HBVdb

Dataset for protein HBe of genotype E

[Download (right click)] [Alignment] [Repertoires]

366 sequence(s)

>gnl|hbvpro|AB091255_HBe_P-E Product feature CHAIN AB091255_HBe_P-E of FT:mat_peptide AB091255_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-129). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB091256_HBe_P-E Product feature CHAIN AB091256_HBe_P-E of FT:mat_peptide AB091256_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-212). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB106564_HBe_C-E Product feature CHAIN AB106564_HBe_C-E of FT:mat_peptide AB106564_HBe_C-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA325). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFDLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVWIPTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB194947_HBe_P-E Product feature CHAIN AB194947_HBe_P-E of FT:mat_peptide AB194947_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR954). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB201287_HBe_P-E Product feature CHAIN AB201287_HBe_P-E of FT:mat_peptide AB201287_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin11). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB201288_HBe_P-E Product feature CHAIN AB201288_HBe_P-E of FT:mat_peptide AB201288_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin89). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB201289_HBe_P-E Product feature CHAIN AB201289_HBe_P-E of FT:mat_peptide AB201289_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin269). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB201290_HBe_P-E Product feature CHAIN AB201290_HBe_P-E of FT:mat_peptide AB201290_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin293). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQVILCWGDLMTLATWVGVNLDDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205129_HBe_P-E Product feature CHAIN AB205129_HBe_P-E of FT:mat_peptide AB205129_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758-2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205188_HBe_P-E Product feature CHAIN AB205188_HBe_P-E of FT:mat_peptide AB205188_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA283). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMNLGTWVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPA
YRPPNAPIVSTLPENTVVRRRSRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205189_HBe_P-E Product feature CHAIN AB205189_HBe_P-E of FT:mat_peptide AB205189_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G138). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205190_HBe_P-E Product feature CHAIN AB205190_HBe_P-E of FT:mat_peptide AB205190_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G123). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205191_HBe_P-E Product feature CHAIN AB205191_HBe_P-E of FT:mat_peptide AB205191_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G166). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB205192_HBe_P-E Product feature CHAIN AB205192_HBe_P-E of FT:mat_peptide AB205192_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274969_HBe_P-E Product feature CHAIN AB274969_HBe_P-E of FT:mat_peptide AB274969_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274970_HBe_P-E Product feature CHAIN AB274970_HBe_P-E of FT:mat_peptide AB274970_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274971_HBe_P-E Product feature CHAIN AB274971_HBe_P-E of FT:mat_peptide AB274971_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274972_HBe_P-E Product feature CHAIN AB274972_HBe_P-E of FT:mat_peptide AB274972_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALREAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB274973_HBe_P-E Product feature CHAIN AB274973_HBe_P-E of FT:mat_peptide AB274973_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB915175_HBe_P-E Product feature CHAIN AB915175_HBe_P-E of FT:mat_peptide AB915175_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AB915178_HBe_P-E Product feature CHAIN AB915178_HBe_P-E of FT:mat_peptide AB915178_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDAIESPEHCSPH
HTALRQAIICWGDLMSLATWVGENLQDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPLNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AF350099_HBe_P-E Product feature CHAIN AF350099_HBe_P-E of FT:mat_peptide AF350099_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4102). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350100_HBe_P-E Product feature CHAIN AF350100_HBe_P-E of FT:mat_peptide AF350100_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350101_HBe_P-E Product feature CHAIN AF350101_HBe_P-E of FT:mat_peptide AF350101_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4527). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETAIEYLVSFGVWIRTPQA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350102_HBe_P-E Product feature CHAIN AF350102_HBe_P-E of FT:mat_peptide AF350102_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4537). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350103_HBe_P-E Product feature CHAIN AF350103_HBe_P-E of FT:mat_peptide AF350103_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4531). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350105_HBe_P-E Product feature CHAIN AF350105_HBe_P-E of FT:mat_peptide AF350105_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4550). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHRSPH
HTALRQAILCWGELMTLATWVGVNLEDPASKDLVVSYANTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350106_HBe_P-E Product feature CHAIN AF350106_HBe_P-E of FT:mat_peptide AF350106_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4607). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350107_HBe_P-E Product feature CHAIN AF350107_HBe_P-E of FT:mat_peptide AF350107_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4625). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPN
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350108_HBe_P-E Product feature CHAIN AF350108_HBe_P-E of FT:mat_peptide AF350108_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4628). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350109_HBe_P-E Product feature CHAIN AF350109_HBe_P-E of FT:mat_peptide AF350109_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4640). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREPVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350111_HBe_P-E Product feature CHAIN AF350111_HBe_P-E of FT:mat_peptide AF350111_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4539). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPENTVVRRRGRPPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350112_HBe_P-E Product feature CHAIN AF350112_HBe_P-E of FT:mat_peptide AF350112_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4618). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVEILSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350114_HBe_P-E Product feature CHAIN AF350114_HBe_P-E of FT:mat_peptide AF350114_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4697). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVCIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350115_HBe_P-E Product feature CHAIN AF350115_HBe_P-E of FT:mat_peptide AF350115_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1001F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350116_HBe_P-E Product feature CHAIN AF350116_HBe_P-E of FT:mat_peptide AF350116_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1002F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350117_HBe_P-E Product feature CHAIN AF350117_HBe_P-E of FT:mat_peptide AF350117_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1003F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHGSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350118_HBe_P-E Product feature CHAIN AF350118_HBe_P-E of FT:mat_peptide AF350118_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1011F5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350119_HBe_P-E Product feature CHAIN AF350119_HBe_P-E of FT:mat_peptide AF350119_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1013F5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350120_HBe_P-E Product feature CHAIN AF350120_HBe_P-E of FT:mat_peptide AF350120_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1073F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350121_HBe_P-E Product feature CHAIN AF350121_HBe_P-E of FT:mat_peptide AF350121_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1074F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350122_HBe_P-E Product feature CHAIN AF350122_HBe_P-E of FT:mat_peptide AF350122_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1076F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350123_HBe_P-E Product feature CHAIN AF350123_HBe_P-E of FT:mat_peptide AF350123_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1081F20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQAFKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSRH
HIALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350124_HBe_P-E Product feature CHAIN AF350124_HBe_P-E of FT:mat_peptide AF350124_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1099F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350125_HBe_P-E Product feature CHAIN AF350125_HBe_P-E of FT:mat_peptide AF350125_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1100F20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350126_HBe_P-E Product feature CHAIN AF350126_HBe_P-E of FT:mat_peptide AF350126_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350127_HBe_P-E Product feature CHAIN AF350127_HBe_P-E of FT:mat_peptide AF350127_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1119F29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350128_HBe_P-E Product feature CHAIN AF350128_HBe_P-E of FT:mat_peptide AF350128_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1121F29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350130_HBe_P-E Product feature CHAIN AF350130_HBe_P-E of FT:mat_peptide AF350130_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1127F28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350131_HBe_P-E Product feature CHAIN AF350131_HBe_P-E of FT:mat_peptide AF350131_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1129). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWISTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350132_HBe_P-E Product feature CHAIN AF350132_HBe_P-E of FT:mat_peptide AF350132_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1131F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350133_HBe_P-E Product feature CHAIN AF350133_HBe_P-E of FT:mat_peptide AF350133_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1132F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350134_HBe_P-E Product feature CHAIN AF350134_HBe_P-E of FT:mat_peptide AF350134_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1135F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350135_HBe_P-E Product feature CHAIN AF350135_HBe_P-E of FT:mat_peptide AF350135_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1136F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENIVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350136_HBe_P-E Product feature CHAIN AF350136_HBe_P-E of FT:mat_peptide AF350136_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1139). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350137_HBe_P-E Product feature CHAIN AF350137_HBe_P-E of FT:mat_peptide AF350137_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1142F33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350138_HBe_P-E Product feature CHAIN AF350138_HBe_P-E of FT:mat_peptide AF350138_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1143F33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350139_HBe_P-E Product feature CHAIN AF350139_HBe_P-E of FT:mat_peptide AF350139_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1145F33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTLQACKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350140_HBe_P-E Product feature CHAIN AF350140_HBe_P-E of FT:mat_peptide AF350140_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1149F34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350141_HBe_P-E Product feature CHAIN AF350141_HBe_P-E of FT:mat_peptide AF350141_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1152F34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350142_HBe_P-E Product feature CHAIN AF350142_HBe_P-E of FT:mat_peptide AF350142_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1157F35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350143_HBe_P-E Product feature CHAIN AF350143_HBe_P-E of FT:mat_peptide AF350143_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1158F35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350146_HBe_P-E Product feature CHAIN AF350146_HBe_P-E of FT:mat_peptide AF350146_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1167). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPY
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350147_HBe_P-E Product feature CHAIN AF350147_HBe_P-E of FT:mat_peptide AF350147_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1175F40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350148_HBe_P-E Product feature CHAIN AF350148_HBe_P-E of FT:mat_peptide AF350148_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1179F42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350149_HBe_P-E Product feature CHAIN AF350149_HBe_P-E of FT:mat_peptide AF350149_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1181F41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350150_HBe_P-E Product feature CHAIN AF350150_HBe_P-E of FT:mat_peptide AF350150_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1182F41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350151_HBe_P-E Product feature CHAIN AF350151_HBe_P-E of FT:mat_peptide AF350151_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1184F41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350152_HBe_P-E Product feature CHAIN AF350152_HBe_P-E of FT:mat_peptide AF350152_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1187F42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350153_HBe_P-E Product feature CHAIN AF350153_HBe_P-E of FT:mat_peptide AF350153_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1194). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTIGRETVIEYLVSFGVWIRTPPA
YRPPNAPISSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350154_HBe_P-E Product feature CHAIN AF350154_HBe_P-E of FT:mat_peptide AF350154_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1208). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVESLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350155_HBe_P-E Product feature CHAIN AF350155_HBe_P-E of FT:mat_peptide AF350155_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1211). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350156_HBe_P-E Product feature CHAIN AF350156_HBe_P-E of FT:mat_peptide AF350156_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1246F53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350157_HBe_P-E Product feature CHAIN AF350157_HBe_P-E of FT:mat_peptide AF350157_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1247F53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350158_HBe_P-E Product feature CHAIN AF350158_HBe_P-E of FT:mat_peptide AF350158_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1249F53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRSTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350159_HBe_P-E Product feature CHAIN AF350159_HBe_P-E of FT:mat_peptide AF350159_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1285). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350160_HBe_P-E Product feature CHAIN AF350160_HBe_P-E of FT:mat_peptide AF350160_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1288F61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350161_HBe_P-E Product feature CHAIN AF350161_HBe_P-E of FT:mat_peptide AF350161_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1307). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFNLCLIICCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALKQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350162_HBe_P-E Product feature CHAIN AF350162_HBe_P-E of FT:mat_peptide AF350162_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1325F81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350163_HBe_P-E Product feature CHAIN AF350163_HBe_P-E of FT:mat_peptide AF350163_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1326F81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350164_HBe_P-E Product feature CHAIN AF350164_HBe_P-E of FT:mat_peptide AF350164_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1327F81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYSVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350165_HBe_P-E Product feature CHAIN AF350165_HBe_P-E of FT:mat_peptide AF350165_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1328F82). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350166_HBe_P-E Product feature CHAIN AF350166_HBe_P-E of FT:mat_peptide AF350166_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1331). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350167_HBe_P-E Product feature CHAIN AF350167_HBe_P-E of FT:mat_peptide AF350167_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1348F82). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRGRRSQSRESQC
>gnl|hbvpro|AF350168_HBe_P-E Product feature CHAIN AF350168_HBe_P-E of FT:mat_peptide AF350168_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1349F90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350169_HBe_P-E Product feature CHAIN AF350169_HBe_P-E of FT:mat_peptide AF350169_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1352F90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350170_HBe_P-E Product feature CHAIN AF350170_HBe_P-E of FT:mat_peptide AF350170_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1353F89). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350171_HBe_P-E Product feature CHAIN AF350171_HBe_P-E of FT:mat_peptide AF350171_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1374). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350172_HBe_P-E Product feature CHAIN AF350172_HBe_P-E of FT:mat_peptide AF350172_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1376). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350173_HBe_P-E Product feature CHAIN AF350173_HBe_P-E of FT:mat_peptide AF350173_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1442). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSRRRRRSQSRESQC
>gnl|hbvpro|AF350174_HBe_P-E Product feature CHAIN AF350174_HBe_P-E of FT:mat_peptide AF350174_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1444). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350178_HBe_P-E Product feature CHAIN AF350178_HBe_P-E of FT:mat_peptide AF350178_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1482F89). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350179_HBe_P-E Product feature CHAIN AF350179_HBe_P-E of FT:mat_peptide AF350179_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1520). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350180_HBe_P-E Product feature CHAIN AF350180_HBe_P-E of FT:mat_peptide AF350180_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1522F137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPAPRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350181_HBe_P-E Product feature CHAIN AF350181_HBe_P-E of FT:mat_peptide AF350181_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1524F137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350182_HBe_P-E Product feature CHAIN AF350182_HBe_P-E of FT:mat_peptide AF350182_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1525F137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350183_HBe_P-E Product feature CHAIN AF350183_HBe_P-E of FT:mat_peptide AF350183_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1535). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350185_HBe_P-E Product feature CHAIN AF350185_HBe_P-E of FT:mat_peptide AF350185_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1557F61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350186_HBe_P-E Product feature CHAIN AF350186_HBe_P-E of FT:mat_peptide AF350186_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1560). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350188_HBe_P-E Product feature CHAIN AF350188_HBe_P-E of FT:mat_peptide AF350188_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1590). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRIRSQSRESQC
>gnl|hbvpro|AF350189_HBe_P-E Product feature CHAIN AF350189_HBe_P-E of FT:mat_peptide AF350189_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1594). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350190_HBe_P-E Product feature CHAIN AF350190_HBe_P-E of FT:mat_peptide AF350190_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1615). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350191_HBe_P-E Product feature CHAIN AF350191_HBe_P-E of FT:mat_peptide AF350191_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1654F172). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350192_HBe_P-E Product feature CHAIN AF350192_HBe_P-E of FT:mat_peptide AF350192_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1660F173). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350193_HBe_P-E Product feature CHAIN AF350193_HBe_P-E of FT:mat_peptide AF350193_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1664F174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350194_HBe_P-E Product feature CHAIN AF350194_HBe_P-E of FT:mat_peptide AF350194_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1665F174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350195_HBe_P-E Product feature CHAIN AF350195_HBe_P-E of FT:mat_peptide AF350195_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1670F172). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350196_HBe_P-E Product feature CHAIN AF350196_HBe_P-E of FT:mat_peptide AF350196_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1676F174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350197_HBe_P-E Product feature CHAIN AF350197_HBe_P-E of FT:mat_peptide AF350197_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1678). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350198_HBe_P-E Product feature CHAIN AF350198_HBe_P-E of FT:mat_peptide AF350198_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1682). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350199_HBe_P-E Product feature CHAIN AF350199_HBe_P-E of FT:mat_peptide AF350199_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1691). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350200_HBe_P-E Product feature CHAIN AF350200_HBe_P-E of FT:mat_peptide AF350200_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1713). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350201_HBe_P-E Product feature CHAIN AF350201_HBe_P-E of FT:mat_peptide AF350201_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1720). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350202_HBe_P-E Product feature CHAIN AF350202_HBe_P-E of FT:mat_peptide AF350202_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1722). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350203_HBe_P-E Product feature CHAIN AF350203_HBe_P-E of FT:mat_peptide AF350203_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1729F202). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350205_HBe_P-E Product feature CHAIN AF350205_HBe_P-E of FT:mat_peptide AF350205_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1821F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350206_HBe_P-E Product feature CHAIN AF350206_HBe_P-E of FT:mat_peptide AF350206_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1822F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCVTFGRETVIEYLVSFGVWIRTPPG
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350210_HBe_P-E Product feature CHAIN AF350210_HBe_P-E of FT:mat_peptide AF350210_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1828F219). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350212_HBe_P-E Product feature CHAIN AF350212_HBe_P-E of FT:mat_peptide AF350212_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1833F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350213_HBe_P-E Product feature CHAIN AF350213_HBe_P-E of FT:mat_peptide AF350213_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1834F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350214_HBe_P-E Product feature CHAIN AF350214_HBe_P-E of FT:mat_peptide AF350214_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1842). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350215_HBe_P-E Product feature CHAIN AF350215_HBe_P-E of FT:mat_peptide AF350215_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1847). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFWPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTAIRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350216_HBe_P-E Product feature CHAIN AF350216_HBe_P-E of FT:mat_peptide AF350216_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1862F231). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350217_HBe_P-E Product feature CHAIN AF350217_HBe_P-E of FT:mat_peptide AF350217_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1863F231). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350218_HBe_P-E Product feature CHAIN AF350218_HBe_P-E of FT:mat_peptide AF350218_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1872). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350219_HBe_P-E Product feature CHAIN AF350219_HBe_P-E of FT:mat_peptide AF350219_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1874F238). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTIATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350220_HBe_P-E Product feature CHAIN AF350220_HBe_P-E of FT:mat_peptide AF350220_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1876F238). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTIATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM494689_HBe_P-E Product feature CHAIN AM494689_HBe_P-E of FT:mat_peptide AM494689_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR006). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494690_HBe_P-E Product feature CHAIN AM494690_HBe_P-E of FT:mat_peptide AM494690_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR008). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494691_HBe_P-E Product feature CHAIN AM494691_HBe_P-E of FT:mat_peptide AM494691_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR024). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|AM494692_HBe_P-E Product feature CHAIN AM494692_HBe_P-E of FT:mat_peptide AM494692_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR026). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTALALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPEITVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494693_HBe_P-E Product feature CHAIN AM494693_HBe_P-E of FT:mat_peptide AM494693_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR039). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494694_HBe_P-E Product feature CHAIN AM494694_HBe_P-E of FT:mat_peptide AM494694_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR047). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494695_HBe_P-E Product feature CHAIN AM494695_HBe_P-E of FT:mat_peptide AM494695_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR053). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRETVVEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVIRHRGRSTRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494696_HBe_P-E Product feature CHAIN AM494696_HBe_P-E of FT:mat_peptide AM494696_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR060). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494697_HBe_P-E Product feature CHAIN AM494697_HBe_P-E of FT:mat_peptide AM494697_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR063). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494698_HBe_P-E Product feature CHAIN AM494698_HBe_P-E of FT:mat_peptide AM494698_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR066). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494699_HBe_P-E Product feature CHAIN AM494699_HBe_P-E of FT:mat_peptide AM494699_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR082). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494700_HBe_P-E Product feature CHAIN AM494700_HBe_P-E of FT:mat_peptide AM494700_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR083). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494701_HBe_P-E Product feature CHAIN AM494701_HBe_P-E of FT:mat_peptide AM494701_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR097). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494702_HBe_P-E Product feature CHAIN AM494702_HBe_P-E of FT:mat_peptide AM494702_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR106). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494703_HBe_P-E Product feature CHAIN AM494703_HBe_P-E of FT:mat_peptide AM494703_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR107). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDVMTLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPKRRTPSPRRRRSQSPRRRRSQSPSSQC
>gnl|hbvpro|AM494704_HBe_P-E Product feature CHAIN AM494704_HBe_P-E of FT:mat_peptide AM494704_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR112). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494705_HBe_P-E Product feature CHAIN AM494705_HBe_P-E of FT:mat_peptide AM494705_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR115). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494706_HBe_P-E Product feature CHAIN AM494706_HBe_P-E of FT:mat_peptide AM494706_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR131). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494707_HBe_P-E Product feature CHAIN AM494707_HBe_P-E of FT:mat_peptide AM494707_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR137). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494708_HBe_P-E Product feature CHAIN AM494708_HBe_P-E of FT:mat_peptide AM494708_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494709_HBe_P-E Product feature CHAIN AM494709_HBe_P-E of FT:mat_peptide AM494709_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR143). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494710_HBe_P-E Product feature CHAIN AM494710_HBe_P-E of FT:mat_peptide AM494710_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR144). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494711_HBe_P-E Product feature CHAIN AM494711_HBe_P-E of FT:mat_peptide AM494711_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR146). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494712_HBe_P-E Product feature CHAIN AM494712_HBe_P-E of FT:mat_peptide AM494712_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR150). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494713_HBe_P-E Product feature CHAIN AM494713_HBe_P-E of FT:mat_peptide AM494713_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR154). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494714_HBe_P-E Product feature CHAIN AM494714_HBe_P-E of FT:mat_peptide AM494714_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR165). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPSSQC
>gnl|hbvpro|AM494715_HBe_P-E Product feature CHAIN AM494715_HBe_P-E of FT:mat_peptide AM494715_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR171). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494717_HBe_P-E Product feature CHAIN AM494717_HBe_P-E of FT:mat_peptide AM494717_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR187). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AM494791_HBe_P-E Product feature CHAIN AM494791_HBe_P-E of FT:mat_peptide AM494791_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR001-1). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHWSPH
HSAIRQAILCWGELMTLATWVGVKLEDPASRDLVVSYVNTNLGLKFQQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTIPENTVVRRRGRSPRRRTSSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|AY738144_HBe_P-E Product feature CHAIN AY738144_HBe_P-E of FT:mat_peptide AY738144_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY738145_HBe_C-E Product feature CHAIN AY738145_HBe_C-E of FT:mat_peptide AY738145_HBe_C-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY738146_HBe_P-E Product feature CHAIN AY738146_HBe_P-E of FT:mat_peptide AY738146_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY738147_HBe_P-E Product feature CHAIN AY738147_HBe_P-E of FT:mat_peptide AY738147_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 10/98). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY739674_HBe_P-E Product feature CHAIN AY739674_HBe_P-E of FT:mat_peptide AY739674_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY739675_HBe_P-E Product feature CHAIN AY739675_HBe_P-E of FT:mat_peptide AY739675_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|AY935700_HBe_P-E Product feature CHAIN AY935700_HBe_P-E of FT:mat_peptide AY935700_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate TH-HBV-012). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDVMSLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060822_HBe_P-E Product feature CHAIN DQ060822_HBe_P-E of FT:mat_peptide DQ060822_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8510-91). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFDLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060823_HBe_P-E Product feature CHAIN DQ060823_HBe_P-E of FT:mat_peptide DQ060823_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8504-91). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFDLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060824_HBe_P-E Product feature CHAIN DQ060824_HBe_P-E of FT:mat_peptide DQ060824_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0121-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060825_HBe_P-E Product feature CHAIN DQ060825_HBe_P-E of FT:mat_peptide DQ060825_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0262-09). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060826_HBe_P-E Product feature CHAIN DQ060826_HBe_P-E of FT:mat_peptide DQ060826_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0433-20). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060827_HBe_P-E Product feature CHAIN DQ060827_HBe_P-E of FT:mat_peptide DQ060827_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0317-04). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060828_HBe_P-E Product feature CHAIN DQ060828_HBe_P-E of FT:mat_peptide DQ060828_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0443-03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060829_HBe_P-E Product feature CHAIN DQ060829_HBe_P-E of FT:mat_peptide DQ060829_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0350-03). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|DQ060830_HBe_P-E Product feature CHAIN DQ060830_HBe_P-E of FT:mat_peptide DQ060830_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 235-01). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFDLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239217_HBe_P-E Product feature CHAIN EU239217_HBe_P-E of FT:mat_peptide EU239217_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate G2451). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLGFHISCLTFGRETVIEYLVSFGVWIRTPSA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239219_HBe_P-E Product feature CHAIN EU239219_HBe_P-E of FT:mat_peptide EU239219_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239221_HBe_P-E Product feature CHAIN EU239221_HBe_P-E of FT:mat_peptide EU239221_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239223_HBe_P-E Product feature CHAIN EU239223_HBe_P-E of FT:mat_peptide EU239223_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDIMTIATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU239226_HBe_P-E Product feature CHAIN EU239226_HBe_P-E of FT:mat_peptide EU239226_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU620071_HBe_P-E Product feature CHAIN EU620071_HBe_P-E of FT:mat_peptide EU620071_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Irish-16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|EU726883_HBe_P-E Product feature CHAIN EU726883_HBe_P-E of FT:mat_peptide EU726883_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IR-RCGLD-7064). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDAYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349226_HBe_P-E Product feature CHAIN FJ349226_HBe_P-E of FT:mat_peptide FJ349226_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate H6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ349237_HBe_P-E Product feature CHAIN FJ349237_HBe_P-E of FT:mat_peptide FJ349237_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C27). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ349238_HBe_P-E Product feature CHAIN FJ349238_HBe_P-E of FT:mat_peptide FJ349238_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C65). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FJ349239_HBe_P-E Product feature CHAIN FJ349239_HBe_P-E of FT:mat_peptide FJ349239_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C74). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN545823_HBe_P-E Product feature CHAIN FN545823_HBe_P-E of FT:mat_peptide FN545823_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVXDLLDTASALFRDALESPEHCSPH
HTALRQAILCWGXLXXLATWVGVNLEDPASRDXVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPA
YRPQNAPILSTLPEXAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPAAQC
>gnl|hbvpro|FN545841_HBe_P-E Product feature CHAIN FN545841_HBe_P-E of FT:mat_peptide FN545841_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|FN594758_HBe_P-E Product feature CHAIN FN594758_HBe_P-E of FT:mat_peptide FN594758_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne341). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSXH
HTALRQAILCWGDLMNLATWVGANLEDPSSRELVVGYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161755_HBe_P-E Product feature CHAIN GQ161755_HBe_P-E of FT:mat_peptide GQ161755_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1694). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGDALESPEHCSPH
HTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161756_HBe_P-E Product feature CHAIN GQ161756_HBe_P-E of FT:mat_peptide GQ161756_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1684). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTAFRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161758_HBe_P-E Product feature CHAIN GQ161758_HBe_P-E of FT:mat_peptide GQ161758_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1506). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161759_HBe_P-E Product feature CHAIN GQ161759_HBe_P-E of FT:mat_peptide GQ161759_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU934). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161760_HBe_P-E Product feature CHAIN GQ161760_HBe_P-E of FT:mat_peptide GQ161760_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1374). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161761_HBe_P-E Product feature CHAIN GQ161761_HBe_P-E of FT:mat_peptide GQ161761_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1033). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161763_HBe_P-E Product feature CHAIN GQ161763_HBe_P-E of FT:mat_peptide GQ161763_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1013). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161764_HBe_P-E Product feature CHAIN GQ161764_HBe_P-E of FT:mat_peptide GQ161764_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1056). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161765_HBe_P-E Product feature CHAIN GQ161765_HBe_P-E of FT:mat_peptide GQ161765_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU952). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161766_HBe_P-E Product feature CHAIN GQ161766_HBe_P-E of FT:mat_peptide GQ161766_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1671). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161769_HBe_P-E Product feature CHAIN GQ161769_HBe_P-E of FT:mat_peptide GQ161769_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU865). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161770_HBe_P-E Product feature CHAIN GQ161770_HBe_P-E of FT:mat_peptide GQ161770_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU927). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161771_HBe_P-E Product feature CHAIN GQ161771_HBe_P-E of FT:mat_peptide GQ161771_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU896). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161772_HBe_P-E Product feature CHAIN GQ161772_HBe_P-E of FT:mat_peptide GQ161772_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU873). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161774_HBe_P-E Product feature CHAIN GQ161774_HBe_P-E of FT:mat_peptide GQ161774_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1501). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161776_HBe_P-E Product feature CHAIN GQ161776_HBe_P-E of FT:mat_peptide GQ161776_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1178). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161777_HBe_P-E Product feature CHAIN GQ161777_HBe_P-E of FT:mat_peptide GQ161777_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU807). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161778_HBe_P-E Product feature CHAIN GQ161778_HBe_P-E of FT:mat_peptide GQ161778_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1035). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|GQ161779_HBe_P-E Product feature CHAIN GQ161779_HBe_P-E of FT:mat_peptide GQ161779_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU557). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161780_HBe_P-E Product feature CHAIN GQ161780_HBe_P-E of FT:mat_peptide GQ161780_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU50). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGGWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRSPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161781_HBe_P-E Product feature CHAIN GQ161781_HBe_P-E of FT:mat_peptide GQ161781_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU200). Complete genome. [Hepadnaviridae] (length=212 residues).
MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161782_HBe_P-E Product feature CHAIN GQ161782_HBe_P-E of FT:mat_peptide GQ161782_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1489). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161784_HBe_P-E Product feature CHAIN GQ161784_HBe_P-E of FT:mat_peptide GQ161784_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU766). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161787_HBe_P-E Product feature CHAIN GQ161787_HBe_P-E of FT:mat_peptide GQ161787_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU841). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161789_HBe_P-E Product feature CHAIN GQ161789_HBe_P-E of FT:mat_peptide GQ161789_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1169). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161790_HBe_P-E Product feature CHAIN GQ161790_HBe_P-E of FT:mat_peptide GQ161790_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1408). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161791_HBe_P-E Product feature CHAIN GQ161791_HBe_P-E of FT:mat_peptide GQ161791_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU459). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPCRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161792_HBe_P-E Product feature CHAIN GQ161792_HBe_P-E of FT:mat_peptide GQ161792_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU605). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNIALKFRQLLWFHISCLTFGREPVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161793_HBe_P-E Product feature CHAIN GQ161793_HBe_P-E of FT:mat_peptide GQ161793_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU932). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161794_HBe_P-E Product feature CHAIN GQ161794_HBe_P-E of FT:mat_peptide GQ161794_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU846). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESHEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161795_HBe_P-E Product feature CHAIN GQ161795_HBe_P-E of FT:mat_peptide GQ161795_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1558). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161796_HBe_P-E Product feature CHAIN GQ161796_HBe_P-E of FT:mat_peptide GQ161796_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1146). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMNLGTWVGANLDDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|GQ161797_HBe_P-E Product feature CHAIN GQ161797_HBe_P-E of FT:mat_peptide GQ161797_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1660). Complete genome. [Hepadnaviridae] (length=212 residues).
TQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTAIRQAIICWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPP
YRPPNAPILSTLPEITVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161798_HBe_P-E Product feature CHAIN GQ161798_HBe_P-E of FT:mat_peptide GQ161798_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1222). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161800_HBe_P-E Product feature CHAIN GQ161800_HBe_P-E of FT:mat_peptide GQ161800_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1039). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161801_HBe_P-E Product feature CHAIN GQ161801_HBe_P-E of FT:mat_peptide GQ161801_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU438). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGEVMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161803_HBe_P-E Product feature CHAIN GQ161803_HBe_P-E of FT:mat_peptide GQ161803_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1700). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161804_HBe_P-E Product feature CHAIN GQ161804_HBe_P-E of FT:mat_peptide GQ161804_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1428). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161808_HBe_P-E Product feature CHAIN GQ161808_HBe_P-E of FT:mat_peptide GQ161808_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1398). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161810_HBe_P-E Product feature CHAIN GQ161810_HBe_P-E of FT:mat_peptide GQ161810_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU852). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|GQ161814_HBe_P-E Product feature CHAIN GQ161814_HBe_P-E of FT:mat_peptide GQ161814_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU625). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRELLVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRQRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161815_HBe_P-E Product feature CHAIN GQ161815_HBe_P-E of FT:mat_peptide GQ161815_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1241). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGXLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSCGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161816_HBe_P-E Product feature CHAIN GQ161816_HBe_P-E of FT:mat_peptide GQ161816_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1214). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161817_HBe_P-E Product feature CHAIN GQ161817_HBe_P-E of FT:mat_peptide GQ161817_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU630). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161819_HBe_P-E Product feature CHAIN GQ161819_HBe_P-E of FT:mat_peptide GQ161819_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1062). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161820_HBe_P-E Product feature CHAIN GQ161820_HBe_P-E of FT:mat_peptide GQ161820_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1089). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSXH
HTALRQAILCWGEXMTLATWVGVNLEDPASRDLVVSYVNXNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPX
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161826_HBe_P-E Product feature CHAIN GQ161826_HBe_P-E of FT:mat_peptide GQ161826_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU607). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLYTASALYRDALESPEHCSPH
HTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161827_HBe_P-E Product feature CHAIN GQ161827_HBe_P-E of FT:mat_peptide GQ161827_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU180). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161828_HBe_P-E Product feature CHAIN GQ161828_HBe_P-E of FT:mat_peptide GQ161828_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1399). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161829_HBe_P-E Product feature CHAIN GQ161829_HBe_P-E of FT:mat_peptide GQ161829_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU719). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161832_HBe_P-E Product feature CHAIN GQ161832_HBe_P-E of FT:mat_peptide GQ161832_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1091). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161833_HBe_P-E Product feature CHAIN GQ161833_HBe_P-E of FT:mat_peptide GQ161833_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU489). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTTPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161835_HBe_P-E Product feature CHAIN GQ161835_HBe_P-E of FT:mat_peptide GQ161835_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU925). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESLEHCSPH
HTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|GQ161836_HBe_P-E Product feature CHAIN GQ161836_HBe_P-E of FT:mat_peptide GQ161836_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1051). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363567_HBe_P-E Product feature CHAIN HM363567_HBe_P-E of FT:mat_peptide HM363567_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C16). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363568_HBe_P-E Product feature CHAIN HM363568_HBe_P-E of FT:mat_peptide HM363568_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C98). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363569_HBe_P-E Product feature CHAIN HM363569_HBe_P-E of FT:mat_peptide HM363569_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A51). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCACPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSKSPRRRRSQSPASQC
>gnl|hbvpro|HM363570_HBe_P-E Product feature CHAIN HM363570_HBe_P-E of FT:mat_peptide HM363570_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A85). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLSLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSKSPRRRRSQSPASQC
>gnl|hbvpro|HM363572_HBe_P-E Product feature CHAIN HM363572_HBe_P-E of FT:mat_peptide HM363572_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363573_HBe_P-E Product feature CHAIN HM363573_HBe_P-E of FT:mat_peptide HM363573_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363574_HBe_P-E Product feature CHAIN HM363574_HBe_P-E of FT:mat_peptide HM363574_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V70). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363575_HBe_P-E Product feature CHAIN HM363575_HBe_P-E of FT:mat_peptide HM363575_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V30). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLYGDALQSPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|HM363576_HBe_P-E Product feature CHAIN HM363576_HBe_P-E of FT:mat_peptide HM363576_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V43). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLCGDALESPEHCSPH
HTELRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPGSQC
>gnl|hbvpro|HM363577_HBe_P-E Product feature CHAIN HM363577_HBe_P-E of FT:mat_peptide HM363577_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C19). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363579_HBe_P-E Product feature CHAIN HM363579_HBe_P-E of FT:mat_peptide HM363579_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A32). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363580_HBe_P-E Product feature CHAIN HM363580_HBe_P-E of FT:mat_peptide HM363580_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A79). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363581_HBe_P-E Product feature CHAIN HM363581_HBe_P-E of FT:mat_peptide HM363581_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A84). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363582_HBe_P-E Product feature CHAIN HM363582_HBe_P-E of FT:mat_peptide HM363582_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL314). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363583_HBe_P-E Product feature CHAIN HM363583_HBe_P-E of FT:mat_peptide HM363583_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V137). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363584_HBe_P-E Product feature CHAIN HM363584_HBe_P-E of FT:mat_peptide HM363584_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V129). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363588_HBe_P-E Product feature CHAIN HM363588_HBe_P-E of FT:mat_peptide HM363588_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A100). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363589_HBe_P-E Product feature CHAIN HM363589_HBe_P-E of FT:mat_peptide HM363589_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A178). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTAQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363590_HBe_P-E Product feature CHAIN HM363590_HBe_P-E of FT:mat_peptide HM363590_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V119). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363591_HBe_P-E Product feature CHAIN HM363591_HBe_P-E of FT:mat_peptide HM363591_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A114). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363592_HBe_P-E Product feature CHAIN HM363592_HBe_P-E of FT:mat_peptide HM363592_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A153). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363593_HBe_P-E Product feature CHAIN HM363593_HBe_P-E of FT:mat_peptide HM363593_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1577). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPQNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363595_HBe_P-E Product feature CHAIN HM363595_HBe_P-E of FT:mat_peptide HM363595_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1219). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKMSLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLIDTASALYRDAFESPEHCSPY
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HM363604_HBe_P-E Product feature CHAIN HM363604_HBe_P-E of FT:mat_peptide HM363604_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A28). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALFRDALESPDHCSPH
HTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HQ700550_HBe_P-E Product feature CHAIN HQ700550_HBe_P-E of FT:mat_peptide HQ700550_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_A032a). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HQ700551_HBe_P-E Product feature CHAIN HQ700551_HBe_P-E of FT:mat_peptide HQ700551_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_F017A). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|HQ700552_HBe_P-E Product feature CHAIN HQ700552_HBe_P-E of FT:mat_peptide HQ700552_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_030). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JQ000008_HBe_P-E Product feature CHAIN JQ000008_HBe_P-E of FT:mat_peptide JQ000008_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|JQ000009_HBe_P-E Product feature CHAIN JQ000009_HBe_P-E of FT:mat_peptide JQ000009_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWLHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF170741_HBe_P-E Product feature CHAIN KF170741_HBe_P-E of FT:mat_peptide KF170741_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_047). Complete genome. [Hepadnaviridae] (length=213 residues).
MQLFHPCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSQPPPLE
>gnl|hbvpro|KF170742_HBe_P-E Product feature CHAIN KF170742_HBe_P-E of FT:mat_peptide KF170742_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_125). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF798259_HBe_P-E Product feature CHAIN KF798259_HBe_P-E of FT:mat_peptide KF798259_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798270_HBe_P-E Product feature CHAIN KF798270_HBe_P-E of FT:mat_peptide KF798270_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798275_HBe_P-E Product feature CHAIN KF798275_HBe_P-E of FT:mat_peptide KF798275_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798298_HBe_P-E Product feature CHAIN KF798298_HBe_P-E of FT:mat_peptide KF798298_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF849713_HBe_P-E Product feature CHAIN KF849713_HBe_P-E of FT:mat_peptide KF849713_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA277). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRELLWFHISCLTLGRETVXDYLVSFGVWIPTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849714_HBe_P-E Product feature CHAIN KF849714_HBe_P-E of FT:mat_peptide KF849714_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA439). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIIXXSXPTVQASKLCLGWLWGMDIDPYKEFGATVELXSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849715_HBe_P-E Product feature CHAIN KF849715_HBe_P-E of FT:mat_peptide KF849715_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA445). Complete genome. [Hepadnaviridae] (length=212 residues).
MLLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849716_HBe_P-E Product feature CHAIN KF849716_HBe_P-E of FT:mat_peptide KF849716_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA278). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFXQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849717_HBe_P-E Product feature CHAIN KF849717_HBe_P-E of FT:mat_peptide KF849717_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA504). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFDLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849719_HBe_P-E Product feature CHAIN KF849719_HBe_P-E of FT:mat_peptide KF849719_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA154). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849720_HBe_P-E Product feature CHAIN KF849720_HBe_P-E of FT:mat_peptide KF849720_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA265). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMVIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849721_HBe_P-E Product feature CHAIN KF849721_HBe_P-E of FT:mat_peptide KF849721_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA379). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849722_HBe_P-E Product feature CHAIN KF849722_HBe_P-E of FT:mat_peptide KF849722_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA386). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849723_HBe_P-E Product feature CHAIN KF849723_HBe_P-E of FT:mat_peptide KF849723_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA173). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849725_HBe_P-E Product feature CHAIN KF849725_HBe_P-E of FT:mat_peptide KF849725_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA399). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQACLCWGDVMNLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KF849727_HBe_P-E Product feature CHAIN KF849727_HBe_P-E of FT:mat_peptide KF849727_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA405). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KM606738_HBe_P-E Product feature CHAIN KM606738_HBe_P-E of FT:mat_peptide KM606738_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Cuba27a). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KT192626_HBe_P-E Product feature CHAIN KT192626_HBe_P-E of FT:mat_peptide KT192626_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASPC
>gnl|hbvpro|KU736891_HBe_P-E Product feature CHAIN KU736891_HBe_P-E of FT:mat_peptide KU736891_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736892_HBe_P-E Product feature CHAIN KU736892_HBe_P-E of FT:mat_peptide KU736892_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDVMNLATWVGVNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736893_HBe_P-E Product feature CHAIN KU736893_HBe_P-E of FT:mat_peptide KU736893_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Ethiopia_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRXRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736894_HBe_P-E Product feature CHAIN KU736894_HBe_P-E of FT:mat_peptide KU736894_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736895_HBe_P-E Product feature CHAIN KU736895_HBe_P-E of FT:mat_peptide KU736895_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLXFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736896_HBe_P-E Product feature CHAIN KU736896_HBe_P-E of FT:mat_peptide KU736896_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736897_HBe_P-E Product feature CHAIN KU736897_HBe_P-E of FT:mat_peptide KU736897_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736898_HBe_P-E Product feature CHAIN KU736898_HBe_P-E of FT:mat_peptide KU736898_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736899_HBe_P-E Product feature CHAIN KU736899_HBe_P-E of FT:mat_peptide KU736899_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736900_HBe_P-E Product feature CHAIN KU736900_HBe_P-E of FT:mat_peptide KU736900_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Somalia_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736901_HBe_P-E Product feature CHAIN KU736901_HBe_P-E of FT:mat_peptide KU736901_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_1). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736902_HBe_P-E Product feature CHAIN KU736902_HBe_P-E of FT:mat_peptide KU736902_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_12). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736903_HBe_P-E Product feature CHAIN KU736903_HBe_P-E of FT:mat_peptide KU736903_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_13). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736904_HBe_P-E Product feature CHAIN KU736904_HBe_P-E of FT:mat_peptide KU736904_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_16). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRTQSPRRRRSQSPASQC
>gnl|hbvpro|KU736905_HBe_P-E Product feature CHAIN KU736905_HBe_P-E of FT:mat_peptide KU736905_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_17). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736906_HBe_P-E Product feature CHAIN KU736906_HBe_P-E of FT:mat_peptide KU736906_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_2). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736907_HBe_P-E Product feature CHAIN KU736907_HBe_P-E of FT:mat_peptide KU736907_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_3). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736908_HBe_P-E Product feature CHAIN KU736908_HBe_P-E of FT:mat_peptide KU736908_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_5). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736909_HBe_P-E Product feature CHAIN KU736909_HBe_P-E of FT:mat_peptide KU736909_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_6). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMXLATWVGVNLEDPASRDLVVSYVNTXMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPXA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736910_HBe_P-E Product feature CHAIN KU736910_HBe_P-E of FT:mat_peptide KU736910_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_8). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISXLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736911_HBe_P-E Product feature CHAIN KU736911_HBe_P-E of FT:mat_peptide KU736911_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_9). Complete genome. [Hepadnaviridae] (length=212 residues).
MXLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVZLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KU736912_HBe_P-E Product feature CHAIN KU736912_HBe_P-E of FT:mat_peptide KU736912_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_4). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDIMTIXTWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|KX186584_HBe_P-E Product feature CHAIN KX186584_HBe_P-E of FT:mat_peptide KX186584_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Eafr). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623842_HBe_P-E Product feature CHAIN LT623842_HBe_P-E of FT:mat_peptide LT623842_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLXDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHXSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTA
YRPXNAPILSTLPEXTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASKC
>gnl|hbvpro|LT623846_HBe_P-E Product feature CHAIN LT623846_HBe_P-E of FT:mat_peptide LT623846_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPX
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623847_HBe_P-E Product feature CHAIN LT623847_HBe_P-E of FT:mat_peptide LT623847_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTLQASKLCLGWLWDMDIDPYKEFGATVQLLSFLPPDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDIMNIATWVGANLEDQTSRDLVVSYVNTNMGIKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623848_HBe_P-E Product feature CHAIN LT623848_HBe_P-E of FT:mat_peptide LT623848_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPXA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|LT623849_HBe_P-E Product feature CHAIN LT623849_HBe_P-E of FT:mat_peptide LT623849_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIXTPXA
YRPPNAPILSTLPEXTVVRRRGRSPRRRTPSPXRRRSQSPRXRRSQSPXSQC
>gnl|hbvpro|LT623850_HBe_P-E Product feature CHAIN LT623850_HBe_P-E of FT:mat_peptide LT623850_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MF772354_HBe_P-E Product feature CHAIN MF772354_HBe_P-E of FT:mat_peptide MF772354_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1067). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MF772357_HBe_P-E Product feature CHAIN MF772357_HBe_P-E of FT:mat_peptide MF772357_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 222). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHFSPH
HTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPIA
YRPQNAPILSTLPETTVIRRRVRSPRRRTPSPRRRRSQSPRRRRSQSPASRC
>gnl|hbvpro|MF772360_HBe_P-E Product feature CHAIN MF772360_HBe_P-E of FT:mat_peptide MF772360_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 666). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAVLCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MF772362_HBe_P-E Product feature CHAIN MF772362_HBe_P-E of FT:mat_peptide MF772362_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 960). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH464856_HBe_P-E Product feature CHAIN MH464856_HBe_P-E of FT:mat_peptide MH464856_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA134). Complete genome. [Hepadnaviridae] (length=214 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKGFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISSLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRXXXRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580614_HBe_P-E Product feature CHAIN MH580614_HBe_P-E of FT:mat_peptide MH580614_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 177). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580615_HBe_P-E Product feature CHAIN MH580615_HBe_P-E of FT:mat_peptide MH580615_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 188). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580616_HBe_P-E Product feature CHAIN MH580616_HBe_P-E of FT:mat_peptide MH580616_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 190). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580617_HBe_P-E Product feature CHAIN MH580617_HBe_P-E of FT:mat_peptide MH580617_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 193). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580618_HBe_P-E Product feature CHAIN MH580618_HBe_P-E of FT:mat_peptide MH580618_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 199). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580619_HBe_P-E Product feature CHAIN MH580619_HBe_P-E of FT:mat_peptide MH580619_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 200). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580620_HBe_P-E Product feature CHAIN MH580620_HBe_P-E of FT:mat_peptide MH580620_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 201). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580621_HBe_P-E Product feature CHAIN MH580621_HBe_P-E of FT:mat_peptide MH580621_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 209). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580622_HBe_P-E Product feature CHAIN MH580622_HBe_P-E of FT:mat_peptide MH580622_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 210). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580623_HBe_P-E Product feature CHAIN MH580623_HBe_P-E of FT:mat_peptide MH580623_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 232). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580624_HBe_P-E Product feature CHAIN MH580624_HBe_P-E of FT:mat_peptide MH580624_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 226). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580625_HBe_P-E Product feature CHAIN MH580625_HBe_P-E of FT:mat_peptide MH580625_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 239). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580626_HBe_P-E Product feature CHAIN MH580626_HBe_P-E of FT:mat_peptide MH580626_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 240). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFDLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSPH
HTALRQAILCWGDLMNLGTWVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPETSVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580628_HBe_P-E Product feature CHAIN MH580628_HBe_P-E of FT:mat_peptide MH580628_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 304). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580629_HBe_P-E Product feature CHAIN MH580629_HBe_P-E of FT:mat_peptide MH580629_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 306). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580630_HBe_P-E Product feature CHAIN MH580630_HBe_P-E of FT:mat_peptide MH580630_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 310). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580631_HBe_P-E Product feature CHAIN MH580631_HBe_P-E of FT:mat_peptide MH580631_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 333). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580632_HBe_P-E Product feature CHAIN MH580632_HBe_P-E of FT:mat_peptide MH580632_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 334). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580633_HBe_P-E Product feature CHAIN MH580633_HBe_P-E of FT:mat_peptide MH580633_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 398). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580634_HBe_P-E Product feature CHAIN MH580634_HBe_P-E of FT:mat_peptide MH580634_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 400). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISRSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580635_HBe_P-E Product feature CHAIN MH580635_HBe_P-E of FT:mat_peptide MH580635_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 401). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580636_HBe_P-E Product feature CHAIN MH580636_HBe_P-E of FT:mat_peptide MH580636_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 402). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580637_HBe_P-E Product feature CHAIN MH580637_HBe_P-E of FT:mat_peptide MH580637_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 408). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580638_HBe_P-E Product feature CHAIN MH580638_HBe_P-E of FT:mat_peptide MH580638_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 416). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580640_HBe_P-E Product feature CHAIN MH580640_HBe_P-E of FT:mat_peptide MH580640_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 438). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPAAQC
>gnl|hbvpro|MH580641_HBe_P-E Product feature CHAIN MH580641_HBe_P-E of FT:mat_peptide MH580641_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 439). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPAAQC
>gnl|hbvpro|MH580644_HBe_P-E Product feature CHAIN MH580644_HBe_P-E of FT:mat_peptide MH580644_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 458). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580646_HBe_P-E Product feature CHAIN MH580646_HBe_P-E of FT:mat_peptide MH580646_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 476). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580647_HBe_P-E Product feature CHAIN MH580647_HBe_P-E of FT:mat_peptide MH580647_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 490). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580649_HBe_P-E Product feature CHAIN MH580649_HBe_P-E of FT:mat_peptide MH580649_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 523). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580650_HBe_P-E Product feature CHAIN MH580650_HBe_P-E of FT:mat_peptide MH580650_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 619). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580651_HBe_P-E Product feature CHAIN MH580651_HBe_P-E of FT:mat_peptide MH580651_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 623). Non-functional genomic sequence. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH580652_HBe_P-E Product feature CHAIN MH580652_HBe_P-E of FT:mat_peptide MH580652_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 668). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725010_HBe_P-E Product feature CHAIN MH725010_HBe_P-E of FT:mat_peptide MH725010_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-263). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725020_HBe_P-E Product feature CHAIN MH725020_HBe_P-E of FT:mat_peptide MH725020_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-298). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725021_HBe_P-E Product feature CHAIN MH725021_HBe_P-E of FT:mat_peptide MH725021_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-311). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725024_HBe_P-E Product feature CHAIN MH725024_HBe_P-E of FT:mat_peptide MH725024_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-321). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725042_HBe_P-E Product feature CHAIN MH725042_HBe_P-E of FT:mat_peptide MH725042_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-387). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725114_HBe_P-E Product feature CHAIN MH725114_HBe_P-E of FT:mat_peptide MH725114_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-870). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|MH725141_HBe_P-E Product feature CHAIN MH725141_HBe_P-E of FT:mat_peptide MH725141_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-1227). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPDHCSPH
HTALRQAILCWGELMTLATWVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH725192_HBe_P-E Product feature CHAIN MH725192_HBe_P-E of FT:mat_peptide MH725192_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-1435). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSSH
HTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPAPQC
>gnl|hbvpro|MK321264_HBe_P-E Product feature CHAIN MK321264_HBe_P-E of FT:mat_peptide MK321264_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1332). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
>gnl|hbvpro|X75657_HBe_P-E Product feature CHAIN X75657_HBe_P-E of FT:mat_peptide X75657_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Bas). Complete genome. [Hepadnaviridae] (length=212 residues).
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPH
HTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPA
YRPPNAPILSTLPENTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
© 1998-2019