_HBc_P-E of FT:mat_peptide AM494802_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138-1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494803_HBc_P-E Product feature CHAIN AM494803_HBc_P-E of FT:mat_peptide AM494803_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138-2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKYRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494804_HBc_P-E Product feature CHAIN AM494804_HBc_P-E of FT:mat_peptide AM494804_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138-3). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494805_HBc_P-E Product feature CHAIN AM494805_HBc_P-E of FT:mat_peptide AM494805_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138-4). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494806_HBc_P-E Product feature CHAIN AM494806_HBc_P-E of FT:mat_peptide AM494806_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138-5). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRYQSPASQC
>gnl|hbvpro|AM494807_HBc_P-E Product feature CHAIN AM494807_HBc_P-E of FT:mat_peptide AM494807_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138-6). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPLRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494808_HBc_P-E Product feature CHAIN AM494808_HBc_P-E of FT:mat_peptide AM494808_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR175-1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM494809_HBc_P-E Product feature CHAIN AM494809_HBc_P-E of FT:mat_peptide AM494809_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR175-2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM494810_HBc_P-E Product feature CHAIN AM494810_HBc_P-E of FT:mat_peptide AM494810_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR175-3). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM494811_HBc_P-E Product feature CHAIN AM494811_HBc_P-E of FT:mat_peptide AM494811_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR177-1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDVDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM494812_HBc_P-E Product feature CHAIN AM494812_HBc_P-E of FT:mat_peptide AM494812_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR177-2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY269055_HBc_P-E Product feature CHAIN AY269055_HBc_P-E of FT:mat_peptide AY269055_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 2483). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSSHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738144_HBc_P-E Product feature CHAIN AY738144_HBc_P-E of FT:mat_peptide AY738144_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY738145_HBc_C-E Product feature CHAIN AY738145_HBc_C-E of FT:mat_peptide AY738145_HBc_C-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY738146_HBc_P-E Product feature CHAIN AY738146_HBc_P-E of FT:mat_peptide AY738146_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY738147_HBc_P-E Product feature CHAIN AY738147_HBc_P-E of FT:mat_peptide AY738147_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 10/98). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY739674_HBc_P-E Product feature CHAIN AY739674_HBc_P-E of FT:mat_peptide AY739674_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY739675_HBc_P-E Product feature CHAIN AY739675_HBc_P-E of FT:mat_peptide AY739675_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY935700_HBc_P-E Product feature CHAIN AY935700_HBc_P-E of FT:mat_peptide AY935700_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate TH-HBV-012). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMSLATWVGVNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060822_HBc_P-E Product feature CHAIN DQ060822_HBc_P-E of FT:mat_peptide DQ060822_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8510-91). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060823_HBc_P-E Product feature CHAIN DQ060823_HBc_P-E of FT:mat_peptide DQ060823_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8504-91). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060824_HBc_P-E Product feature CHAIN DQ060824_HBc_P-E of FT:mat_peptide DQ060824_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0121-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060825_HBc_P-E Product feature CHAIN DQ060825_HBc_P-E of FT:mat_peptide DQ060825_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0262-09). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060826_HBc_P-E Product feature CHAIN DQ060826_HBc_P-E of FT:mat_peptide DQ060826_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0433-20). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060827_HBc_P-E Product feature CHAIN DQ060827_HBc_P-E of FT:mat_peptide DQ060827_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0317-04). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060828_HBc_P-E Product feature CHAIN DQ060828_HBc_P-E of FT:mat_peptide DQ060828_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0443-03). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060829_HBc_P-E Product feature CHAIN DQ060829_HBc_P-E of FT:mat_peptide DQ060829_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0350-03). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060830_HBc_P-E Product feature CHAIN DQ060830_HBc_P-E of FT:mat_peptide DQ060830_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 235-01). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239217_HBc_P-E Product feature CHAIN EU239217_HBc_P-E of FT:mat_peptide EU239217_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate G2451). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLGFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239218_HBc_P-E Product feature CHAIN EU239218_HBc_P-E of FT:mat_peptide EU239218_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BD2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239219_HBc_P-E Product feature CHAIN EU239219_HBc_P-E of FT:mat_peptide EU239219_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239220_HBc_P-E Product feature CHAIN EU239220_HBc_P-E of FT:mat_peptide EU239220_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTATALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNDNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239221_HBc_P-E Product feature CHAIN EU239221_HBc_P-E of FT:mat_peptide EU239221_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239222_HBc_P-E Product feature CHAIN EU239222_HBc_P-E of FT:mat_peptide EU239222_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239223_HBc_P-E Product feature CHAIN EU239223_HBc_P-E of FT:mat_peptide EU239223_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDIMTIATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239224_HBc_P-E Product feature CHAIN EU239224_HBc_P-E of FT:mat_peptide EU239224_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BD1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRTQSPRRRRSQSPASQC
>gnl|hbvpro|EU239226_HBc_P-E Product feature CHAIN EU239226_HBc_P-E of FT:mat_peptide EU239226_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU620071_HBc_P-E Product feature CHAIN EU620071_HBc_P-E of FT:mat_peptide EU620071_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Irish-16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU726883_HBc_P-E Product feature CHAIN EU726883_HBc_P-E of FT:mat_peptide EU726883_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IR-RCGLD-7064). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDAYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPI
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU726953_HBc_P-E Product feature CHAIN EU726953_HBc_P-E of FT:mat_peptide EU726953_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IR-RCGLD-3551). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVQLLSFLPSDFFPSIRDLLDTAAALYRDALESPEHCSAHHTALRQAILCWGDLMSLATWVGGNLEDPV
SRELVIGYVNTTVGLKFRQLLWFHISCLMFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|FJ349226_HBc_P-E Product feature CHAIN FJ349226_HBc_P-E of FT:mat_peptide FJ349226_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate H6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPS
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ349237_HBc_P-E Product feature CHAIN FJ349237_HBc_P-E of FT:mat_peptide FJ349237_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C27). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ349238_HBc_P-E Product feature CHAIN FJ349238_HBc_P-E of FT:mat_peptide FJ349238_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C65). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ349239_HBc_P-E Product feature CHAIN FJ349239_HBc_P-E of FT:mat_peptide FJ349239_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C74). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ349240_HBc_P-E Product feature CHAIN FJ349240_HBc_P-E of FT:mat_peptide FJ349240_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C89). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTAKALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNINVGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN545821_HBc_P-E Product feature CHAIN FN545821_HBc_P-E of FT:mat_peptide FN545821_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGENLQDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN545822_HBc_P-E Product feature CHAIN FN545822_HBc_P-E of FT:mat_peptide FN545822_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN545823_HBc_P-E Product feature CHAIN FN545823_HBc_P-E of FT:mat_peptide FN545823_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVXDLLDTASALFRDALESPEHCSPHHTALRQAILCWGXLXXLATWVGVNLEDPA
SRDXVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPQNAPILSTLPEXAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPAAQC
>gnl|hbvpro|FN545827_HBc_P-E Product feature CHAIN FN545827_HBc_P-E of FT:mat_peptide FN545827_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVXDLLDTASALYRDALESPEHCSPHHTALRQAXLCWGDLMNLATWVGVNLEDPA
SRDLVVSYVNTXVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPXAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN545841_HBc_P-E Product feature CHAIN FN545841_HBc_P-E of FT:mat_peptide FN545841_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN545842_HBc_P-E Product feature CHAIN FN545842_HBc_P-E of FT:mat_peptide FN545842_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTAQALFRDALESPEHCSPHHTALRQAILCWGDLMSLATWVGTNLDDPA
SRDXVVSYVNTNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594748_HBc_P-E Product feature CHAIN FN594748_HBc_P-E of FT:mat_peptide FN594748_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESSEHCSTHPAALRQAILCWGDLMNLGTWVGGNLEDQA
SRDAVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594749_HBc_P-E Product feature CHAIN FN594749_HBc_P-E of FT:mat_peptide FN594749_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASTLYRDALESPPHCSPSHTALRQAVLCWGDVMNLATGVGTNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594750_HBc_P-E Product feature CHAIN FN594750_HBc_P-E of FT:mat_peptide FN594750_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPXHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594751_HBc_P-E Product feature CHAIN FN594751_HBc_P-E of FT:mat_peptide FN594751_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne52H). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSXHPAALRQAILCWGDLMNLATWVGANLDDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGTPTVVEYLVSFGVWIRTPIAYRPPNAPILSTLPEHTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594752_HBc_P-E Product feature CHAIN FN594752_HBc_P-E of FT:mat_peptide FN594752_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne134). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSSXHLPLRQAILCWGDVMNLATWVGVNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594753_HBc_P-E Product feature CHAIN FN594753_HBc_P-E of FT:mat_peptide FN594753_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne137). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMNMATWVGVNLQDQA
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|FN594756_HBc_P-E Product feature CHAIN FN594756_HBc_P-E of FT:mat_peptide FN594756_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne250). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDIMNIATWVGANLEDQA
SRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594758_HBc_P-E Product feature CHAIN FN594758_HBc_P-E of FT:mat_peptide FN594758_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne341). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSXHHTALRQAILCWGDLMNLATWVGANLEDPS
SRELVVGYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594759_HBc_P-E Product feature CHAIN FN594759_HBc_P-E of FT:mat_peptide FN594759_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne342). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVZLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSXHTTALRQALLCWGDLMNLATWVGANLEDPS
SRELVVGYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594760_HBc_P-E Product feature CHAIN FN594760_HBc_P-E of FT:mat_peptide FN594760_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne362). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSXHHTALRQAILCWGDLMNLATWVGANLEDPS
SRELVVGYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594761_HBc_P-E Product feature CHAIN FN594761_HBc_P-E of FT:mat_peptide FN594761_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne385). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAXXELLSFLPSDFFPSVRDLLDTASALCRGALESPEHCSPHHTALRQAILCWGDLMNLATWVGANLEDPA
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRDVVIEYLVSFGVWIRTPIAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594762_HBc_P-E Product feature CHAIN FN594762_HBc_P-E of FT:mat_peptide FN594762_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne439). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHSALRQAVLCWGDLMNLATWVGVNLEDPA
SRDLVVSYVNTDMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPIPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594763_HBc_P-E Product feature CHAIN FN594763_HBc_P-E of FT:mat_peptide FN594763_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne446). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHNTALRQAILCWGDLMNLATWVGANLDDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGTPTVVEYLVSFGVWIRTPIAYRPPNAPILSTLPEHTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594765_HBc_P-E Product feature CHAIN FN594765_HBc_P-E of FT:mat_peptide FN594765_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne9447). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVKDLLDTASALYRDALESSEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDQVVSYVNTNMGVKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|FN594766_HBc_P-E Product feature CHAIN FN594766_HBc_P-E of FT:mat_peptide FN594766_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne9449). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALKSPEHCSPHHTALRQAILCWGDLMNLATWVGANLEDQA
SRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161755_HBc_P-E Product feature CHAIN GQ161755_HBc_P-E of FT:mat_peptide GQ161755_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1694). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGDALESPEHCSPHHTALRQAILCWGELMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161756_HBc_P-E Product feature CHAIN GQ161756_HBc_P-E of FT:mat_peptide GQ161756_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1684). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAFRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161757_HBc_P-E Product feature CHAIN GQ161757_HBc_P-E of FT:mat_peptide GQ161757_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1156). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLITLSTWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161758_HBc_P-E Product feature CHAIN GQ161758_HBc_P-E of FT:mat_peptide GQ161758_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1506). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161759_HBc_P-E Product feature CHAIN GQ161759_HBc_P-E of FT:mat_peptide GQ161759_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU934). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161760_HBc_P-E Product feature CHAIN GQ161760_HBc_P-E of FT:mat_peptide GQ161760_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1374). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161761_HBc_P-E Product feature CHAIN GQ161761_HBc_P-E of FT:mat_peptide GQ161761_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1033). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161762_HBc_P-E Product feature CHAIN GQ161762_HBc_P-E of FT:mat_peptide GQ161762_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU716). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161763_HBc_P-E Product feature CHAIN GQ161763_HBc_P-E of FT:mat_peptide GQ161763_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1013). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161764_HBc_P-E Product feature CHAIN GQ161764_HBc_P-E of FT:mat_peptide GQ161764_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1056). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161765_HBc_P-E Product feature CHAIN GQ161765_HBc_P-E of FT:mat_peptide GQ161765_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU952). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161766_HBc_P-E Product feature CHAIN GQ161766_HBc_P-E of FT:mat_peptide GQ161766_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1671). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161768_HBc_P-E Product feature CHAIN GQ161768_HBc_P-E of FT:mat_peptide GQ161768_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU960). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMNLATWVGVNLQDPA
SRDQVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|GQ161769_HBc_P-E Product feature CHAIN GQ161769_HBc_P-E of FT:mat_peptide GQ161769_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU865). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161770_HBc_P-E Product feature CHAIN GQ161770_HBc_P-E of FT:mat_peptide GQ161770_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU927). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161771_HBc_P-E Product feature CHAIN GQ161771_HBc_P-E of FT:mat_peptide GQ161771_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU896). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161772_HBc_P-E Product feature CHAIN GQ161772_HBc_P-E of FT:mat_peptide GQ161772_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU873). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161773_HBc_P-E Product feature CHAIN GQ161773_HBc_P-E of FT:mat_peptide GQ161773_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1406). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPS
SRELVVSYVNTNMGLKFRQLLWFHISCLTFGRQVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161774_HBc_P-E Product feature CHAIN GQ161774_HBc_P-E of FT:mat_peptide GQ161774_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1501). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161775_HBc_P-E Product feature CHAIN GQ161775_HBc_P-E of FT:mat_peptide GQ161775_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU754). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHVSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|GQ161776_HBc_P-E Product feature CHAIN GQ161776_HBc_P-E of FT:mat_peptide GQ161776_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1178). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161777_HBc_P-E Product feature CHAIN GQ161777_HBc_P-E of FT:mat_peptide GQ161777_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU807). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161778_HBc_P-E Product feature CHAIN GQ161778_HBc_P-E of FT:mat_peptide GQ161778_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1035). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|GQ161779_HBc_P-E Product feature CHAIN GQ161779_HBc_P-E of FT:mat_peptide GQ161779_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU557). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161780_HBc_P-E Product feature CHAIN GQ161780_HBc_P-E of FT:mat_peptide GQ161780_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU50). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGGWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRS
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161781_HBc_P-E Product feature CHAIN GQ161781_HBc_P-E of FT:mat_peptide GQ161781_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU200). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161782_HBc_P-E Product feature CHAIN GQ161782_HBc_P-E of FT:mat_peptide GQ161782_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1489). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161783_HBc_P-E Product feature CHAIN GQ161783_HBc_P-E of FT:mat_peptide GQ161783_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU981). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPS
SRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSPASQC
>gnl|hbvpro|GQ161784_HBc_P-E Product feature CHAIN GQ161784_HBc_P-E of FT:mat_peptide GQ161784_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU766). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161785_HBc_P-E Product feature CHAIN GQ161785_HBc_P-E of FT:mat_peptide GQ161785_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU758). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSAHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161786_HBc_P-E Product feature CHAIN GQ161786_HBc_P-E of FT:mat_peptide GQ161786_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1688). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTGPALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLQDQA
SRDLVVNYVNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPLNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161787_HBc_P-E Product feature CHAIN GQ161787_HBc_P-E of FT:mat_peptide GQ161787_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU841). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161789_HBc_P-E Product feature CHAIN GQ161789_HBc_P-E of FT:mat_peptide GQ161789_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1169). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161790_HBc_P-E Product feature CHAIN GQ161790_HBc_P-E of FT:mat_peptide GQ161790_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1408). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161791_HBc_P-E Product feature CHAIN GQ161791_HBc_P-E of FT:mat_peptide GQ161791_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU459). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPCRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161792_HBc_P-E Product feature CHAIN GQ161792_HBc_P-E of FT:mat_peptide GQ161792_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU605). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNIALKFRQLLWFHISCLTFGREPVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161793_HBc_P-E Product feature CHAIN GQ161793_HBc_P-E of FT:mat_peptide GQ161793_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU932). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161794_HBc_P-E Product feature CHAIN GQ161794_HBc_P-E of FT:mat_peptide GQ161794_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU846). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESHEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161795_HBc_P-E Product feature CHAIN GQ161795_HBc_P-E of FT:mat_peptide GQ161795_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1558). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161796_HBc_P-E Product feature CHAIN GQ161796_HBc_P-E of FT:mat_peptide GQ161796_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1146). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLGTWVGANLDDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|GQ161797_HBc_P-E Product feature CHAIN GQ161797_HBc_P-E of FT:mat_peptide GQ161797_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1660). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQAIICWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161798_HBc_P-E Product feature CHAIN GQ161798_HBc_P-E of FT:mat_peptide GQ161798_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1222). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161800_HBc_P-E Product feature CHAIN GQ161800_HBc_P-E of FT:mat_peptide GQ161800_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1039). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161801_HBc_P-E Product feature CHAIN GQ161801_HBc_P-E of FT:mat_peptide GQ161801_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU438). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGEVMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161802_HBc_P-E Product feature CHAIN GQ161802_HBc_P-E of FT:mat_peptide GQ161802_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU921). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPS
SRELVVSYVNTNMGLKFRQLLWFHISCLTFGRQVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161803_HBc_P-E Product feature CHAIN GQ161803_HBc_P-E of FT:mat_peptide GQ161803_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1700). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161804_HBc_P-E Product feature CHAIN GQ161804_HBc_P-E of FT:mat_peptide GQ161804_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1428). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161807_HBc_P-E Product feature CHAIN GQ161807_HBc_P-E of FT:mat_peptide GQ161807_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1168). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDQVVSYVNDNIALKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSPASQC
>gnl|hbvpro|GQ161808_HBc_P-E Product feature CHAIN GQ161808_HBc_P-E of FT:mat_peptide GQ161808_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1398). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161810_HBc_P-E Product feature CHAIN GQ161810_HBc_P-E of FT:mat_peptide GQ161810_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU852). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|GQ161811_HBc_P-E Product feature CHAIN GQ161811_HBc_P-E of FT:mat_peptide GQ161811_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1361). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPA
SRDLVVGYVNTNMGIRFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161812_HBc_P-E Product feature CHAIN GQ161812_HBc_P-E of FT:mat_peptide GQ161812_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1577). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDSASAMFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREAVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161814_HBc_P-E Product feature CHAIN GQ161814_HBc_P-E of FT:mat_peptide GQ161814_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU625). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRELLVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRQRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161815_HBc_P-E Product feature CHAIN GQ161815_HBc_P-E of FT:mat_peptide GQ161815_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1241). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGXLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSCGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161816_HBc_P-E Product feature CHAIN GQ161816_HBc_P-E of FT:mat_peptide GQ161816_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1214). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161817_HBc_P-E Product feature CHAIN GQ161817_HBc_P-E of FT:mat_peptide GQ161817_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU630). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161819_HBc_P-E Product feature CHAIN GQ161819_HBc_P-E of FT:mat_peptide GQ161819_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1062). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161820_HBc_P-E Product feature CHAIN GQ161820_HBc_P-E of FT:mat_peptide GQ161820_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1089). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSXHHTALRQAILCWGEXMTLATWVGVNLEDPA
SRDLVVSYVNXNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPXYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161823_HBc_P-E Product feature CHAIN GQ161823_HBc_P-E of FT:mat_peptide GQ161823_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU3397). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYEEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLGTWVGVNLEDQA
SRDRVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSPASQC
>gnl|hbvpro|GQ161824_HBc_P-E Product feature CHAIN GQ161824_HBc_P-E of FT:mat_peptide GQ161824_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU893). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPS
SRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRKSQSPASQC
>gnl|hbvpro|GQ161825_HBc_P-E Product feature CHAIN GQ161825_HBc_P-E of FT:mat_peptide GQ161825_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1769). Complete genome. [Hepadnaviridae] (length=182 residues).
MDLDPYKEFGATVELLSFLPGDFFPSVRDLLYTASALYRDALESPEHCSPHHTALRQAILCWGDVMNLATWVGANLEDPV
SRDLVVSYVNNNMGLKFRQLLWVHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRPSRSYRRRTP
SPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161826_HBc_P-E Product feature CHAIN GQ161826_HBc_P-E of FT:mat_peptide GQ161826_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU607). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLYTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161827_HBc_P-E Product feature CHAIN GQ161827_HBc_P-E of FT:mat_peptide GQ161827_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU180). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161828_HBc_P-E Product feature CHAIN GQ161828_HBc_P-E of FT:mat_peptide GQ161828_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1399). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161829_HBc_P-E Product feature CHAIN GQ161829_HBc_P-E of FT:mat_peptide GQ161829_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU719). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161831_HBc_P-E Product feature CHAIN GQ161831_HBc_P-E of FT:mat_peptide GQ161831_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU779). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPA
SRDVVVNYVNTNIALKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161832_HBc_P-E Product feature CHAIN GQ161832_HBc_P-E of FT:mat_peptide GQ161832_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1091). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161833_HBc_P-E Product feature CHAIN GQ161833_HBc_P-E of FT:mat_peptide GQ161833_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU489). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTTPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161834_HBc_P-E Product feature CHAIN GQ161834_HBc_P-E of FT:mat_peptide GQ161834_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1128). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHGSPHHTALRQAILCWGDLMTLATWVGENLEDPA
SRDLVVSYVNTNAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161835_HBc_P-E Product feature CHAIN GQ161835_HBc_P-E of FT:mat_peptide GQ161835_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU925). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESLEHCSPHHTALRQAILCWGELMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161836_HBc_P-E Product feature CHAIN GQ161836_HBc_P-E of FT:mat_peptide GQ161836_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1051). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ491112_HBc_P-E Product feature CHAIN GQ491112_HBc_P-E of FT:mat_peptide GQ491112_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8804335). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLDDQA
SRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVHEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSKSPASQC
>gnl|hbvpro|HM363565_HBc_P-E Product feature CHAIN HM363565_HBc_P-E of FT:mat_peptide HM363565_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A186). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPLDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGANLDDPG
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASHC
>gnl|hbvpro|HM363566_HBc_P-E Product feature CHAIN HM363566_HBc_P-E of FT:mat_peptide HM363566_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1082). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHVSHHHTALRQAILCWGDIMNIATWVGANLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363567_HBc_P-E Product feature CHAIN HM363567_HBc_P-E of FT:mat_peptide HM363567_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C16). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363568_HBc_P-E Product feature CHAIN HM363568_HBc_P-E of FT:mat_peptide HM363568_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C98). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363569_HBc_P-E Product feature CHAIN HM363569_HBc_P-E of FT:mat_peptide HM363569_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A51). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSPASQC
>gnl|hbvpro|HM363570_HBc_P-E Product feature CHAIN HM363570_HBc_P-E of FT:mat_peptide HM363570_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A85). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSKSPRRRRSQSPASQC
>gnl|hbvpro|HM363571_HBc_P-E Product feature CHAIN HM363571_HBc_P-E of FT:mat_peptide HM363571_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363572_HBc_P-E Product feature CHAIN HM363572_HBc_P-E of FT:mat_peptide HM363572_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363573_HBc_P-E Product feature CHAIN HM363573_HBc_P-E of FT:mat_peptide HM363573_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363574_HBc_P-E Product feature CHAIN HM363574_HBc_P-E of FT:mat_peptide HM363574_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V70). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363575_HBc_P-E Product feature CHAIN HM363575_HBc_P-E of FT:mat_peptide HM363575_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V30). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLYGDALQSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|HM363576_HBc_P-E Product feature CHAIN HM363576_HBc_P-E of FT:mat_peptide HM363576_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V43). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLCGDALESPEHCSPHHTELRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|HM363577_HBc_P-E Product feature CHAIN HM363577_HBc_P-E of FT:mat_peptide HM363577_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C19). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363578_HBc_P-E Product feature CHAIN HM363578_HBc_P-E of FT:mat_peptide HM363578_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL802). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSAHHTALRQAVLCWGELMTLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASHC
>gnl|hbvpro|HM363579_HBc_P-E Product feature CHAIN HM363579_HBc_P-E of FT:mat_peptide HM363579_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A32). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363580_HBc_P-E Product feature CHAIN HM363580_HBc_P-E of FT:mat_peptide HM363580_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A79). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363581_HBc_P-E Product feature CHAIN HM363581_HBc_P-E of FT:mat_peptide HM363581_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A84). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363582_HBc_P-E Product feature CHAIN HM363582_HBc_P-E of FT:mat_peptide HM363582_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL314). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363583_HBc_P-E Product feature CHAIN HM363583_HBc_P-E of FT:mat_peptide HM363583_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V137). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363584_HBc_P-E Product feature CHAIN HM363584_HBc_P-E of FT:mat_peptide HM363584_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V129). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363585_HBc_P-E Product feature CHAIN HM363585_HBc_P-E of FT:mat_peptide HM363585_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1455). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363586_HBc_P-E Product feature CHAIN HM363586_HBc_P-E of FT:mat_peptide HM363586_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A227). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363587_HBc_P-E Product feature CHAIN HM363587_HBc_P-E of FT:mat_peptide HM363587_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V195). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQVILCWGDLMTLATWVGGNLEDQT
SRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363588_HBc_P-E Product feature CHAIN HM363588_HBc_P-E of FT:mat_peptide HM363588_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A100). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363589_HBc_P-E Product feature CHAIN HM363589_HBc_P-E of FT:mat_peptide HM363589_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A178). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363590_HBc_P-E Product feature CHAIN HM363590_HBc_P-E of FT:mat_peptide HM363590_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V119). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363591_HBc_P-E Product feature CHAIN HM363591_HBc_P-E of FT:mat_peptide HM363591_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A114). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363592_HBc_P-E Product feature CHAIN HM363592_HBc_P-E of FT:mat_peptide HM363592_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A153). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363593_HBc_P-E Product feature CHAIN HM363593_HBc_P-E of FT:mat_peptide HM363593_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1577). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363594_HBc_P-E Product feature CHAIN HM363594_HBc_P-E of FT:mat_peptide HM363594_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V157). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALFRDALESPEHCSPHHTALRQAIICWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363595_HBc_P-E Product feature CHAIN HM363595_HBc_P-E of FT:mat_peptide HM363595_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1219). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLIDTASALYRDAFESPEHCSPYHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363596_HBc_P-E Product feature CHAIN HM363596_HBc_P-E of FT:mat_peptide HM363596_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V87). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALFRDALESPEHCSPHHTALRQAIICWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363597_HBc_P-E Product feature CHAIN HM363597_HBc_P-E of FT:mat_peptide HM363597_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A112). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTHHHTAIRQAIICWGELMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363598_HBc_P-E Product feature CHAIN HM363598_HBc_P-E of FT:mat_peptide HM363598_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V15). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGGTVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDQG
SRDLVVSYVNNHMGLKFRQLMWFHISCLTFGREIVLEFLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363599_HBc_P-E Product feature CHAIN HM363599_HBc_P-E of FT:mat_peptide HM363599_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V144). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLIFGRDVVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363600_HBc_P-E Product feature CHAIN HM363600_HBc_P-E of FT:mat_peptide HM363600_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALEGPEHCTPHHTALRQAIICWGELMTLATWVGVNLDDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|HM363601_HBc_P-E Product feature CHAIN HM363601_HBc_P-E of FT:mat_peptide HM363601_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL911). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDQA
SRDLIVSYVNSSMGLKFRQIFWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363602_HBc_P-E Product feature CHAIN HM363602_HBc_P-E of FT:mat_peptide HM363602_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A231). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MVIDPYKEFGASVELLSFLPSDFFPSVRDLIDTASALYRDAFESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVVEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRRRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363603_HBc_P-E Product feature CHAIN HM363603_HBc_P-E of FT:mat_peptide HM363603_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1274). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAQALYRDALESSEHCSPHHTALRQAILCWGDLMSLGTWVGGNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASHC
>gnl|hbvpro|HM363604_HBc_P-E Product feature CHAIN HM363604_HBc_P-E of FT:mat_peptide HM363604_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A28). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALFRDALESPDHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENAVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363605_HBc_P-E Product feature CHAIN HM363605_HBc_P-E of FT:mat_peptide HM363605_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C58). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLDDPA
SRDLVVSYVNTHMGLKFRQLLWFHLSCLMFGRDTVVEYLVSFGVWIRTPIAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|HM363606_HBc_P-E Product feature CHAIN HM363606_HBc_P-E of FT:mat_peptide HM363606_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V64). Complete genome. [Hepadnaviridae] (length=183 residues).
MVIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHWSPHHTALRHVILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363607_HBc_P-E Product feature CHAIN HM363607_HBc_P-E of FT:mat_peptide HM363607_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C78). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDIIDTASGLFRDAFESLEHCSPYHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTHMGLKFRQLLWFHFSCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPSSHC
>gnl|hbvpro|HM363608_HBc_P-E Product feature CHAIN HM363608_HBc_P-E of FT:mat_peptide HM363608_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A212). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDVMNLATWVGANLEDPT
SRDLVVSYVNTHMGLKTRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363609_HBc_P-E Product feature CHAIN HM363609_HBc_P-E of FT:mat_peptide HM363609_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A58). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLVTAPARNRNALEFPEHCSTQPTAIRPSLFCWGELMTLATWVGVNLEDPS
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363610_HBc_P-E Product feature CHAIN HM363610_HBc_P-E of FT:mat_peptide HM363610_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C113). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSVRDLLDTAAALFRDAFESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLFWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363611_HBc_P-E Product feature CHAIN HM363611_HBc_P-E of FT:mat_peptide HM363611_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A67). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEGPA
SRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGREVVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPGRRT
PSPRRRRPQSPRRRRSQSPSSQC
>gnl|hbvpro|HQ700550_HBc_P-E Product feature CHAIN HQ700550_HBc_P-E of FT:mat_peptide HQ700550_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_A032a). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HQ700551_HBc_P-E Product feature CHAIN HQ700551_HBc_P-E of FT:mat_peptide HQ700551_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_F017A). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HQ700552_HBc_P-E Product feature CHAIN HQ700552_HBc_P-E of FT:mat_peptide HQ700552_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_030). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JQ000008_HBc_P-E Product feature CHAIN JQ000008_HBc_P-E of FT:mat_peptide JQ000008_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JQ000009_HBc_P-E Product feature CHAIN JQ000009_HBc_P-E of FT:mat_peptide JQ000009_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWLHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF170741_HBc_P-E Product feature CHAIN KF170741_HBc_P-E of FT:mat_peptide KF170741_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_047). Complete genome. [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSQPPPLE
>gnl|hbvpro|KF170742_HBc_P-E Product feature CHAIN KF170742_HBc_P-E of FT:mat_peptide KF170742_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_125). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF798259_HBc_P-E Product feature CHAIN KF798259_HBc_P-E of FT:mat_peptide KF798259_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798270_HBc_P-E Product feature CHAIN KF798270_HBc_P-E of FT:mat_peptide KF798270_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798275_HBc_P-E Product feature CHAIN KF798275_HBc_P-E of FT:mat_peptide KF798275_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798298_HBc_P-E Product feature CHAIN KF798298_HBc_P-E of FT:mat_peptide KF798298_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798305_HBc_P-E Product feature CHAIN KF798305_HBc_P-E of FT:mat_peptide KF798305_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-47). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTPHHTALRQAFLCWGELMTLATWVGANLEDQG
SRDLVVSYVNVNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPQPYRPPNAPILSTLPECTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF849713_HBc_P-E Product feature CHAIN KF849713_HBc_P-E of FT:mat_peptide KF849713_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA277). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRELLWFHISCLTLGRETVXDYLVSFGVWIPTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849714_HBc_P-E Product feature CHAIN KF849714_HBc_P-E of FT:mat_peptide KF849714_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA439). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELXSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849715_HBc_P-E Product feature CHAIN KF849715_HBc_P-E of FT:mat_peptide KF849715_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA445). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849716_HBc_P-E Product feature CHAIN KF849716_HBc_P-E of FT:mat_peptide KF849716_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA278). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFXQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849717_HBc_P-E Product feature CHAIN KF849717_HBc_P-E of FT:mat_peptide KF849717_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA504). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849718_HBc_P-E Product feature CHAIN KF849718_HBc_P-E of FT:mat_peptide KF849718_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA72). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQXILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849719_HBc_P-E Product feature CHAIN KF849719_HBc_P-E of FT:mat_peptide KF849719_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA154). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849720_HBc_P-E Product feature CHAIN KF849720_HBc_P-E of FT:mat_peptide KF849720_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA265). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MVIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849721_HBc_P-E Product feature CHAIN KF849721_HBc_P-E of FT:mat_peptide KF849721_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA379). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849722_HBc_P-E Product feature CHAIN KF849722_HBc_P-E of FT:mat_peptide KF849722_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA386). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849723_HBc_P-E Product feature CHAIN KF849723_HBc_P-E of FT:mat_peptide KF849723_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA173). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849724_HBc_P-E Product feature CHAIN KF849724_HBc_P-E of FT:mat_peptide KF849724_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA274). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAVLCWGELMNLATWVGANLQDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849725_HBc_P-E Product feature CHAIN KF849725_HBc_P-E of FT:mat_peptide KF849725_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA399). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQACLCWGDVMNLATWVGVNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849726_HBc_P-E Product feature CHAIN KF849726_HBc_P-E of FT:mat_peptide KF849726_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA417). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAIICWGELMTLATWVGVNLEDPS
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSSLPECTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849727_HBc_P-E Product feature CHAIN KF849727_HBc_P-E of FT:mat_peptide KF849727_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA405). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849728_HBc_P-E Product feature CHAIN KF849728_HBc_P-E of FT:mat_peptide KF849728_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA423). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDVMNLATWVGVNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASHC
>gnl|hbvpro|KF922438_HBc_P-E Product feature CHAIN KF922438_HBc_P-E of FT:mat_peptide KF922438_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PO04v1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF922439_HBc_P-E Product feature CHAIN KF922439_HBc_P-E of FT:mat_peptide KF922439_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PO04v2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASPC
>gnl|hbvpro|KM606738_HBc_P-E Product feature CHAIN KM606738_HBc_P-E of FT:mat_peptide KM606738_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Cuba27a). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KM606739_HBc_P-E Product feature CHAIN KM606739_HBc_P-E of FT:mat_peptide KM606739_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Cuba32a). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPVHVSPHHTALRQAILCWGDVMSLATWVGVNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSHRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KP856973_HBc_P-E Product feature CHAIN KP856973_HBc_P-E of FT:mat_peptide KP856973_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYRQALESPEHCSPHHTAIRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP856982_HBc_P-E Product feature CHAIN KP856982_HBc_P-E of FT:mat_peptide KP856982_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPQGYRPPNAPILSTLPETTVIRGRRRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP856998_HBc_P-E Product feature CHAIN KP856998_HBc_P-E of FT:mat_peptide KP856998_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATIELLSFLPSDFYPSVRDLLDTASALYREALESQDHCSPHHTALRQAILCWGELMNLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVAEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|KP857001_HBc_P-E Product feature CHAIN KP857001_HBc_P-E of FT:mat_peptide KP857001_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857010_HBc_P-E Product feature CHAIN KP857010_HBc_P-E of FT:mat_peptide KP857010_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPT
SRDLVVSYVNTNMGLKFRQLLWFHLSCLMFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVXRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857011_HBc_P-E Product feature CHAIN KP857011_HBc_P-E of FT:mat_peptide KP857011_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPG
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857055_HBc_P-E Product feature CHAIN KP857055_HBc_P-E of FT:mat_peptide KP857055_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQAVLCWGDLMSLATWVGVNLEDQA
SRDLIVSYVNNNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVLRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KT192626_HBc_P-E Product feature CHAIN KT192626_HBc_P-E of FT:mat_peptide KT192626_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASPC
>gnl|hbvpro|KT749841_HBc_P-E Product feature CHAIN KT749841_HBc_P-E of FT:mat_peptide KT749841_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate FL11). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPA
SRDLVVSYVNTTIGLKFRQLLWFHISCLTFGRDIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736891_HBc_P-E Product feature CHAIN KU736891_HBc_P-E of FT:mat_peptide KU736891_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736892_HBc_P-E Product feature CHAIN KU736892_HBc_P-E of FT:mat_peptide KU736892_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMNLATWVGVNLEDPV
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736893_HBc_P-E Product feature CHAIN KU736893_HBc_P-E of FT:mat_peptide KU736893_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Ethiopia_3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRXRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736894_HBc_P-E Product feature CHAIN KU736894_HBc_P-E of FT:mat_peptide KU736894_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736895_HBc_P-E Product feature CHAIN KU736895_HBc_P-E of FT:mat_peptide KU736895_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLXFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736896_HBc_P-E Product feature CHAIN KU736896_HBc_P-E of FT:mat_peptide KU736896_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736897_HBc_P-E Product feature CHAIN KU736897_HBc_P-E of FT:mat_peptide KU736897_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736898_HBc_P-E Product feature CHAIN KU736898_HBc_P-E of FT:mat_peptide KU736898_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736899_HBc_P-E Product feature CHAIN KU736899_HBc_P-E of FT:mat_peptide KU736899_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736900_HBc_P-E Product feature CHAIN KU736900_HBc_P-E of FT:mat_peptide KU736900_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Somalia_2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736901_HBc_P-E Product feature CHAIN KU736901_HBc_P-E of FT:mat_peptide KU736901_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_1). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736902_HBc_P-E Product feature CHAIN KU736902_HBc_P-E of FT:mat_peptide KU736902_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_12). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736903_HBc_P-E Product feature CHAIN KU736903_HBc_P-E of FT:mat_peptide KU736903_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_13). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736904_HBc_P-E Product feature CHAIN KU736904_HBc_P-E of FT:mat_peptide KU736904_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_16). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRTQSPRRRRSQSPASQC
>gnl|hbvpro|KU736905_HBc_P-E Product feature CHAIN KU736905_HBc_P-E of FT:mat_peptide KU736905_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_17). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736906_HBc_P-E Product feature CHAIN KU736906_HBc_P-E of FT:mat_peptide KU736906_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_2). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736907_HBc_P-E Product feature CHAIN KU736907_HBc_P-E of FT:mat_peptide KU736907_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_3). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736908_HBc_P-E Product feature CHAIN KU736908_HBc_P-E of FT:mat_peptide KU736908_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_5). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736909_HBc_P-E Product feature CHAIN KU736909_HBc_P-E of FT:mat_peptide KU736909_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_6). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMXLATWVGVNLEDPA
SRDLVVSYVNTXMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736910_HBc_P-E Product feature CHAIN KU736910_HBc_P-E of FT:mat_peptide KU736910_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_8). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISXLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736911_HBc_P-E Product feature CHAIN KU736911_HBc_P-E of FT:mat_peptide KU736911_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_9). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVZLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736912_HBc_P-E Product feature CHAIN KU736912_HBc_P-E of FT:mat_peptide KU736912_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_4). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDIMTIXTWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736913_HBc_P-E Product feature CHAIN KU736913_HBc_P-E of FT:mat_peptide KU736913_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPA
SRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASXC
>gnl|hbvpro|KX186584_HBc_P-E Product feature CHAIN KX186584_HBc_P-E of FT:mat_peptide KX186584_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Eafr). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KY271392_HBc_P-E Product feature CHAIN KY271392_HBc_P-E of FT:mat_peptide KY271392_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C34082). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTIVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623842_HBc_P-E Product feature CHAIN LT623842_HBc_P-E of FT:mat_peptide LT623842_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHXSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPXNAPILSTLPEXTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|LT623843_HBc_P-E Product feature CHAIN LT623843_HBc_P-E of FT:mat_peptide LT623843_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTARALFRDALESPEHCSPHHTALRQAILCWGDLMXLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623844_HBc_P-E Product feature CHAIN LT623844_HBc_P-E of FT:mat_peptide LT623844_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMNLATWVGVNLEDPA
SRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSXSPRRRRSQSPASQC
>gnl|hbvpro|LT623845_HBc_P-E Product feature CHAIN LT623845_HBc_P-E of FT:mat_peptide LT623845_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRXGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623846_HBc_P-E Product feature CHAIN LT623846_HBc_P-E of FT:mat_peptide LT623846_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPXYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623847_HBc_P-E Product feature CHAIN LT623847_HBc_P-E of FT:mat_peptide LT623847_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVQLLSFLPPDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDIMNIATWVGANLEDQT
SRDLVVSYVNTNMGIKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623848_HBc_P-E Product feature CHAIN LT623848_HBc_P-E of FT:mat_peptide LT623848_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPXAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623849_HBc_P-E Product feature CHAIN LT623849_HBc_P-E of FT:mat_peptide LT623849_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIXTPXAYRPPNAPILSTLPEXTVVRRRGRSPRRRT
PSPXRRRSQSPRXRRSQSPXSQC
>gnl|hbvpro|LT623850_HBc_P-E Product feature CHAIN LT623850_HBc_P-E of FT:mat_peptide LT623850_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623851_HBc_P-E Product feature CHAIN LT623851_HBc_P-E of FT:mat_peptide LT623851_HBc_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCSPHHTALRQAIXCWGELMTLATWVGANLXDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRXPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MF772354_HBc_P-E Product feature CHAIN MF772354_HBc_P-E of FT:mat_peptide MF772354_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1067). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MF772355_HBc_P-E Product feature CHAIN MF772355_HBc_P-E of FT:mat_peptide MF772355_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 488). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSAHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKXRQLLWFHISCLTFGRDVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MF772356_HBc_P-E Product feature CHAIN MF772356_HBc_P-E of FT:mat_peptide MF772356_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1834). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPPDFFPSVKDLLDTASALFRDALESGEHCSPHHTALRHAFLCWGDLMSLATWVGVNLEDQA
SRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPSSQC
>gnl|hbvpro|MF772357_HBc_P-E Product feature CHAIN MF772357_HBc_P-E of FT:mat_peptide MF772357_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 222). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHFSPHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPIAYRPQNAPILSTLPETTVIRRRVRSPRRRT
PSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|MF772358_HBc_P-E Product feature CHAIN MF772358_HBc_P-E of FT:mat_peptide MF772358_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 2255). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPADFYPSVKDLLDSATALFRDALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDQA
SRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRPPRGRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MF772359_HBc_P-E Product feature CHAIN MF772359_HBc_P-E of FT:mat_peptide MF772359_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 335). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKELGATVELLSFLHNDFFPSLRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPA
SRDLVVNYVNSHMGIKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVRQRGRTPRRRT
PSPRRRRSQSPRRRRSQSPASHC
>gnl|hbvpro|MF772360_HBc_P-E Product feature CHAIN MF772360_HBc_P-E of FT:mat_peptide MF772360_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 666). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MF772361_HBc_P-E Product feature CHAIN MF772361_HBc_P-E of FT:mat_peptide MF772361_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 801). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRHDLESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDQA
SRDLVVNYVNINVGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRKRSQSPASKC
>gnl|hbvpro|MF772362_HBc_P-E Product feature CHAIN MF772362_HBc_P-E of FT:mat_peptide MF772362_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 960). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MG491180_HBc_P-E Product feature CHAIN MG491180_HBc_P-E of FT:mat_peptide MG491180_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ShrSan59CC). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=181 residues).
MDLDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPT
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRT
PSPRRRRSQSPRRRRSPSRGS
>gnl|hbvpro|MH464855_HBc_P-E Product feature CHAIN MH464855_HBc_P-E of FT:mat_peptide MH464855_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA133). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
IDPYXXFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASR
DLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRXXXRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH464856_HBc_P-E Product feature CHAIN MH464856_HBc_P-E of FT:mat_peptide MH464856_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA134). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKGFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISSLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRXXXRSPRR
RTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580614_HBc_P-E Product feature CHAIN MH580614_HBc_P-E of FT:mat_peptide MH580614_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 177). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580615_HBc_P-E Product feature CHAIN MH580615_HBc_P-E of FT:mat_peptide MH580615_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 188). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580616_HBc_P-E Product feature CHAIN MH580616_HBc_P-E of FT:mat_peptide MH580616_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 190). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580617_HBc_P-E Product feature CHAIN MH580617_HBc_P-E of FT:mat_peptide MH580617_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 193). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580618_HBc_P-E Product feature CHAIN MH580618_HBc_P-E of FT:mat_peptide MH580618_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 199). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580619_HBc_P-E Product feature CHAIN MH580619_HBc_P-E of FT:mat_peptide MH580619_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 200). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580620_HBc_P-E Product feature CHAIN MH580620_HBc_P-E of FT:mat_peptide MH580620_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 201). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580621_HBc_P-E Product feature CHAIN MH580621_HBc_P-E of FT:mat_peptide MH580621_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 209). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580622_HBc_P-E Product feature CHAIN MH580622_HBc_P-E of FT:mat_peptide MH580622_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 210). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580623_HBc_P-E Product feature CHAIN MH580623_HBc_P-E of FT:mat_peptide MH580623_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 232). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580624_HBc_P-E Product feature CHAIN MH580624_HBc_P-E of FT:mat_peptide MH580624_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 226). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580625_HBc_P-E Product feature CHAIN MH580625_HBc_P-E of FT:mat_peptide MH580625_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 239). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580626_HBc_P-E Product feature CHAIN MH580626_HBc_P-E of FT:mat_peptide MH580626_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 240). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSPHHTALRQAILCWGDLMNLGTWVGGNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETSVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580628_HBc_P-E Product feature CHAIN MH580628_HBc_P-E of FT:mat_peptide MH580628_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 304). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580629_HBc_P-E Product feature CHAIN MH580629_HBc_P-E of FT:mat_peptide MH580629_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 306). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580630_HBc_P-E Product feature CHAIN MH580630_HBc_P-E of FT:mat_peptide MH580630_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 310). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580631_HBc_P-E Product feature CHAIN MH580631_HBc_P-E of FT:mat_peptide MH580631_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 333). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580632_HBc_P-E Product feature CHAIN MH580632_HBc_P-E of FT:mat_peptide MH580632_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 334). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580633_HBc_P-E Product feature CHAIN MH580633_HBc_P-E of FT:mat_peptide MH580633_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 398). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580634_HBc_P-E Product feature CHAIN MH580634_HBc_P-E of FT:mat_peptide MH580634_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 400). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580635_HBc_P-E Product feature CHAIN MH580635_HBc_P-E of FT:mat_peptide MH580635_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 401). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580636_HBc_P-E Product feature CHAIN MH580636_HBc_P-E of FT:mat_peptide MH580636_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 402). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580637_HBc_P-E Product feature CHAIN MH580637_HBc_P-E of FT:mat_peptide MH580637_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 408). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580638_HBc_P-E Product feature CHAIN MH580638_HBc_P-E of FT:mat_peptide MH580638_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 416). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580640_HBc_P-E Product feature CHAIN MH580640_HBc_P-E of FT:mat_peptide MH580640_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 438). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPAAQC
>gnl|hbvpro|MH580641_HBc_P-E Product feature CHAIN MH580641_HBc_P-E of FT:mat_peptide MH580641_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 439). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPAAQC
>gnl|hbvpro|MH580644_HBc_P-E Product feature CHAIN MH580644_HBc_P-E of FT:mat_peptide MH580644_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 458). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580645_HBc_P-E Product feature CHAIN MH580645_HBc_P-E of FT:mat_peptide MH580645_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 472). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPG
SRELVVSYVNTHMGLKFRQLMWFHISCLTFGRELVVEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRSRGRSSRRRT
PSPRRRRSQSPRRRRSQSPAPRC
>gnl|hbvpro|MH580646_HBc_P-E Product feature CHAIN MH580646_HBc_P-E of FT:mat_peptide MH580646_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 476). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580647_HBc_P-E Product feature CHAIN MH580647_HBc_P-E of FT:mat_peptide MH580647_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 490). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580648_HBc_P-E Product feature CHAIN MH580648_HBc_P-E of FT:mat_peptide MH580648_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 522). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPPDFFPSVKDLLDTISALFRDALESPEHCSPHHTAIRQAILCWGNLMNLATWVGVNLEDQA
SRDLVVSYVNTNMGLQFRQLLWFHMSCIIFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPSSQC
>gnl|hbvpro|MH580649_HBc_P-E Product feature CHAIN MH580649_HBc_P-E of FT:mat_peptide MH580649_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 523). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580650_HBc_P-E Product feature CHAIN MH580650_HBc_P-E of FT:mat_peptide MH580650_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 619). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580651_HBc_P-E Product feature CHAIN MH580651_HBc_P-E of FT:mat_peptide MH580651_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 623). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580652_HBc_P-E Product feature CHAIN MH580652_HBc_P-E of FT:mat_peptide MH580652_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 668). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725010_HBc_P-E Product feature CHAIN MH725010_HBc_P-E of FT:mat_peptide MH725010_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-263). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725020_HBc_P-E Product feature CHAIN MH725020_HBc_P-E of FT:mat_peptide MH725020_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-298). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725021_HBc_P-E Product feature CHAIN MH725021_HBc_P-E of FT:mat_peptide MH725021_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-311). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725024_HBc_P-E Product feature CHAIN MH725024_HBc_P-E of FT:mat_peptide MH725024_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-321). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725042_HBc_P-E Product feature CHAIN MH725042_HBc_P-E of FT:mat_peptide MH725042_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-387). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725114_HBc_P-E Product feature CHAIN MH725114_HBc_P-E of FT:mat_peptide MH725114_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-870). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725141_HBc_P-E Product feature CHAIN MH725141_HBc_P-E of FT:mat_peptide MH725141_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-1227). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPDHCSPHHTALRQAILCWGELMTLATWVGGNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725192_HBc_P-E Product feature CHAIN MH725192_HBc_P-E of FT:mat_peptide MH725192_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-1435). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSSHHTALRQAILCWGDLMSLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPAPQC
>gnl|hbvpro|MK321264_HBc_P-E Product feature CHAIN MK321264_HBc_P-E of FT:mat_peptide MK321264_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1332). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|X75657_HBc_P-E Product feature CHAIN X75657_HBc_P-E of FT:mat_peptide X75657_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Bas). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|X85274_HBc_P-E Product feature CHAIN X85274_HBc_P-E of FT:mat_peptide X85274_HBc_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient Tedde'89). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPNDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPT
SRDVVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRT
PSPRRRRSQSPRRRRSQSRESQC
© 1998-2019